[Bio] / FigWebPages / group_name_desc_seq.html Repository:
ViewVC logotype

View of /FigWebPages/group_name_desc_seq.html

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.2 - (download) (as text) (annotate)
Thu Jul 26 20:48:51 2007 UTC (12 years, 2 months ago) by disz
Branch: MAIN
CVS Tags: rast_rel_2014_0912, rast_rel_2008_06_18, rast_rel_2008_06_16, rast_rel_2008_07_21, rast_rel_2010_0928, rast_2008_0924, rast_rel_2008_09_30, rast_rel_2010_0526, rast_rel_2014_0729, rast_rel_2009_05_18, rast_rel_2009_0925, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2009_02_05, rast_rel_2011_0119, rast_rel_2008_12_18, rast_rel_2008_10_09, rast_release_2008_09_29, rast_rel_2008_04_23, rast_rel_2008_08_07, rast_rel_2009_07_09, rast_rel_2010_0827, myrast_33, rast_rel_2011_0928, rast_rel_2008_09_29, rast_rel_2008_10_29, rast_rel_2009_03_26, rast_rel_2008_11_24, HEAD
Changes since 1.1: +273 -272 lines
Jensen file

CG1	Aact	    fig|714.2.peg.737_Actinobacillus actinomycetemcomitans HK1651 	IVIVGGRGKLGSLFCRYLKGSGYQVKCLERDDWARADQILQHADVVIVSVPIANTLAVIERLKPYLTENMLLADFTSVKRTPLEKMLEVHKGAVVGLHPMFGPDVASMAKQVVVCCDGRFSERYQWLLQQIQIWGAKIYQVDATEHDHHMTYIQALRHFSTFVYGLYLSQQPVDLEKLLALSSPIYRLELAMVGRLFAQDAALYADIIAHKPENLAVIEHFKDSYETGLAFFKHHDRQGFIEQFNQIRDWFGGYSEQF
CGO	Aaeo	    fig|224324.1.peg.1217_Aquifex aeolicus VF5 	NVLIVGVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSPDFVMLSSPVRTFREIAKKLSYILSEDATVTDQGSVKGKLVYDLENILGKRFVGGHPIAGTEKSGVEYSLDNLYEGKKVILTPTKKTDKKRLKLVKRVWEDVGGVVEYMSPELHDYVFGVVSHLPHAVAFALVDTLIHMSTPEVDLFKYPGGGFKDFTRIAKSDPIMWRDIFLENKENVMKAIEGFEKSLNHLKELIVREAEEELVEYLKEVKIKRMEI
CG10	Aave	    gi#120611939_Acidovorax avenae subsp. citrulli AAC00-1 	QLGLLGCGLMGGSFALAMKKAGLVKRVVGYSKSPSTTDRARQLGVIDVEAPSALLAVAGADIVLLAVPVAATESTLKAIKHLVTPKMLIMDVGSTKADVVQAARGALRDQFGSFVPAHPITGSEASGVEHAQADLYAGRQVILTPTERTLTDQLGKAEAVWSALGCRVRSMSPESHDAAFAAVSHLPHLLAFALINSINAQPEGDVFLSLAGPGFRDFTRIAASDPKIWRDILLANRDELLAQSRHFAQALQQMEQAMQQGDGQGLEDLITLASETRAHWRMG
CG17	Abal	    gi#46275288_Amycolatopsis balhimycina	KALVVGTGLIGTSVALALREKGVAVFLSDVDTEAARLAQVLGAGREWAGEGVDLAVIAVPPHLVGDRLADLQKQGAARVYTDVASVKADPIADAERLGCDLASYVPGHPLAGRERSGPAAARAELFSGRPWALCPGPETDAEALRRVRELVSLCGATAVVVGAGEHDSAVALVSHAPHVVASAVAASLASGDDVALGLAGQGLRDVTRIAAGDPLLWRRILSGNTRPVAGVLERIAADLAAAASALRSGDLDEVTDLLRRGVDGHGRI
CG24	Acap	    No fig or gi#_Acidobacterium capsulatum ATCC 51196 	RIAILGTGLIGASAGMALRLHGFQGSITGWDPRPEEAATAQRVGAIGEIATDAVTLAKSSDVVVLAGPVLTMLDWLERLAPVLGPHQLVTDVGSVKGALCRQAAGHYNGPAQPGFLPGHPMAGKEVGGAANADGHLFQDAVWIFTDPAEAAERSPQAQALALEWRGWIAKFGCRVLDMDPTRHDVLCAWISHLPQMLSTALSSLLEEQFETNADLLPIGGRALREMTRLGASPFSMWRDIAQTNTDAIAHSLLALEQRLAHLRENLKTPELRAEFEQANRFRLA
CG10	ACID	    gi#110592958_Acidovorax sp. JS42 	QLGLIGCGLMGGSFALALKKAGLVKRVVGYSKSPSTTDRARQLGVIDVEAPSALLAAAGADIVLLAVPVAATESTLKAIKHLVTPQMLLMDVGSTKADVVQAARRALRDQIGSFVPAHPITGREVSGVEHADVDLYTGRQVILTPTERTLTAQLHRAEEVWRALGCHVSSMSPEAHDASFAAVSHLPHMLAFAMISGITAQPNADELLALAGPGFRDFTRIAASDPKMWRDILRANRDEVLAQSRVFKQALQTLEEAMQADNDQALEDLITLASHTRAHWRMG
CG3	ACIN	    fig|62977.3.peg.2127_Acinetobacter sp. ADP1 ATCC 33305	KVAFIGLGLIGSSLARVIQAEKLAGSVVASTRSAKTLEDAKALGLIEEGFRDPVEAVQGADLVILALPVRATQAVLAQIQPYLAQHTIITDVGSTKGNVVDAAKAVFGENLPEGFVPGHPIAGSEHTGVHAGKIDLFANHKVILTPLKSSAPWAVEKLIQLWSAAKAEVICMDVTRHDEVLAHTSHLPHLMAFNLVEQLANREDNLDIFRYAAGGFRDFSRIAASDPQMWHDIFFANKAAILNAVDGFEHQLSQIRQLIENEDSQALMGLLGHAQAARQHF
CG27	Adeh	    gi#86156612_Anaeromyxobacter dehalogenans 2CP-C	HLGVVGLGLMGASLARAARRVDRGVRITAVEPRAEVRARALADGVADQVSAEPDAALAGCGVVVLCTPVATIEALLAPVSALLADGAVLTDVGGAKERVVTLARERVRPGVAFVGAHPMFGGHGGYDGATAEKWSAGGTVAICTDGDAAAVEKVAALHLALGAGVERCTAAEHDAAVAMVSHLPYLVASALSVAVREAGPLAMHLAGPGLKDATRLAEFPFDIQGEVARRNAHLPEAARRLERHLARILAAIAESPESARSALEAARAAREELF
CG5	Aehr	    fig|187272.6.peg.896_Alkalilimnicola ehrlichei MLHE-1	RLCIIGVGLIGGSLARALRQAGAVDQVIGCGRSVDSLQRAEELGVVDHYTTDPARAVAAADMVVVCVPLGAMRGVFEQIRDHLAPEAVVTDGGSAKGSVIEDARAAFGELPAGFVPGHPIAGTEKSGVEASFARLYNQRRVILTPVPESADWAVARTRRMWEAVGARVTCMSAAHHDDVLAATSHLPHALAFGLVDTLSRWEGEHEIFEYAAGGFRDFTRIASSDPVMWRDICLANREALARALRYYTADLAHLTALVEQGDGAALEAIFRHAKERREQFL
CGO	Afer_4	    No fig or gi#_Acidithiobacillus ferrooxidans ATCC 23270	RIVIVGLGLMGGSIAKALRSRGFAGSLVGVVVDAQAVRRLRSAAKYWRISLTCEPEPALRNADLVLLATPPQIALRQLPELVRHISATGMVSDVASIKTPVAQLGRQLLGDRFIPGHPVVGGEKTGFAAARKNLYQGARVILTPLPEQAPAALDAVCGFWQCLGATVSQMTPEAHDQALAATSHLPHLLAFAYMAGLADQVPALRDLAGGGLRDFSRIAASDPDLWTAILSENRSAVVQHLKALQENLDTVRQMLAGDDTRTLKAFLKQGRACRQQFQ
CG86	Aful_1	    fig|224325.1.peg.224_Archaeoglobus fulgidus DSM 4304 	KILIYGVGNMGKLFRDIFYGKGYYVRGYDIDQMKRDTNSISGFDVIFVCTPMYALEEALEHIKREAKKEALLVDVSSVKKVSVPLFEESGFDFLSIHPMLGGDSEISLSNVIVVRESGREEEKVILEELRKCGAVLSRLDVEEHDRKMAEIQGIAHFALVSMADFLRYGKEELKYASPIFTVLYKLASRIINQNWEMYFQIQKNAEDVREEYLRRAMELHEKMKDRESFREIFESLRKIYTD
CG98	Afum	    gi#71001394_Aspergillus fumigatus Af293	MIGIIGLGDMGKMYAQQLSLAGWRVNACDLPQNYERLKEEFASQQGVTILPNGHLVSRISDYIIYSVEAAVIDRVVAQYGPSTKVGAIVGGQTSCKAPELAAFEKHLPPDVEILSCHSLHGPQVNPKGQPLVLIQHRASDESLRFVEEVFSSFGSKYVYLTGEMHDRITADTQAVTHAAFLSMGTAWQANNQFPWEMSRWVGGIENVKINITLRIYSNKWHVYAGLAILNPAAKEQIRTYAQSVTELYKLMIGGQREELKRRVKAAGAAVFKDG
CG98	Agos	    gi#44986169_Ashbya gossypii ATCC 10895	KIGIIGMGAMGQLYAERFSAAGWQVLCCDRSERYAELVAKYADSALTILQNGYLVSRECDYIIYSVEAANIGAIVAQYGPSTKLGAIVGGQTSCKSGELQAFEQHLPADVDIVTVHSLHGPKVDPEGQPLVLIDHRTSRPDSFPFVEALMSCLRSRHVYITGEEHDQITADTQAITHAAFLSMGLAWYKRQVYPWDAGAGKWCGGLENAKMNISLRIYSNKWHVYAGLAITNPTAHCHVTVYAQSATDLFTLMIEHRKDTLRDRLLADKADVFRHRR
CG17	Anae	    No fig or gi#_Actinomyces naeslundii MG1	PVLIVGTGLLGTSLALALRTAGVGVLLSDTSPTSLALARDMGAGSLHDEDSPEPQVVVVATPPDVTADVVVAQLSAHPSAVVTDVASVKERVVAEVRARAGAQARRYVGSHPMAGRERSGAGAADCDLFAGRPWVVVGQDADPQAELVIRNLAVDVGATPVRMGAAEHDAAVAAVSHMPQLVSSLVAARLEELGEGALALSGQGLRDVTRIAASDPRLWSAIIVGNAGPVVDLLRRIRDDLGVLITGIEAAACDSDSPEHTAPGAARVVAG
CG17	Aori	    gi#5051821_Amycolatopsis orientalis	KVLVVGTGLIGTSAALALREKDVTVYLCDIDADAVRLARELGAGQEWTGQDVDLAVIAVPPHLVGESLADLQKQGAARAYTDVASVKVDPIADAERLGCDMTCYVPGHPLAGRERSGPAAARADLFLGRPWALCPGPETEAGAEQLARELVSLCGAKSVTVGARQHDSAVALVSHAPHVAASAVAASLESGDEVALGLAGQGLRDTTRIAAGDPLLWRMILSGNAQPVAGVLDRIAADLVAAASALRSGDLDDVTDLLRRGVDGHGRI
CG98	Aory	    gi#83774947_Aspergillus oryzae	MIGIIGMGDMGKMYAQRLSMAGWRINACDKPDSFESLKSEFASQQGVTIYPNGHLVSRISDFIIYSVEAGVIDKVVAEYGPSTKVGAIVGGQTSCKAPELAAFEKHLPSDVEIVSCHSLHGPKVNPKAQPLVLIQHRASDESLRFVENVLSCFESKFVYLTGEMHDRITADTQAVTHAAFLSMGTAWRANNQFPWEISRWVGGIENVKINITLRIYSNKWHVYAGLAILNPSAKEQIRQYAESVTDLYKLMIEGRREELKQRVKAAGAAVFKEG
CG85	Aper_1	    fig|272557.1.peg.437_Aeropyrum pernix K1 	RVGFVGAGSVARALARAASARGWPVCFYDIDRERAGEAASQYGGLSFSSLQGLAAESEAIVVAVPGPAAGGVMVEAARSSRSGTLVVDTATFKRGVVAAARGMPPRVLAALTHPLFGGRASRPEKHYVAVMPFPGREGVVEAERLYREMGFNTIRLRSWEEHDRLAGYSIGLVYALAEALYAALESGGLDLDSPLPSTTYRVLGMLAQSVLSDSPDLRGEILSNPSTREAAASLASALMEVARGAGPRGRGRSSYNLLYRLLEEC
CG1	Aple_1	    fig|228399.1.peg.927_Actinobacillus pleuropneumoniae serovar 1 str. 4074	IVIVGGKGKLGGLFARFLTLSGYRVETLGSQDWEQAEHILSDCDLVIVCVPIVKTLETIERLQPFLTENMILADLTSVKAQPLEKMLEVHSGPVVGLHPMFGPDIASMAKQVVACCHGRFSEKYEWLIEQIKIWGAKIEVIDAHEHDHAMTYIQALRHFSTFTFGLHLSRQSVKLSQLLALSSPIYRLELAMIGRLFAQDGGLYADIISDKPENLAVIESLKETFTSSLDFFKNNDKAGFIQAFEDVHHWFGDYSEQ
CG1	Asuc	    gi#75429313_Actinobacillus succinogenes 130Z	IVIVGGNGKLGGLFARFLRASGYHVDTMGSRDWESADKILADSDVVMVCVPIAKTLETIERLKPYLTESMLLTDLTSVKRRPLEKMLEVHTGAVVGLHPMFGPDIASMAKQIVVRCDGRYPERYEWLLQQIGIWGAKIYQADAAEHDHSMTYIQALRHFSTFANGYHLSRQPVKLANILALSSPIYRLELAMIGRLFAQDGELYADIIMDKPENLAVIESLKQSYEESLKFFENGDKAGFIEAFNQVREWFGEYSEQFMK
CG17	Atei	    gi#45580876_Actinoplanes teichomyceticus	TLLVIGTGLIGTSVALAARRAGVAVFLADRDVAAARVAEALGAGLAEPPRRPVDLALVAVPPAQVGPVLRDAQANRAAHSYTDVAGVKGQPERDVLRLASDPASYVGGHPMAGRERSGPLAATADLFAGKTWVLTPNERTGAAALERATTLAEICGAAPVRLDSRAHDTVVALTSHVPHLMASLTAARLLHGPAATEALVGQGVRDVTRIAAGDPALWTDIVRSNAPAVAAVLRGVRDDLTRLLAATDILAGHHPGGRAQAEHTVTDLLE
CG95	1Atha	    fig|3702.1.peg.1877_Arabidopsis thaliana 	KIAVLGFGNFGQFLSKTLIRHGHDLITHSRSDYSDAANSIGARFFDNPHDLCEQHPDVVLLCTSILSTESVLRSFPFQRLRRSTLFVDVLSVKEFPKALFIKYLPKEFDILCTHPMFGPESGKHSWSGLPFVYDKVRIGDAASRQERCEKFLRIFENEGCKMVEMSCEKHDYYAAGSQFVTHTMGRVLEKYGVESSPINTKGYETLLDLVENTSSDSFELFYGLFMYNPNALEQLERLDMAFESVKKELFGRLHQQYRKQMFGGEVQSPKKTE
CG95	2Atha1	    fig|3702.1.peg.25198_Arabidopsis thaliana_first A Domain	RIAIIGFGNYGQFLAETLISQGHILFAHSRSDHSSAARRLGVSYFTDLHDLCERHPDVVLLCTSILSIENILKTLPFQRLRRNTLFVDVLSVKEFAKTLLLQYLPEDFDILCTHPMFGPQSVSSNHGWRGLRFVYDKVRIGEERLRVSRCESFLEIFVREGCEMVEMSVTDHDKFAAESQFITHTLGRLLGMLKLISTPINTKGYEALLDLAENICGDSFDLYYGLFVYNNNSLEVLERIDLAFEALRKELFSRLHGVVRKQSFEGEAKKVHVFP
CG95	2Atha2	    fig|3702.1.peg.25198_Arabidopsis thaliana_second A Domain	KIGIVGFGNFGQFLGKTMVKQGHTVLAYSRSDYTDEAAKLGVSYFSDLDDLFEEHPEVIILCTSILSTEKVLESLPFQRLKRSTLFVDVLSVKEFPRNLFLQTLPQDFDILCTHPMFGPESGKNGWNNLAFVFDKVRIGMDDRRKSRCNSFLDIFAREGCRMVEMSCAEHDWHAAGSQFITHTVGRLLEKLSLESTPIDTKGYETLLKLVENTAGDSFDLYYGLFLYNPNAMEQLERFHVAFESLKTQLFGRLHSQHSHELAKSSSPKTTKLLTS
CG12	Atum	    fig|176299.4.peg.3832_Agrobacterium tumefaciens str. C58 	RIALIGIGLIGSSIARDVRELGLARHVVISTRSEDTLKRAEELALGTDYTVSAAEAVKDADLVIVSVPVGASESVAQQIAPYLKPSAIVTDVGSTKASVIAQMAPHMPENVHFIPGHPLAGTEKSGPDAGFAGLFRERWCIFTPLPGTDAAALERLKDFWRALGSRVDEMDAEHHDKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKDAILEMLARFSEDLASLQRAIRWGEGDKLFELFSRTRSIRRSII
CG16	Avar	    fig|240292.3.peg.4775_Anabaena variabilis ATCC 29413 	QIGILGLGLIGGSLGYDLRSQGHHVLGVSRKQSTCETAVSLGSVDEASVDISLLTAAEVVFICTPIGLIVPQVEQLINHLPQSTVVTDVGSVKAPIVEAISPLWENFVGGHPMAGTTDSGIESAQRNLFAHRPYVLTPEPTTPKGAIALVEEIVRSLGAKIYYCQPEQHDRAVSWISHLPVMVSSSLIAACISETDPEVLQLAQNLASSGFRDTSRVGGGNPELGVMMAQYNRQALLGSLHQYRRNLDEVIALVEQENWSALETKLHTTQQARPNF
CG2	Avin_1	    fig|354.1.peg.1510_Azotobacter vinelandii 	RLVVVGLGLIGGSFAKGVRERGLCREVVGVDLDPHTRELAVAQGVVDRCEEDLAVACRGAQVIQLAVPILAMEKLLGVLAGLALGDAVITDVGSSKGYVLQAARRAFAGRPLNFVPGHPIAGSERSGVAAADSELFLHHKVILTPVQESEPQALALVDGLWRGLGAVVERMAVERHDEVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDPVMWRDIFLANREAVLRTLDVFRSDLDALRAAVDAGDGHQLLGVFTRARVAREHF
CGO	AZOA	    fig|76114.4.peg.1423_Azoarcus sp. EbN1 CG3 	KLVVCGVGLIGGSFALALRRAGLVRRIVGLGRSPASLARAVALGVIDKAAAGWADALDGADFVLLATPVGQMDAVMAAMAPHLAPRTVVTDAGSTKRDVIEAIYRHLPDHLPYVVPAHPIAGAECSGVEASFAGLYDGRKVVVTPLPENEPEAVLRVREAWEACGALMHEMPPQEHDRVFAAVSHLPHLLAFGLVHDLAGRSNAEQLFGYAASGFRDFTRIAGSHPEMWRDICIANRQALLGELDQYLAELAQLRALLLSGDGDRLEQLFGEARRARNAWAEQ
CG12	Babo	    fig|262698.3.peg.1913_Brucella abortus biovar 1 str. 9-941	KITLIGIGLIGSSLARVIRREGLATHIAIATRSAETLKRAEELNLGDSYTTNSAEAVKDADLVIVSVPVGSSGTVARQIAGNLKPGAIVTDVGSTKASVIAQMQPELPENVHFIPGHPLAGTEYSGPDAGFAELFTNRWCILTPLPDTDEKALEKLTAFWTACGSRLDHMDPQHHDLVLAIVSHLPHIIAYNIVGTASDLELVTKSEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKDAILEMLGRFSEDLASLQRSIRWGDGEALFDLFTRTRAVHRGII
CG18	Bant	    fig|198094.1.peg.2717_Bacillus anthracis Ames   	KVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGSIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSL
CG8	Bavi	    fig|521.1.peg.518_Bordetella avium	VLAVVGVGLIGGSFAAALRQAGQVGRVLGVGRNPDSLAQAKHLGLIDDIVSPEIAAAQADLIMLATPVGSLGPMLARMRDHLRATTVITDGGSTKAEVVDAARAALGDHIGAFVPGHPIAGAERTGPDAADASLYAGRKVILTPLAENAADAVALVRAAWEVCGAMVLEMTPEAHDSVLASVSHLPHFLSAVYMAQVCEADDAAMRLALAGSGFRDFTRIAAGSPEMWRDIFLSNRSAMLAELTALRAVLDRTEAALLAADGAGLQQWLQDAALARRAWRKE
CG8	Bbro	    fig|257310.1.peg.3450__Bordetella bronchiseptica RB50	VLAVAGVGLIGGSFAAALRHAGQVGTILGVGRNPASLARARELGLIDEAVSPEEAAARADLVLLSTPVGGLGAMLARMRDHLRPGCLLTDAGSTKSQVVMAARQALGEQVSCFVPGHPIAGGERTGPEAADAGLYVRRAVVLTPLPENAAASVARVRACWHACGAHVVEMDDVAHDRLLASVSHMPHFLAAVYMAQVAGSDDAQARMDLAGSGFRDFTRIAAGSPEMWRDIFLSNQAAMQSELAALRRVLDEAEQALGAGDGAGLQALLERAAHARRNWRKD
CG7	Bcen_1	    fig|216591.1.peg.4051_Burkholderia cenocepacia J2315 	KLVIFGVGLIGGSLARALRERAPGGAGEIVGVGRSRASVERALSLGVIDRAAALDDDVQVRDALAGADLVLLAAPVAQTGPLLARIAPWLDGATIVTDAGSTKSDVVAAARDALGARIAQFVPGHPIAGRESSGVEAALPDLYVGRNVVLCPLPENAPDAVARIDAMWRATGADVRMMSTEQHDRVFASISHLPHVLSFALVEQILGEADAELKFSYAAGGFRDFTRIAASNPEMWRDVCVANRAALLDELDGYTRVLTRLRAAIDAGDGAALEAVFTRSRAARKAWQER
CG7	Bcep	    fig|269483.3.peg.5254_Burkholderia cepacia R18194 	KLVIFGVGLIGGSLARALRERAPGGAGEVVGVGRSRASVERALALGVIDRAAALDDDAQLRDALAGADLVLLAAPVAQTGPLLARIAPWLEAATIVTDAGSTKSDVVAAAREALGARIAQFVPGHPIAGRESSGVEAALPDLYVGRNVVLCPLPENAPESVARIDAMWRATGADVRTMSTEQHDRVFASISHLPHVLSFALVEQILGEADAELKFSYAAGGFRDFTRIAASSPEMWRDVCVANRAALLDELDGYTRVLTRLRAAIDAGDGAALEAVFTRSRAARKAWQER
CG18	Bcer	    fig|226900.1.peg.2798_Bacillus cereus ATCC 14579 	KVVLIGTGLIGGSLALAIKKEHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFRLREDVIVTDVGSTKGTIMNEAETLFSKEVSFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYQTVSTGDAEIQNYFADAKEYRDSL
CG18	Bcla_1	    fig|66692.3.peg.1946_Bacillus clausii KSM-K16 	TAFVVGMGLIGGSISLAIKRDQDIHLVGYDISAEQLHMAKALGVIDEAASSLEEGAQAADFIILAVPVSKTIELIEQLSTIPLKQGVIVTDVGSTKQDIAAAADNHFGDNVCFIGGHPMAGSHKSGVEAAKAHLFENAFYLLAPGKNSEPRHIIALQNLLKGTKARFLQMEPQQHDKLAGTVSHFPHIIAASLVHQLKKLEKTDPEVAQLAAGGFRDITRIASASPVMWRDVLLHNKEEMLRLFAEWQIEMDSVKEMVERCDGKAIHAYFQEAKAFREEL
CG1	Bflo	    fig|203907.1.peg.169_Blochmannia floridanus (Candidatus)	VVIIGGNGRMGQFFFKMLTLSGYQVRILDQDDWIHAKSILTNVGVVFISVPIYSVIKVINQLPHLSNDCIIVDLSSVKKSSLTAILKIHTGPVLGLHPMFSPDTTITASMIKKVVICCDGRYPQEYQWLLQQLKLWGAKVYYCNFIEHDKYMSFIQSLCHFTIFVMGYHLFKENIDLKKILSFSSPMFQLELILIGRLFTQNPQLYADIIMSSKNNIIVIKRYYKRLGKMLMLLEQNNKEEFINQFKKIKCWLDSYAGIF
CG23	Bfra	    fig|295405.3.peg.3998_Bacteroides fragilis YCH46 	RILILGAGKMGSFFTDILSFQHETAVFDVNPHQLRFVYNTYRFTTLEEIKEFEPELVINAATVKYTLDAFRKILPVLPKDCILSDIASVKTGLKKFYEESGFRYVSTHPMFGPTFASLSNLSSESAIIISESDHLGKVFFKDLYNSLNLNIFEYTFDEHDETVAYSLSIPFVSTFVFAAVMKHQEAPGTTFKKHMAIAKGLLSEDDYLLQEILFNPRTPSQVENIRTELKQLLEIITNKDAEGMKKYLTKIREKIK
CG18	Bhal_2	    fig|272558.1.peg.1666_Bacillus halodurans C-125 	TVFIIGLGLIGGSIALAIRKEHDVKMIGFDVNEHQVKMALSLGVIDEEASTMEEGASQADLIVLATPVARTTGILQQLAKLPLKADAIVTDVGSTKKEIMEEAQFLEEKGITFIGGHPMAGSHKSGVEAARAHLFENAFYILTPSKELTVKPIIQLQNWLKGTKAKFIEMTPDQHDRLVGAISHFPHIVAASLVHQVAKIESEDPMVSRLAAGGFRDITRIASGSPIMWRDILLHNKDSLLQLLETWEREMEFVKQVIEEEDEEKILQYFHEAKVFRDG
CG12	Bhen	    fig|283166.1.peg.1442_Bartonella henselae str. Houston-1	KIALIGIGLIGSSLARVIKKNNLAAHISIATRRQETLIRARELQLGDFYTTDKAEAVEGADLVILSVPVGASAQVAKSLHDHLKPGAIVSDVGSTKALVIAEMAPLLPKTVHFIPGHPIAGTEYSGPDAGFADLFMNRWCILTPLAESDAGAVAQLTAFWEACGARVEKMDAKHHDLVLAIVSHLPHLIAYNTVGTASDLEKVTNSEVIAYSASGFRDFTRLASSDPVMWRDICLHNKDAILEMLNRFSEGLSFLEQAIRMGDGETLFNFFTRTRAVRRNII
CG12	Bjap_1	    fig|224911.1.peg.1396_Bradyrhizobium japonicum str. USDA 110 	RIALIGFGLIGGSIARAAKLQGLAGEIVTTARSEKTRARVLELGIVDQVVATNAEAVKDADLVILCIPVGACGPVAQEIAAHLKPGAIVSDVGSVKGAIVRDMAPHLPKTVHFVPAHPVAGTEHSGPDSGFAELFINRWCILTPPEGVDASATDRLRAFWAAMGAKVEVMTPDHHDLVLAITSHLPHLIAYTIVGTADELAQVTESEVIKFSAGGFRDFTRIAASDPTMWRDVFLANKEAVLEMLGTFTEDLAKLTRAIRRGDGEALFDHFTRTRAIRRGIV
CG18	Blic	    fig|279010.5.peg.246_Bacillus licheniformis ATCC 14580 	TILLAGLGLIGGSIALAIKKEHPGKRIIGFDVSEEQARAAQKLGVIDAPAASFLEGVKEASTVFLAAPVEQTLHMLDELAASGIKKKLLITDVGSTKQKVVSHAEKVLPDDYRFIGGHPMAGSHKSGVAAAKDFLFENAFYILTPSGSAGKEAVASLKDLLKGTNAKFVEMSPAEHDAVTSVISHFPHIVAASLVHQTVKFEDQYPLVKRFAAGGFRDITRIASSSPAMWRDILLHNKDKILERFDEWKQELDRIQSFVENEDADGLFEFFRQAKEYRDGL
CG17	Blin	    fig|321955.3.peg.1676_Brevibacterium linens BL2	RIHIIGTGLLGASLGLALSAQKYQVSLEDTSPTAQQLAADLGAGTVSSARLDAEDPQIVVVATPPDVAAQTIATALETYPNATVTDVASIKTRLLEAVRELVGEAELSRYIGCHPMAGREKSGAIAARSDLFTARPWVICSDEDTPGSRLGEVVTMAEATGASVIHLDPRIHDAAVAKVSHVPQVVASLVASQLRHAPLEEIELAGQGLRDVTRIAASDPRLWTQILAGNSEEIRSVLLDLRTELDEVITALELGPGSTGALAKAIALGNEGH
CG17	Blon_1	    fig|206672.1.peg.1314_Bifidobacterium longum NCC2705 	TVGIVGLGLIGGSLARRLTERGVRVVAWNHRPHPYAQAEADGIFCKSTLSELMDAEPDVVVLCNPLKAMPAILAALAPLMGDHPNTTLTDVGSVKGMVRDQVKAAGLGKCYVGAHPMAGNELSGWQAADPHLYDGALWAITVDESTDYRRFLDVAAMITKDVGNRVIVVDDETHDKAAAMISHMPHVVSTALINELVANPDRNIAAALAAGCWRDMTRVSLTDPDRTRAMVEEDSLNVEALLRRMAARLTDMADQLHAGAAGEQDVMGFFAEGDPFRRYKAAK
CG7	Bmal	    fig|243160.4.peg.907_Burkholderia mallei ATCC 23344 	KLVIFGVGLIGGSLALALREGASGGRREVVGVGRSSASIGRALALRVIDRAAALDDDAQLRDALAGADLVLLAAPVAQTGPLLARIAPFLDASTIVTDAGSTKSDVVAAARAALGARIGQFVPGHPIAGRESSGVDAALADLYVGRNVVLCALPENAPDALARVEAMWRAARADVRAMSAEQHDRVFAAVSHLPHVLSFALVEQILGESDAELKFSYAAGGFRDFTRIAASSPEMWCDVCLANRAALLDELDAYTAVLARLRAAIDAGDGAALEAVFARSRAARAAWRER
CG31	Bmar_4	    fig|314230.3.peg.3748_Blastopirellula marina DSM 3645	QATIVGVGLIGGSIGLAMRARGLAKSIVGVGRNQESLVDAKRVGAIDRSTTDIAGGVKSADLVVVCAPVDKIVGLVQEIDRHCPAGTIVTDAGSTKSEIAAALDQGLTNARFVGGHPLAGGAKAGPKHADACLFVDRTVVLTPTRRTDAAAAEAVEDLWTALGATVVWMKPKEHDEALAFTSHLPHWAAAAVAATTPEKWLPLTSTGWADTTRIAGGDAALWRQIFTSNRGHVLKALDKFEKVLAALREALEAENDAKLEKLLNDGKNRRDAVGN
CG12	Bmel	    fig|224914.1.peg.79_Brucella melitensis 16M  	KITLIGIGLIGSSLARVIRREGLATHIAIATRSAETLKRAEELNLGDSYTTNSAEAVKDADLVIVSVPVGSSGTVARQIAGNLKPGAIVTDVGSTKASVIAQMQPELPENMHFIPGHPLAGTEYSGPDAGFAELFTNRWCILTPLPDTDEKALEKLTAFWTACGSRLDHMDPQHHDLVLAIVSHLPHIIAYNIVGTASDLELVTKSEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKDAILEMLGRFSEDLASLQRSIRWGDGEALFDLFTRTRAVHRGII
CG8	Bpar	    fig|257311.1.peg.2940_Bordetella parapertussis 12822 	MLAVAGVGLIGGSFAAALRHAGQVGTILGVGRNPASLARARELGLIDEAVSPEEAAARADLVLLSTPVGGLGAMLARMRDHLRPGCLLTDAGSTKSQVVMAARQALGEQVSCFVPGHPIAGGERTGPEAADAGLYVRRAVVLTPLPENAAASVARVRACWHACGAHVVEMDDVAHDRLLASVSHMPHFLAAVYMAQVAGSDDAQARMDLAGSGFRDFTRIAAGSPEMWRDIFLSNQAAMQSELAALRRVLDEAEQALGAGDGAGLQALLERAAHARRNWKRD
CG8	Bper_1	    fig|257313.1.peg.827_Bordetella pertussis Tohama I 	MLAVAGVGLIGGSFAAALRHAGQVGTILGVGRNPASLARARELGLIDEAVSPEEAAARADLVLLSTPVGGLGAMLARMRDHLRPGCLLTDAGSTKSQVVMAARQALGEQVSCFVPGHPIAGGERTGPEAADAGLYVRRAVVLTPLPENAAASVARVRACWHACGAHVVEMDDAAHDRLLASVSHMPHFLAAVYMAQVAGSDDAQARMDLAGSGFRDFTRIAAGSPEMWRDIFLSNQAAMQSELAALRRVLDEAEQALGAGDGARLQALLERAAHARRNWKRD
CG7	Bpse_6	    fig|272560.3.peg.4863_Burkholderia pseudomallei K96243 	KLVIFGVGLIGGSLALALREGASGGRREVVGVGRSSASIGRALALRVIDRAAALDDDAQLRDALAGADLVLLAAPVAQTGPLLARIAPFLDASTIVTDAGSTKSDVVAAARAALGARIGQFVPGHPIAGRESSGVDAALADLYVGRNVVLCALPENAPDALARVEAMWRAARADVRAMSAEQHDRVFAAVSHLPHVLSFALVEQILGESDAELKFSYAAGGFRDFTRIAASSPEMWRDVCLANRAALLDELDAYTAVLARLRAAIDAGDGAALEAVFARSRAARAAWRER
CG12	Bqui	    fig|283165.1.peg.1102_Bartonella quintana str. Toulouse CG4 	KIALIGIGLIGSSLARAIKKKNLTAHISIATRRQETLKRARELNLGNFYTTNNAEAVEGADLVIISVPVGASAQVAKTLHDSLKPGAIVSDVGSTKALVIAEMAPLLPKTVHFIPGHPIAGTEYSGPDAGFADLFMNRWCILTPFAESDASAVARLTAFWEACGARVEKMDPKHHDLVLAIVSHLPHLIAYNTVGTASDLEKVTNSEVIAYSASGFRDFTRLASSDPVMWRDICLHNKDAILEMLSRFSEGLASLEQAIRLEDGETLFNFFTRTRAVRRNII
CG18	Bsub	    fig|224308.1.peg.2265_Bacillus subtilis subsp. subtilis str. 168  	TILLAGLGLIGGSIALAIKKNHPGKRIIGIDISDEQAVAALKLGVIDDRADSFISGVKEAATVIIATPVEQTLVMLEELAHSGIEHELLITDVGSTKQKVVDYADQVLPSRYQFVGGHPMAGSHKSGVAAAKEFLFENAFYILTPGQKTDKQAVEQLKNLLKGTNAHFVEMSPEEHDGVTSVISHFPHIVAASLVHQTHHSENLYPLVKRFAAGGFRDITRIASSSPAMWRDILLHNKDKILDRFDEWIREIDKIRTYVEQEDAENLFRYFKTAKDYRDGL
CG12	Bsui_1	    fig|204722.1.peg.1920_Brucella suis 1330  	KITLIGIGLIGSSLARVIRREGLATHIAIATRSAETLKRAEELNLGDSYTTNSAEAVKDADLVIVSVPVGSSGTVARQIAGNLKPGAIVTDVGSTKASVIAQMQPELPENVHFIPGHPLAGTEYSGPDAGFAELFTNRWCILTPLPDTDEKALEKLTAFWTACGSRLDHMDPQHHDLVLAIVSHLPHIIAYNIVGTASDLELVTKSEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKDAILEMLGRFSEDLASLQRSIRWGDGEALFDLFTRTRAVRRGII
CG7	Btha	    gi#83721591_Burkholderia thailandensis E264    	KLVIFGVGLIGGSLALALRDGAAGGRREVVGVGRSAASIERALALRVIDRAAALDDDAQLRDALAGADLVLLAAPVAQTGPLLARIAPFLDASTIITDAGSTKSDVVAAARAALGARIGQFVPGHPIAGRESSGVEAALADLYVGRNVVLCALPENAPDALARVEAMWRAARADVRAMSAEQHDRVFAAVSHLPHVLSFALVEQILGESDAELKFSYAAGGFRDFTRIAASSPEMWRDVCLANRAALLDELDAYTAVLARLRAAIDAGDGAALETVFARSRAARAAWRER
CG23	Bthe_9	    fig|226186.1.peg.3931_Bacteroides thetaiotaomicron VPI-5482	RILILGAGKMGSFFTDILSFQHETAVFDVNPHQLRFVYNTYRFTTLEEIKEFEPELVINAVTVKYTLDAFRKVLPVLPKDCIISDIASVKTGLKKFYEESGFRYVSSHPMFGPTFASLSNLSSENAIIISEGDHLGKIFFKDLYQTLRLNIFEYTFDEHDETVAYSLSIPFVSTFVFAAVMKHQEAPGTTFKKHMAIAKGLLSEDDYLLQEILFNPRTPGQVANIRTELKNLLEIIEKKDAEGMKAYLTKIREKIK
CG18	Bthu	    fig|281309.1.peg.2659_Bacillus thuringiensis serovar konkukian str.97-27	KVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELYVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKGSIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFRDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSL
CG7	BURK	    gi#78065629_Burkolderia sp.	KLVIFGVGLIGGSLARALRERAPGGAGEVVGVGRSRASVERALALGVIDRAAALDDDAQLRDALAGADLVLLAAPVAQTGPLLARIAPWLEAATIVTDAGSTKSDVVAAAREALGARIAQFVPGHPIAGRESSGVEAALPDLYVGRNVVLCPLPENAPESVARIDAMWRATGADVRTMSTEQHDRVFASISHLPHVLSFALVEQILGEADAELKFSYAAGGFRDFTRIAASSPEMWRDVCVANRAALLDELDGYTRVLTRLRAAIDAGDGAALEAVFTRSRAARKAWQER
CG7	Bvie	    fig|60552.1.peg.3874_Burkholderia vietnamiensis G4	KLVIFGVGLIGGSLARALRERASGGAGEIVGVGRSRASVERALALGVIDRAAALDDDAQLRDALAGADLVLLAAPVAQTEPLLARIAPWLDAATIVTDAGSTKSDVVAAARAALGERIAQFVPGHPIAGRESSGVEAALPDLYVGRNVVLCPLAENAPETVARIDAMWQATGADVRTMSAAQHDRVFASISHLPHVLSFALVEQILGEADAELKFSYAAGGFRDFTRIAASSPEMWRDVCVANRAALLDELDGYTRVLARLRAAIDAGDGAALEAVFTRSRAARKAWQER
CG7	Bxen	    fig|36873.1.peg.4890_Burkholderia xenovorans LB400 	KLVIFGVGLIGGSLARALRERSGTEGARTVIGVGRSSASTGRALELGVIDGSAALNDAASLREALSGADLVLLAAPVAQTQPLLERIAPFLDPATIVTDAGSTKSDVVAAARAALGARIGQFVPGHPIAGREASGVEAALPDLYVGRNVVLCPLPENAPAAVERVAAMWRATGALVRDMAPGQHDRVFASVSHLPHLLSFALVEQILNSPDAALKFSFAAGGFRDFTRIAASSPEMWRDVCVANRVALLDELDAYTAVLARLRAAIEAADGAALETVFARSRVARTEWQEQ
CG19	Cace_2	    fig|272562.1.peg.1058_Clostridium acetobutylicum ARCC 824	NLTIVGLGLMGGSYAMALKEKNKGHIWGVDLDNNTLKNAAEMDIIDEGYSIENAYIPLKKSDIVIIAIYPEALVQFVKNNVNNFKKGAIITDVLGIKEDNISYIQSILGDSAEFLGGHPMAGKEVSGFSNASKNIFNNANYILTPTVKNKKDTIEFMKKFIRSIGCTSITEVTPEKHDEIIAFTSQLPHVIAVSLMNTKSADDIKHFVGGSFRDATRVAMINPDLWCQLFMRNKKNIIDSIEEFQKSLNQIKGFIKEENVNDIKQFLKDAASKKEG
CG98	Calb	    gi#68466097_Candida albicans SC5314	TIGIIGLGDMGYLYAKRFSDAGWKVVGCDREDLYETTKAKFADEKFEILRNGHFVSRISDYIIYSVEAENIEKIVSIYGPSTKFGAIVGGQTSCKAPEIAAFEKHLPEDNEIISLHSLHGPKVNTTGQPLVLIKHRATDKSFEFVEALVSCLNSKQVYLTAKEHDRITADTQAVTHAAFLSMGVAWKSVNQYPWETPRWIGGIENAKINISLRIFSNKWHVYAGLAITNPSAHDQVLQYSKSTTELFTLMIQGKKKELTERLTKAKQFVFKYIT
CG26	Cbur	    fig|227377.1.peg.935_Coxiella burnetii strain RSA 493	SIGIIGCGRFGALLSEMLSEEFEVSVYDVKPDPYLTHINFTDLESVLQLSTIFIAVPIHHFKNTIIKIASKLIKKTTVIDVCSVKCYPVEIMQAHLPPSVGIIATHPLFGPDSLQKAQLKMMMHPARDTHDCYEFWKNYFSSKKIKILEMTPDQHDRFSARSQSITHFIGRTLELMGSQSTEMDTIGYKNLLAVMAQTCNDKWDLFLDLKRFNPYAAQTIGEFIEKSIHLQKEITKLSPFPDASREQAKER
CG24	Cchl	    fig|156405.1.peg.554_Chlorobium chlorochromatii CaD3 (uncultured Chlorobi bacterium)	TIAIVGLGLIGMSLVRAFHHSPFMQEQQVRLIGYDPHFSESDCQCALELGLHSFESNPETLYRAEIVILAAPVEVNIALLESVRNCVASHTLVTDVSSTKRDIALRAKQLQLPFVGMHPMAGKEEKGYQASHEELLHGKRMIFCDDDNLLATPQGEFLQQAIASIGCTTLFMTSEEHDAVVARVSHLPQLLSTLLMEHCGDAMQASGPGFATLTRLSGSSWEIWHDIVATNQMNIATELTRFSSKLLELSQEIQMGNFEQVAERFNHANQLYQALK
CG13	Ccol	    fig|306254.1.peg.1062_Campylobacter coli RM2228	KVAIIGLGLIGGSLGLCLKENKLISCVYGLDSSKENEQDALNLGLVHELIEFENLHLCDMIFIATPVNAIIEILQKLVNLPSNTTIIELGSTKRKIIEKLPAKLTKQTLFAHPMAGTENSGPKAAFKELYKDAVCVLCDSEVADDLHQKRAVEIFSHLGMRIVFMDSTAHDHHAAIISHLPHVISFSLANFVMKEEDKRNIVHLAGGSFKGMSRIAKSSPIMWGSIFEQNKDNVLSSIEFFQKELEFCKKMIEEDKNEELKSWMQKANTLREIL
CG12	Ccre	    fig|190650.1.peg.2207_Caulobacter crescentus CB15	KLTVIGCGLIGGSVIRAARQHGVVGEITVADASEAHRARVTELGIAEHVTGDIAEAVKDADLVVIATPVLSVPELARVVIPAMKPGATLTDVGSTKGNVAEAFRAQDLSKIFAIPGHPIAGTEQSGPDAGFAELFENRWTILTPFESEDDHYAAAVAKLSAFWRAFGAQVELMDDKHHDLVLAVVSHLPHLIAYTIVGSAADLENVTENEVIKYSASGFRDFTRIAASDPTMWRDIFVANKDAVLEMLGRFTEDLQAMSRAIRWGDADTLHAHFTRTRAIRRGIV
CG19	Cdif	    fig|1496.1.peg.2965_Clostridium difficile QCD-32g58 	NIVIVGLGVIGGSFAKALKKAGYENVFGVDVDLETLKKAEKAKIIKKGCTTGKELFKKADLIILSIYPRLVVDFLNNNKNFFKKGTIITDTTGIKETLINDVLQIIPDDIDFIFGHPMAGREKKGIDFASEQVFNGANYIITPTGRNNIKNLELVENLILEIGFKRVKKLTSQKHDEIIAFTSQLPHVMAVALINSDEEGRDTGKFIGDSYRDLTRIANMNEDLWSELFLGNRDNLLKVIENFESEVNLVKEAIFNNDKNKLIEYFKKSSIRREA
CG17	Cdip	    fig|257309.1.peg.226_Corynebacterium diphtheriae NCTC 13129 	PVCVLGLGLIGGSLLRALRHKGVPAFGFNRSPSAARIATKEGFDVSSSLIQTLERAEAENALIVLATPMPAIASLLDALQEHAPSCGFTDVVSVKEAVYDLVKSRGLQSRYVGGHPMAGTANSGWEASYPELFVRAPWVVTYDFAPEADAEWVGLWTDVVNMAGTVGAEVIPARVEAHDAAVARISHLPHVFAEALAIVGDNGGALALSLAAGSFRDSTRVAGSAPSLVRAMCETNAQALLGALDEALTLLNDARAHLTEAHPNLEELIDAGYRSRVRFEARS
CG98	Cdub	    No fig or gi#_Candida dubliniensis	TIGIIGLGDMGYLYAKRFSDAGWKVVGCDREDLYETTKTKFSNEKFEILKNGHFVSRISDYIIYSVEAENIEKIVSIYGPSTKFGAIVGGQTSCKAPEIAAFEKHLPEDNEIISLHSLHGPKVNTTGQPLVLIKHRASDRSFEFVEALVSCLNSKQVYLTAKEHDRITADTQAVTHAAFLSMGVAWKLVNQYPWETPRWIGGIENAKINISLRIFSNKWHVYAGLAITNPSAHDQVLQYSKSTTELFTLMIQGKKKELTERLTKAKQFVFKYIT
CG17	Ceff	    fig|196164.1.peg.195_Corynebacterium efficiens YS-314 	PVCILGLGLIGGSLLRDLHAAGHTVFGYNRSRSGARSAVTEGFDVSAELIPTLGRAAEEDALIVLAVPMTAVEELLDEINTHAPNCGFTDVVSVKTAVYDAVKARDMQDRYVGSHPMAGTTESGWGASMTGLFERAVWVITFDHLMDTEKVSAHWTGIWKDVCQMAAAVGSEVVPARVGPHDAAAARVSHLPHLLAETAAIVGDNGGALSLSLAASSFRDVTRVAGTEPGLVRAMCEGNADALLTALDEALAILQETRDHLAATPPSVEQLADNGYRSRLRYEART
CG13	CELL_1	    fig|313590.3.peg.343_Cellulophaga sp. MED134	DICIIGVGLIGGSFARDLRAQLPEATVCGIDASKKHLDEALALGFIDKAGVLEDVAKADLVVLAIPVDVAIHVLPDVLNIINDDTVVIDMGSTKQAICEVVTNHPKRRNFLACHPIAGTEFSGPSAAITGLYEGKTNIVCEVEKTAFKLQEPVLDLFKNMGMRMRYMDPVSHDKHIAYMSHLSHISAFMLGKTVIDKEKNERDIFDMAGSGFASTVRLAKSNPVTWTSIFKQNRDNVLETLTEYIANLNDFKSLLEAEDYTGVHNEMENTNHIKEILNG
CG24	Cfer_8	    gi#110597282_Chlorobium ferrooxidans DSM 13031	NISFIGLGLIGMSLLRAIKLSPLSRESKIFFQGFDPCFTDSDRTTVEALGLDRFTAEKSLLYSADLIILSAPVEINIALLEEIKQFAPPSTLVSDVSSTKSLIARKARELELNFIGMHPMAGKEQQGYRESHEELLHGRRVILCDDKGVLEEPKGRFLIALLESAGCTTLSMNAEEHDLVVAKTSHLPQLLSTLLMNHCGDSISKTGPGFATLARLAGSPWQIWRDIIATNSDNIAAELDRFAVELTALSEEVRSLNLEQLESRFDEANRLYQTLKE
CG98	Cgla	    gi#49528922_Candida glabrata CBS138	VIGIIGLGDMGLLYATKFSSAGWKVVACDREELFDSLSERKRQNAWKFDIVKNGHYVSRISDYIIYSVEAENIDKLVKLYGPSTKVGAIVGGQTSCKTPEIKAFEKYLPEDVEIITLHSLHGPKVNTEGQPLVLINHRSKTDESMKFIESLVSCLKSKQVYLTYEEHDRITADTQAVTHAAFLSMGRAWAKLKVYPWTLGVNKWYGGLENVKVNISLRIYSNKWHVYAGLALTNPMAHKQILQYATSATELFTLFLDKKKDELTERLNKAKEFVFGNHT
CG17	Cglu_1	    fig|196627.4.peg.262_Corynebacterium glutamicum ATCC 13032 	PVCILGLGLIGGSLLRDLHAANHSVFGYNRSRSGAKSAVDEGFDVSADLEATLQRAAAEDALIVLAVPMTAIDSLLDAVHTHAPNNGFTDVVSVKTAVYDAVKARNMQHRYVGSHPMAGTANSGWSASMDGLFKRAVWVVTFDQLFDGTDINSTWISIWKDVVQMALAVGAEVVPSRVGPHDAAAARVSHLTHILAETLAIVGDNGGALSLSLAAGSYRDSTRVAGTDPGLVRAMCESNAGPLVKALDEALAILHEAREGLTAEQPNIEQLADNGYRSRIRYEARS
CG24	CHLO_4	    fig|888888.1.peg.969_Chlorochromiumaggregatum sp. 	TIAIVGLGLIGMSLVRAFHHSPFMQEQQVRLIGYDPHFSESDCQCALELGLHSFESNPETLYRAEIVILAAPVEVNIALLESVRNCVASHTLVTDVSSTKRDIALRAKQLQLPFVGMHPMAGKEEKGYQASHEELLHGKRMIFCDDDNLLATPQGEFLQQAIASIGCTTLFMTSEEHDAVVARVSHLPQLLSTLLMEHCGDAMQASGPGFATLTRLSGSSWEIWHDIVATNQMNIATELTRFSSKLLELSQEIQMGNFEQVAERFNHANQLYQALKAM
CG26	Chut	    fig|985.1.peg.1111_Cytophaga hutchinsonii	TLGIIGFGGFGQFMVKHLQPYISVTVHDLTDLSHIAAEHKVEWGTLQETASKDIVILAVPVQFLESLLLEIKDYLKAEALIVDVSSVKVKPIELMLKHLPLTVDILGTHPLFGPQSGKNGIKGLNMVVCPVRSKKMRAITHFLRNVIQLNVLERTPETHDKQMAYVQALTHFIGRSINEMDIPDVEQKTPAYQYLLDIKRNLGGDSMDLFLTIELENPYAKKVREEFMGALKSLNDRLEHIKR
CG20	Chyd_4	    fig|246194.3.peg.918_Carboxydothermus hydrogenoforams Z-2901 	KIGIVGLGLIGGSLARAFSYLGYQVYGIDTNSQYVELAYREKVIVNNHSDLNLLTSCDVVFLATPPETTLQLIPALNFLKPETIITDTVSIKGEIMQTAREKLNNAKNFIGGHPLTGMERGGYQAGHRFLFENSYYFLIPGPDAPEDTVTKLKGLLEKIGALVIVSDVTTHDRITAQLSHLPHAIAYSLCRMCQKEEDNELLLKLAAGGFRDLTRIAASSPELWSEILLYNREEVAKSIDLFIGELLTLKNLLMAGNKNEISAFLKEGQEFRTN
CG95	Cimm	    gi#90303694_Coccidioides immitis RS	SIGIIGMGDMGRMYAQRLSQAGWSINACDKPTNYDTLRQEFISHTNINILPNGHLVSRVSDYIIYSVEAEAINKIVAEYGPSTKVGAIVGGQTSCKAPELAAFENHLPGDVEIISVHSLHGPNVNPKGQPLVLIQHRASDESLRFVESVFASFESKYVYLTGERHDRITADTQAVTHAAFLSMGTAWQANNQFPWEISRYVGGIENVKINITLRIYSNKWHVYAGLAILNPAAKRQIRQYAESVTELFKLMLGGHRDELKRRVKAARAAVFRSDAV
CG17	Cjei	    fig|306537.3.peg.792_Corynebacterium jeikeium K411 	PLCILGLGLIGGSLMRDAQAAGWPVFGWNRSEKTVTRARRDGYDVSADLEATLRRAEETDALLILGVPMPALSFLLDAISQHAPTCGFTDVTSVKQEVHDLVEAKGMSDRFVGGHPMAGTANSGWQATMHGLFRGAVWVVTYDNARELAGAGAEAGAAASTGSSAAGGGATSGAAGAAPGADADEVSKRWLDTWVRVVGLAEEVGASVIPAIARRHDSAVGRVSHLPHILAESLAVAGDSGGPLALSLAASSFRDGTRVAGTDPDLVRAMVENNRPAVLEALDQTIELLQGAREDIAHPDRSLKTLAEDGHAARGRFEARA
CG13	Cjej	    fig|192222.1.peg.119_Campylobacter jejuni subsp. jejuni NCTC 11168 	KIAIIGLGLMGGSLGLCLKENKLISCVYGMDLSKENEKDALQLGLIHELIEFKDLALCDMIFVATPVNAIIEILQKLVDLPSNVTIIELGSTKRKIIESLPKNLIKQTLFAHPMTGTENSGPKAAFKELYKDAVCVLCDSEIADDLHQKRAVEIFSHLGMKIVFMDSKAHDHHAAIISHLPHVISFSLANFVMKEEDKRNIVHLAGGSFKGMSRIAKSSPQMWESIFLQNKDNLLSSIDFFQQELERCKQMIQLDKNDELREWMKQANTLREIL
CG13	Clar	    fig|306263.1.peg.477_Campylobacter lari RM2100	KVGIIGLGLIGGSLGLSLRENKLIDLVCGYDINKEFEQIALERKLIDKIVTFEELKKCDVIFLAIPVRAIVKILKEFQGISKDCTIIELGSTKEEIIKNLPSYLQSQFIAAHPMAGTENSGPNAAIKDLYKNAVCVLCDVQNADHIHQKRAIEIFSDLGMKLVFMDSISHDHHASIISHLPHVISFSLANFVMKEENKKNIAHLGGPSFKDMCRIAKSNPQMWSGIFEQNKQNLLNSIDLFQKELQECKKMIEKCDVNELETWIKSANKLREIL
CG24	Clim	    gi#67918022_Chlorobium limicola DSM 245	TISFVGLGLIGTSLLRAFRLSQPVDEKPLFMQGYDPSFNEKDKKDILDCGLDLFTTDKKTLYNADLIVLSAPVEANIALLDEIREYAGSSALVTDVSSTKALIAEKARELGLPFIGMHPMAGREQQGFRAAHEELLREKTIILCDNASYLAEPKGKKLLELLESAGCRTMLMDPENHDRIVANISHLPQLLSTLLINYCEENITASGPGFATLARLSGSSWSIWHDIVLTNSGNIALELEQFAEELLTLASDVKNENVENLASRFSKANRLYQTLKKLHNT
CG17	Cmic	    fig|31964.1.peg.6_Clavibacter michiganensis	TVRIVGTGLLGTSIALGLRARGVDVVLADASPTTLRLAADMGAGRIADISSAPDRPALVVVCVPPDVTARVVAAELAAHPDALVTDVASVKAAPLAELRAMGADLSSYLGSHPLAGRERGGPVSATGDLFLGRPWVIAGHDGITYSAGAPVEQLILDLGAVPIEMTAEEHDASVALVSHVPQVVASLLASRLADGDASALGLSGQGLRDTTRIASSDAALWVQILGANASRIVPILKALRTDLDEVIDALDDVDAQGARLRVAERIHAGN
CG98	Cneo	    gi#57229998_Cryptococcus neoformans var. neoformans JEC21	VVGIIGMGDMGRMYAKRLHAGGIETIYVCDKPDSFEALEEEFKGTGIHVLRNGHAVSRLSTFIIYSVEAAALPAVVREYGPSTRVGAVVAGQTSVKAPEREAFERWLPEDVGITSVHSLHGPSVTTEGQPLIIIHHRGPEENVKMVEDVFRSFKSRYVHLSYEEHDKVTANTQAVTHAAFLSMGTAWQKSSSYPWETTRYVSGIEVIKVNITLRIYSAKWHVYAGLALLNPSAKSQIQQYATSATELFKLMVEGRGEELEDRVWCARKEVFGWRR
CG24	Cpha_1	    gi#67936884_Chlorobium phaeobacteroides DSM 266	SISFIGLGLIGVSLLRAFRNAPIIADKQIVLQGFDPSLGKSDLPCLKNLGLDRFVTDKAELYQADLLILSAPVEINIMLLDEIKRFTTPETLITDVSSTKALIAKKAQELSLPFIGMHPMAGKEQQGYRESHEELLKGRPMIMCDDKGLLDTEKGIFLTQLLKSAGCITIAMTPEEHDQIIAKISHLPQLLSTLLMTHCAGAIDKSGPGFATLARLAGSPWKIWRDIVATNSSNIAEELEQFSKEIAELAHEVKALNMKKIEQRFTDANQLYKTLKEINRE
CG1	Cpsy_4	    fig|167879.3.peg.3829_Colwellia psychrerythraea 34H 	VVVVGGKGQLGSVFVDLFQRSDYQVAIIEQNDWPNSEAILADASLVIVAVPIRLTTMVINHLNNLPKECILADLTSIKESPLFEMKKVHAGPVVGLHPMFGPDVTGLIKQTIISCEGRNPEQYQWLIEQFEVWGAKIYPVQAHEHDQAMSMVQVMRHFSTIAYGYHLMSEGADIENLVAMSSPIYRLELIMVGRLFAQDPTLYADIIFANKDNVSMMKRFAYRFLELLEDVSLDDKDAFVDMFNNVSGWFGDYAGD
CG1	Crod	    No fig or gi#_Citrobacter rodentium	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQQDWDRASEIVADAGMVIVSVPIHVTEQVIARLPRLPSDCILVDLASVKNGPLQAMLAAHDGPVVGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSESNLALIKRYYQRFGEAISLLEQGDKQAFIASFRKVEHWFGDYAKR 
CG24	Ctep	    fig|194439.1.peg.84_Chlorobium tepidum TLS 	TISFVGLGLIGASLMQALKRAAGATGRNIEMIGFDPAFDAADIVAITGECGLDRFEPDPAKLYNADLVVLCAPVVTNIALLDEAKRHIRKDTLVSDVSSTKAEIAAKAQELGIEFIGMHPIAGREQQGYQAASPELLDGRLVILCTECATLETTLATELAGLLRAAGCKPLFMSPEEHDRVYANISHLPQLISTALMAHCRENVEWAGPGFASMARLAGSPWAVWRDIVETNRSNIADEMEAFSALLADVAGEVRGGNFEALESKFREANDLYQRL 
CG20	Cthe_5	    fig|203119.1.peg.2939_Clostridium thermocellum ATCC 27405 	KISIIGLGLIGGSLAKALKEKLGIESITAVDINEKSLSQALKEGFIKEGFTELNESVYNSDIIFICTPVKDAVEYITRLHGKVKAGCILTDTASTKGEIIDYVNSLDNPPCFIGGHPMAGTEKAGFSSSFSHLFENAYYIMSPSKNCPEESLEYLAEIIRGIGAIPIKLDSKEHDIITATISHVPHVIASALVNLVKFSDSPDGKMQTLAAGGFKDITRIASSNPKMWENIILSNKEIVKSTLNKFTETINTFIEYIDNENSNGIYNFFDSAKKFRDS
CG13	Cups	    fig|306264.1.peg.1263_Campylobacter upsaliensis RM3195 	KVGIIGLGLMGGSLGLCLKENKLISSVYGLDLDAQNAKDALELGLIHKLIGFDKLSNCDIIFIATPVNAIIEILQNLKELPKTTTIIELGSTKRKIVESLPTTLIKQTIFAHPMAGTENSGPKAAFKELYKDAVCVLCDSEVADDLHQKRAVEIFSHLGMRIVFMDSTSHDHHTAIISHLPHAISFSLANYVMREEDRRNIAYLGGPSFKGMCRIAKSSPLMWGGIFTQNKENILASIEHFQEELENCKKMLENCDENKLKKWMEKANHLREIL
CGO	Cvio	    fig|243365.1.peg.3407_Chromobacterium violaceum ATCC 12472 	TLVVAGVGLIGGSFALALKRAGRVKTVIGVGRTLANLEKALTLGVADEISQDIAAVAHRADMVLLASPVGQMGALMAALAPGLKPGAVVTDGGSTKSDVVELYRRHLPGHLPWCVPAHPIAGSDMSGAVAAQYGLYENRRVVLTPLEETAPAAVEAVADLWRACGAEIHCMDAAEHDAVFASVSHLPHLLAFAYVDRVAAKANAERCFDFAATGFRDFTRIAGSHPEMWTDISLANRDALLAELADYRCGLDRLAALLEAGDADGLNRLFGEARAARTRWHQQ
CG16	Cwat	    fig|165597.1.peg.2861_Crocosphaera watsonii WH 8501	KVGIIGLGLIGGSLGLDLRNCGHIIYGVSRKESTCNRALKKEVVDYADINLKSLSTVDIIFICTPIGLISQTLKQLIPHLSKEVIITDVGSVKTCIVKECESLWTNFVGGHPMAGTAEQGIEAAQKNLFKNAPYVITPTEKTPENSMKILEELAQSLGSLVYTCSPEIHDQSVAWISHLPVMISASLIAACSEEKDKSILKLAQQLASSGFRDTSRVGGGNPELGVMMAQYNKTALLHTLQGYSQQLDEITEYIKTEQWDSLQKLLMITQQERSPF
CG14	1Dace_5	    fig|891.1.peg.100_Desulfuromonas acetoxidans (Chloropseudomonas ethylica)	KIAIVGVGLIGGSFALALKRAGVVARVSGWDADRNNLHLAHELQVIDQLPSTLAQAVDGAELVMLAVPVGAMESAAREVIPLMASGAILTDSGSVKQCVVECLEPLALQHGVRYVAGHPISGTERSGASAAFAELYQGKRCILTPTAQSDVAALDTVTLAWQAAGSEVVTMDVLKHDRILAAISHLPHMIAYSLVNSVSDYDRYDENILDYSAGGFRDFTRIASSDPIMWRDIALTNKDSLIEMIDQFEEFLGELKNDIQQADGERLYEFFRRSKITRDALL
CG14	2Dace_5	    fig|891.1.peg.2292_Desulfuromonas acetoxidans (Chloropseudomonas ethylica)	KLAVVGVGLIGGSLALALKAAKAVGEVIGIGRGLANLEKAFDLGVVDRIEQDPRAGVADADLVFLATPVRSLESVAAVIAPCMKPGAVLTDGGSVKAEVARAIEPLMPAGVHFVPGHPIAGTEKSGAEAAFATLYQGKRCILTPTEATNPAALDLVKRVWEKAGSEVVLMDVEKHDRILAAISHLPHMVAYSLVNSVGSYDRYPENILDYSAGGFRDFTRIASSDPTMWRDIAMTNREALIEMMENFEACFAELKKDVRDGDGEKLFEFFMRSKKSRDAIL
CGO	Daro	    fig|159087.4.peg.933_Dechloromonas aromatica RCB 	KVVVFGTGLIGGSFSLALKEAEAVEEVVGFGRTPSTLRTAQELGVIDRAGINPLHEIEDADIVLVATPVAQMPEIFERIAPYLGPNTIVTDGGSTKGDVVAAARAAFGDRISQFVPAHPIAGAENSGPSAARWDLYQGRKVVVTPLPENSDDALDHIKRAWSLCGADIYELTPEMHDRVFAAVSHLPHLLSYALVHDLAVRENADLFFTFAASGFRDFTRIAASHPEMWRDICLANREALLGELDSYRAQLDELRLALAQNDGERLEEIFGIARRARRNWAGE
CG15	Ddes	    fig|207559.3.peg.3693_Desulfovibrio desulfuricans G20 	VAVVGADGRMGQLFCARARAAGMGVVALDRPLEPEAVRQAVHGVQMVLLCVPAAVLDRVAGLMSGILSGNQILADITSVKVLPMQQMRRQYSGPVVGTHPLFGPAPAQGETRVAVVPDSGHAAGEAACAAVEDFFVRLGCEPFRTTAQEHDRAAACIQNLNFITSVAYFATLAHDDAITPFLTPSFRRRLDAARKMLTEDAELFEGLFEANPYSQDAVRAFRAILNHACAGDVNLLVDRAGWWWRSSDNRGGAPS
CG29	DEHA	    fig|255470.3.peg.868_Dehalococcoides sp. CBDB1 	IGILGGSGKMGQWFGRFLTENGHQVWLWGRNPSKLAPIATRLGVQAATRPDMLGDMDCLIISVPIDTFEDTLRELAPFTKPDQLVFDLCSVKERPVELMHQYLPHCRTLGTHPVFGPGAESLKGYNFILTPTTAPETDLAQGVKTWLEKQGGNVRLISPEEHDRLMSVVLGLAHFIAIVSADTLLGQNLPGISSAGGTTFRLLDTLTKSVLTEDPGLYASLQVNMPKLPKLEADFIKRATEWAELVKNGDKAEFARRMQTLKDNLARTE
CG29	Deth	    fig|243164.3.peg.722_Dehalococcoides ethenogenes 195	IGILGGSGKMGQWFSRFLTENGHQVWLWGRNPSKLAPVASRLGSQVITQPDQLTEMDCLVISVPIDAFEDTLKEIAPFTKPEQMVFDLCSVKERPVELMHQYLPHCRTLGTHPVFGPGAKSLKGYNFILTPTTGAETELAEKVKIWLEKHGSTVSLISPEEHDRLMSVVLGLAHFIAIVSADTLLGQNLPGIAGAGGTTFRLLDTLTKSVLTEDPNLYASLQVNMPKLPGLEADFIKRATDWAELVKNGDKTGFAHRMQAIKDKLAQTEPGFEKAYQDM
CG22	Dgeo	    fig|68909.1.peg.516_Deinococcus geothermalis DSM 11300 	QAAIAGVGLIGGSVALGLRQRLLARRVIGYDASVEVLREAEALGVVDEVRATPGEWLQSCDLVVLAAPMRALAPLARDLAPFLSPTALVTDVGSVKAGIAAELEALGVRNFVPGHPMAGSERGGVTHARAALLENAVWVLTPTDHTPLTALTRMRTLVEGLGAAPVVMPPDAHDQLVATVSHLPYLASLALTHMVARDERLSLLAAGGFRDLTRVASGDPRMSRDMVVENRTALREALARFRRQLERLEADLDSPEELLAAATEGKRTRDSLP
CGO	Dhaf	    fig|49338.1.peg.2227_Desulfitobacterium hafniense DCB-2	RACVIGLGLIGGSWAGALAGQGWSVCAVECHEESLKEAKVREWIKEGWQEIPESLDVDLVILATPVSLLAESFARAVGCVSAGSLITDVGSVKIDICRAANQMNSVYFIGGHPMTGSEQQGFQAAKPNLFQGYPYVITPPPSCPQEMVEKFSQLVQRLGARIVSREAEDHDDEVALISHLPHVLSLALALTAAEGNLRGKPLEIAGRSFREITRLVDSSPEMWRDILFSNASAILRSLDIWEEKVKEIREIIAGADGEEMLKVFARAQGARSQML
CG98	Dhan	    gi#49658011_Debaryomyces hansenii CBS767	TIGIIGLGDMGYLYARRFSEAGWKVVGCDREDLFEETKAKFANENFEILLNGHYVSRISDYIIYSVEAENINKIVSLYGQSTKFGATVGGQTSCKQPEIEAFEKNLPPDTEIVSLHSLHGPNVNTTGQPLVLIRHRASDESFRLVECLVSCLRSKVVYLSAEKHDKITADTQAVTHAAFLSMGVAWKSINQYPWETPRWVGGMENAKMNISLRIFSNKWHVYAGLAITNPSAHEQIVQYSRSVTELYTLMIQGKKDELKARVFKAKESVFRHIS
CG22	Drad	    fig|243230.1.peg.1305_Deinococcus radiodurans R1	RVVVAGVGLIGGSMALGLRERGLARRIVGLDLNPDALREAEALGVVDEVRSRPGEWLREADLVVLAAPMRSLAPLAAELAPFLDPAALVTDVGSVKSGIAAELQALGVRHFVPGHPMAGSERGGVTHARAALLENAVWVMTPTEFTPLTALTRVRSLVEALGAAPVVMPPEAHDQLVATISHLPYLASLALTHMVARDERLSLLAAGGFRDLTRVASGDPLMSRDMVVENRAALRDALGRFRTQLERLEADLDDPEELLAAAREGKRTRDSLP
CG25	Dthe_6	    No fig or gi#_Dictyoglomus thermophilum H-6-12	IIGIIGLGLIGTSLALSFKKEFKNVYLWGVDKDNKVLDYLSERKILDVLGKDITRLRDLIGESDYIFISVYPSGVVDVVENLKNYVSEKVIITDTASTKFKIMNYMNRDEFLRKLFIGGHPLAGREVSGPLGAVDNLFTGKVYFLCPAFEVSEEKVEGLRRIIEKINASPIIIDPEKHDEILAFTSHLPQIIAYLLSYVSVKEDNLSFFGSGFKDTTRISKSDYNLWLDILKENDIKIKEALVEFEKTLKDLIENLERKDFEKIRHIFKDSREKRLRLR
CG15	Dvul	    fig|882.1.peg.463_Desulovibrio vulgaris subsp. vulgaris str. Hildenborough	IALVGDKGRMGRLLTSRFSAAGCEVAGVDRPLTPDTVRPAVQGADVVILCVPVEVLAEVLSIVAPLLSPKQVLADITSVKVRPMEVMQAFHAGPVVGTHPLFGPDPQDDHLPVAVTPGSSARDADVTLVEQCFRMIGCDTFRTTAQEHDRAAAMIQGLNFISSVAYLATLAHNEELLPFVTPSFRRRLDAARKMLTEDAALFEGMFEANPASQDAVRSFRSFLNIASAGDVDVLVDRARWWWRTHDDRGGARQ
CG1	Ecar	    fig|218491.3.peg.2590_Erwinia carotovora subsp. atroseptica SCRI1043	VVIIGGRGQMGNLFEKMLTLSGYQVRILEQDDWPRADELLSDAGMVIVSVPIHVTEQVIASLPILPDDCILVDLASVKNGPLQAMLAAHNGPVLGLHPMFGPDSGSLAKQVVVYCDGRQPEAYQWLLEQIQVWGARLHRISAVEHDQNMMFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELIMVGRLFAQDPQLYADIIMSSEDNLALIKRYYKRFGEAIELLEQTDKAEFISSFKKVEHWFGDYAKRF
CG1	Echr	    No fig or gi#_Erwinia chrysanthemi str. 3937	IVIVGGRGQMGRLFDRMLTLSGYQVRILEQEDWPQAESLLADAGMVIVSVPIHVTEQVIAQLPRLPDDCILVDLASVKNGPLQAMLAAHQGPVLGLHPMFGPDIGSLAKQVVVYCDGRQPEAYQWLLEQIQVWGARLHRTSAVEHDQNMAFIQALRHFATFAYGVHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSGSNLALIKRYYQRFGEAIALLEAGDKAAFVSSFKKVEHWFGDYSRRF
CG1	Ecol	    fig|199310.1.peg.3046_Escherichia coli CFT073	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQHDWDRAADIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNGPLQAMLVAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRF
CG18	Efae	    fig|226185.1.peg.1467_Enterococcus faecalis V583	RILIVGLGLIGSSLALCIKKGHPNSEIIGFDNQAEATEFAKKTGLIDEIAESLTSGARRAEIIFLCSPVKATLVQLEELNQLSLETALITDVGSTKVEINQLATKLNMKNFIGGHPMAGSHKSGVTAADERLFENAYYIFTDDHGEKNKQIQELQTLLKGTHAKFITMPAQEHDEITGALSHLPHIVAAALVNESQQLNTTYPRAQQLAAGGFRDITRIASSDATMWTDILLSNRLVLLDLLENWQKEMTTVCQWLTEKNAPAIRNFFDKAKETRAQL
CG18	Efae_1	    fig|1352.1.peg.2808_Enterococcus faecium	HVFIVGLGLIGASMALCIRQTNPELIVVGWDSQSKTREQAVEQQIVDYVASDFETGAEQADVILLAVPVRTTLAYLDVLERINLSDHVIITDVSSTKQQVVTSAEQKNLRFVGGHPMAGSHKSGIQAADAKLFENAYYIFTPLEKTKKDVEKLQELFCGTKAKYVTLTAREHDRITGMLSHFPHILAAGLVNQAEQFNQEYPRAKQLAAGGFRDITRIASSDPVMWTDILLSNKQILLERLADWQQEMTQIAEWIMTENQSEIFSFFNRAKESRDQL
CG12	Elit	    fig|314225.3.peg.737_Erythrobacter litoralis HTCC2594 	RVAIIGLGLLGGSLSLALREKLPGIATTGYDRDPATRTRAAERGLVGTVYDTAGEAVSGCELVVLCVPVGAIGEAARDIADVLPSHAIVSDVGSSKRSVQKALAEALPSHTCVPAHPVAGTEQSGPDAGFATLFDGRWCILTPPDGAPQQAIDDLTALWQALGAKVEIMDAEHHDLVLAVTSHIPHLIAYTIVGTASDMEDVTRSEVIKYSAGGFRDFTRIAASDPVMWRDVFLNNRDAVLEMLGRFTEDLTALQRAIRSGDGETLHELFSRTRDIRRSII
CG12	ERYT	    fig|237727.3.peg.3049_Erythrobacter sp. NAP1	RVAIIGLGLLGGSIGLAVREHAPGITTTGYDRDEGVRRVARERGLAAAVCDTAAEAVREADLVILCVPVGAMEAAAAELADLLPDGAIISDVGSSKQSVTEALARALPGKTIIPAHPVAGTEESGPEAGFASLFTNRWCILTPPEGTDEEALAALSDFWAKLGAMVEVMDAEHHDLVLAVTSHIPHLIAFTIVGTASDLEDVTRSEVIKYSAGGFRDFTRIAASDPVMWRDVFLNNKSAVLEMLGRFTEDLTALQRAIRSGDGDALHDLFSRTRAIRREVI
CG82	Faci_1	    fig|97393.1.peg.324_Ferroplasma acidarmanus	LLIVGSEGRLGRTLMKIFPGSSSIDLENEDQLQSELTKADFALLAVPLEETVNIIRSFPEYRGFVDLTSMKYNMEEFSGHIISIHPLFGPESYKTNKTIIFINDISTPDSLDKVKELFNGYRIISMNAREHDYLMSELLVKPYILSYISEASNTDIVTGSYIKFLEIEKIKHNENTEIFLDTIKYNERAMEIIINIEKKLDELKKLIGNR
CG13	Fbac	    fig|313603.3.peg.816_Flavobacteriales bacterium HTCC2170	NVFIIGIGLIGGSMAKDIKRLNPNTKIYGVDSSATHLDEAINLDIIDYKSSYNDLNLADIVIVSIPVDAMVIELPKILEEVNDDCVVVDAGSTKAILCKSLENHPKRRNFLASHPIAGTEFSGPSAAIDGLYQGKTNIICEVEKTAFKLQERALELFQQMGMRIRYMNPEAHDKHIAYVSHLSHISSFMLGKTVIEKEKNERDIFDMAGSGFESTVRLAKSSPAMWTPIFEQNKENVVETLEEYIQNLEDFRQLLLKDDFEGIYKEMNNTNRIKEILRG
CG13	Fjoh	    gi#90591593_Flavobacterium johnsoniae UW101	KVYVIGIGLIGGSMVLDIKDQHPDSTILGIDNNEKHLQEAIDLGVVDQAGSFEDLAEADFVIVSVPVDVALTVLPKVLDLVGDKTIVFEVGSTKKPICEAVASHPKRRNFIATHPIAGTEFSGPSAAIRGLFKGKTNIICEVEKTTFKLQEKALKLFSEIGMRIRYMDPVSHDKHIAYVSHLSHISSFMLGKTVMNKEKDEQDIFDMAGSGFESTVRLAKSSPAMWTPIFKQNKEHVLETLEAYISNLSRFRDLLKEEDYNAIFEEMESTNKIKEILNG
CG13	FLAV	    fig|313593.3.peg.860_Flavobacterium sp. MED217	NIFVLGIGLIGGSLARDLKRVLPESTIYGVDNNDDHLDEAVGLGVIDHPARFEAINQADLVILAIPVDQANLFLPPVLDAIAPNALVMDVGSTKGSVCDAVQDHPKRNQFLAAHPIAGTEFSGPSAAIENLYKNKTMILCEVEQTREDLLAKAMQIFEALSMQIRYMNPHSHDKHIAYVSHLSHISSFMLGKTVIEKEKNEKDIFDMAGSGFASTVRLAKSNPATWTPIFKENKANVLESLTEYINNLTHFKNVLEAENYEEVFNEMHNTNHIKSILKG
CG28	Fsuc	    No fig or gi#_Fibrobacter succinogenes subsp. succinogenes S85 	RITMVGFGLLASSIAAAIKQAKLPTKIRAVSSPATLKRARELELADEFFEYDETEKWAKDSDLILLCAPILHILKMIDALGKVSWAGANAAADREILVSDIGSTKVEICKAGVRLPSPFRFVGSHPMAGSEKRTCEYNDPAIFENAYWFVCPPDGTPESVYAPLLEIIRFVGANPVVFPPEHHDRTMAWVSHMPQMLSSTLAGNLPERLLKHNYQHFAGRAFRDMTRIAASGWGMWHDIAVTNRDETTRALCEVRDGLDKTIAAMNGLNVVKDGKPASGDFENDEHSV
CG14	GEOB	    gi#110601840_Geobacter sp. FRC-32	RLAIIGVGLIGGSLARVLREKGEVDEVVGIGRGEANLKKAVELGVIDSYSLDPVAGVVGADMVFIATPVCSIAGMVDKIAPGLGQGCIVTDGGSVKGEIVAPCEGIMPDGTFFVGGHPIAGTENSGVEASFSTLYQGKRCILTPTDRTDREALAKVARMWELAGSEVVEMDVEKHDHVVAAISHLPHMVAYSLVNAVGSYDRFAESILKYSAGGFRDFTRIASSDPAMWRDIALMNRGAVLEMMDYFQEHLGRLRKLVDAGDGDGLHDFFLSSKKSRDAIL
CG18	Gkau	    fig|235909.3.peg.1007_Geobacillus kaustophilus HTA426	KVFIVGLGLIGGSIALAIKKAHPEAMIIGYDVNERQLGLARSLKVIDEAARSPEDGYGQADLIVLAVPVMQTEALLSSMPLERLKRGVIVTDVGSTKQRIVQGARRLLDHGVAFIGGHPMAGSHKSGVAAARAHLFENAFYILTPTDDVPPQQVEALKQWLAGTKAQFVILTPKEHDRITGVISHFPHLIAASLVHQAREYECENALVSRLAAGGFRDITRIASSNPEMWRDIFIHNKHELLALFDRWIAEMERLRSFVEEENSIAIYHYFLEAKQFRDGL
CG14	Gmet	    fig|269799.3.peg.938_Geobacter metallireducens GS-15	RLAIIGVGLIGGSLARILREKGAVGEIVGIGRGEANLRKAVELGVIDRYSLDSVAGVEGADVVFLATPVCSIPSITAEIAPHLAPGCVVTDGGSVKEEIVSACEPLMPNGIHFVGGHPIAGTEHSGVEASFSSLYVGKRCIVTPTSRTSQDALAKVVRMWEVAGSEVVIMDTEKHDRVLAAISHLPHMVAYALVNAVEGYDRFEESILRYSAGGFRDFTRIASSDPAMWRDIALMNREAVIEMMDHFAAYFARLRELVAAADAPGLERFFRESKESRDAIL
CG31	Gobs	    No fig or gi#_Gemmata obscuriglobus UQM 2246	QITIVGVGLIGGSVGLAAKARGVAGRVVGVDRDPDCIARAAKLGAIDTGTTDLAAGVAGAQLVVVCTPVDRIAEVIVTAARHVRPGTYFTDGGSTKSNIVATVQGRLPAGVEYVAAHPLAGSEKGGAENGRADLFVNRVTVLIVGALGADWGRTVTVGRFWEALGSRVVLMNAEEHDRTVASTSHLPHAVASGVAAITPMEWLKLTAGGFRDVTRIAAGDPDLWAAIFEANRDATLAALTQFTDRMTEFRTLLESRDRAGLVRWLTEGKQVRDALG
CG12	Goxy	    fig|290633.1.peg.2186_Gluconobacter oxydans 621H	SLSVIGPGLIGSSVLRRARETRAIAETLIAADSNPAVLERVRELGIADITTSDPAVAAQADCVMICVPVGAVEEVARQVLPFMKPGSILTDVASVRGQLGPTLAAILPENVAYVPGHPMAGTEHSGPDAGFSTLFEDRWALLVPPEGADTKAVNTIEQLWTLCGARTKILSDEKHDRICAMVSHLPHLLAFTICDTADNLSDEIRAAVLDYAASGFRDFTRIAASDPVMWRDIFLANKEALLGTLDKFVADTQAMADAIRTGDEAAITSKIERGRAIR
CG18	Gste	    fig|272567.1.peg.1853_Geobacillus stearothermophilus 10	KVFIVGLGLIGGSIALAIKKAHPEAMIIGYDVNERQLGLARSLKVIDEAARSPEDGYGQADLIVLAVPVMQTEALLSSMPLERLKRGVIVTDVGSTKQRIVQGARRLLDHGVAFIGGHPMAGSHKSGVAAARAHLFENAFYILTPTDDVPPQQVEALKQWLAGTKAQFVILTPKEHDRITGVISHFPHLIAASLVHQAREYECENALVSRLAAGGFRDITRIASSNPEMWRDIFIHNKHELLALFDRWIAEMERLRSFVEEENSIAIYHYFLEAKQFRDGL
CG14	Gsul	    fig|243231.1.peg.2590_Geobacter sulfurreducens PCA  	RLAIIGVGLIGGSLARALRTAGAVGEIIGIDRDEANLRQAAELGVVDRAAATVAEGVAGADMVFLSVPVRAMAGVVREIAPHLAAGCIVTDGGSVKAEVVAACDPLMPAGTCFVGGHPIAGTEHSGVGASFATLYQGKRCILTPAATTDRDALATVARMWEAAGSEVVLMDPEKHDRVVAAISHLPHMVAYALVNAVEGYDRFEESILRYSAGGFRDFTRIASSDPAMWRDIALMNREGVLEMMDHFAAYFGQLRSLVAAGDAEGLERFFRDSKESRDAIL
CG14	Gura	    fig|351605.3.peg.1757_Geobacter uraniumreducens Rf4	RLAIIGVGLIGGSLARILREKGAVVEIVGIGRGEANLRKAVELGVIDRYSLDPVAGVEGADLVFLATPVCSIIDMVARIAPALAPGCVVTDGGSVKGEIVAPCEKLLPPGTFFVGGHPIAGTEKSGVEASFAALYQGKRCILTPTAQTDGEALRKVVRMWELAGSEVVCMDVEKHDRVVAAISHLPHMVAYSLVNAVGGYDRFSENILKYSAGGFRDFTRIASSDPAMWRDIALMNREAVLEMMDFFSEYFAGLRNLVEKGDGHGLEAFFARSKQNRDAIS
CG16	Gvio	    fig|251221.1.peg.406_Gloeobacter violaceus PCC7421	KIGIVGLGLIGGSLAHDLGRHHEITGVSRSSATVAEALSQGLIRQGGESLGLLGSCELVFVCTPIGLTLETIRALAAVLPPETILTDVASVKAAIVPAAEALWPNFVGGHPMAGGEAQGLSAARAGLFRGRPYVLTPTPRTPAAACTALEDLVGELGARLVRTDPETHDRAVARISHLPVFVGAALLLNLAASGDPTASTLASSGFFDTTRVGGGNPQLGAAMAEWNRAALLAELCSYRDHLGRLEQAIAAGDWQAVEQRLGECRKTRREV
CG81	HALO_6	    fig|64091.1.peg.1136_Halobacterium sp. NRC-1	EVLVVGAGAVGRWVAEVVAAPAAFADTDPQRAVAAADATENARAVAVDTAASFAVVAVAVPMRAAGAAIDAHAAAAERAIVDFTGVMGEPLAAMAAAGPPGVERASFHPLFAPAHAPGRIAVTDGDGGPTVDRLRGWLADAGNELVEVPAAVHDDAMETIQGRTHAAILAFALAADDVPDALATPVYEELSRLADRVTGGTPGVYADIQSTFGGSQEVAAAADRIAAAAAGDGDAFAEVYEDAS
CG6	Hche	    fig|349521.5.peg.4370_Hahella chejuensis KCTC 2396	CLAVVGLGLIGGSLAKAVKERGLAEKVIGYDRRDTEAALAVRMGVVDESAPDLVTLASRADVIVLAVPVGAVAPVLEEMKPALRSDHILTDVGSVKGEIEKAFVSVFGEMPANAVLGHPIAGSEKSGVQAANSALFENHKTILTPLPVTDSQALGVVAALWRGMGAEVLFMSVAHHDEVLAATSHLPHLIAFSLVDTLAGADDNKEIFRYAAGGFRDFTRIAASDPVMWRDVYLTNRDAVLKVLNAFDADLKKLRNAIADGDGQTLLGVFTRARAAREHFT
CG5	Hhal_3	    gi#88950354_Halorhodospira halophila SL1	RLAIIGVGLIGGSLALSLRRSGAVEEVIGCGRSAENLERAQALGVIDRGCHDPAEAAAGADLVVICVPLRAMRGVFAALEHAVEPGTVVTDAGSVKGSVVEDARAVFGTPPPWLVPGHPIAGTENSGVEAAFAELYDRRRVILTPTPQNPQDAVERVAAMWRAAGAQVVRMEADHHDEVLAATSHLPHALAYALVDALAGWDDRQEIFEYAAGGFRDFTRIASSDPAMWRDICTANRDHLVAALRRYQQDLGRLTDALAAGDDEQVLRVFENAQEARAGFLRL
CG13	Hhep	    fig|235279.1.peg.993_Helicobacter hepaticus ATCC 51449	NIGIIGLGLMGGSMGLALREVGQIQNKHINRILGYDKNALHSQQALNLGLVDECVPLNEIWQCDVIFLSVPVDGIVELISSIKPQDISENATIIDVGGAKVQILSDIPSWLRHHFVGAHPMCGTEFFGPKAAFGELYKNNIVILTDLEQSGAYQAEIAKDIFIGIGMKILKMDAHSHDKHIALISHMPHIISYALANATLAQEDPQTILALVGGGFRSMSRISKSSPLMWKDVFKQNKENVLEAMAYFQAKFNEAKELLEREDWEGLELFMAQANTLQKFL
CG1	Hinf	    fig|71421.1.peg.1230_Haemophilus influenzae RdKW20	IVIVGGYGKLGGLFARYLRASGYPISILDREDWAVAESILANADVVIVSVPINLTLETIERLKPYLTENMLLADLTSVKREPLAKMLEVHTGAVLGLHPMFGADIASMAKQVVVRCDGRFPERYEWLLEQIQIWGAKIYQTNATEHDHNMTYIQALRHFSTFANGLHLSKQPINLANLLALSSPIYRLELAMIGRLFAQDAELYADIIMDKSENLAVIETLKQTYDEALTFFENNDRQGFIDAFHKVRDWFGDYSEQF
CG81	Hmar_2	    fig|272569.1.peg.498_Haloarcula marismortui ATCC 43049	NVLVVGAGAMGQWFARTVRTHADAAVAFTDVDQSAAEAAANAVGGRAVASDAAETFDVVCIAVPMPVAETAIDEFAPCATDAIVDVTGSMAGPIAAMRDAMPDGQRLSLHPLFAPENAPGNVAVVADALGPDATAVVDAIAAAGNNCFETTVSEHDEAMETVQASAHAAVLAFAMAAADVPDQFQTPISAGLFDLVEQVTGGDSRVYADIQRTFDGADAVADAASELADADADTFERLYEQLS
CG21	Hmob	    No fig or gi#_Heliobacillus mobilis (IG-37)	RVAIIGLGLIGGSLGMALTQGRIVEEVIGFDQDEEALSLALSTQTVHRVERNMAEAVQNADLVIMATPVCTYPSIVAAIKTSLRPGTIVTDVGSTKSWVMDQMKRLLPEGIAFVGGHPMAGSEKKGIRGADRYLLENAVYVLTPDRDTVPEAIDAVKAIMCAVGARVLKLSPLEHDQMVAVVSHLPHMVAVALVETLSEVAKSYTQAPMLAAGGFRDTTRVAAGDPRMWVDIAKTNREPLLHTIGLFRRALDRLESEIGGCSSDGTDQVASLQNTLSHAR
CG13	Hmus	    fig|217.1.peg.608_Helicobacter mustelae ATCC 43772 	QAGIIGLGLIGGSLGLALKETKMFKMILGYDCNSLHMQQALSLGLIDECIELHEIKQCDVIFLAIPLDAITKTLKNFGSLSPHSTIIDLGSAKEQILREIPQNLRKNYIGAHPMCGTENNGPKAAIKGLFDKKIVILTSIEQSGEFQVAFCKEIFIAIGMQIVKMQAKEHDEHIALISHLPHLISYALANTVLEQEKKEFILTLIGGGFRDMSRISKSSPIMWRDIFKQNRKNVLESLGLFEKQIQAAQQMLEKEDYQGLEKWMSNANSLKNFI
CG13	Hpyl	    fig|85963.1.peg.1290_Helicobacter pylori J99	KAGIIGLGLMGGSLGLALQEWGRFKSVIGYDHNALHAKLALTLGLVDECVEFEKILECDVIFLAIPVEGIIECLKKMTPIKKSATIIDLGGAKAQILHNIPKSIRQNFIAAHPMCGTEFYGPKASVKGLYENALVILCDLEDSGTEQVEIAKEIFLGIKARLIKMKSNEHDTHVAYISHLPHVLSYALANSVLKQNDPEMILSLAGGGFRDMSRLSKSSPLMWKDIFKQNRDNVLEAIEKCEKEIAQAKAWIENNDYESLAEWMAQANKLQEFM
CG1	Hsom	    fig|205914.1.peg.1395_Haemophilus somnus 129PT	IVIVGGKGKLGALFARYLSSSGYQIAVLEKQDWQSADKILQNANVVIVCVPIAQTLNVIDRLKPYLTENMLLTDLTSVKRQPLEKMLQVHQGAVLGLHPMFGPDITNMAKQVVVRCDGRYPEKYQWFLEQIQMWGAKIYQVDATEHDKSMTYVQALRHFSTFANGLHLSKQPIELAQLLALSSPIYRLELAMIGRLFAQDAELYADIIMDKSENLEVIKSLKQSYEESLNFFEHNNKQGFIDCFNQVREWFGEYSEQF
CG81	Hvol_1	    No fig or gi#_Haloferax volcanii DS2	DVLIVGAGAMGRWFGRTVDADLAFADADPESAVAAADALGGRAVPLDGDERFDVVCLAVPMRLAADAVADNAHRADAAMCDVTGAMKPPVVAMRNHLPDRERLSLHPLFAPHNAPGNVAAVADESGPKTDTLLADLDAAGNRVFETTPEEHDAAMETVQAAAHAAVLAFGVAADDVREEFATPISAALDELVASVSGGTPRVYADIQSSFGGGADRVADAARALAAADDEAFDDLYRRVSRGDSGVAAGAD
CG1	Iloi	    fig|283942.3.peg.1532_Idiomarina loihiensis L2TR	VFVFGGKGALGARLVSQLRQTGYSVITIDKDDDWPDKDDLSQAQLVLMSVPVNKTVELIKQLPPLAEDCVLADVTSIKAAPLNAMLAQHSGPVVGLHPMFGPSVQNLAKQLVVVTHGRQPERYQWLLDQFVNWGAHLHEVNADKHDDAMGWIQAMRHLSTFAYGVHLANERVDIKELLELSSPIYRMELMMIGRLFAQNAELYADIIAANKGQFASIRRYLQQFSAIIDDIENGKKSDFISLFDEVSQYFGEFSSQF
CG17	JANI	    fig|313589.3.peg.1373_Janibacter sp. HTCC2649	RVHIIGTGLIGTSLGLALSSAGRAVTLEDISSTNAALARDLGAGEASTDVDPDLVVVATPPDVTASCVAAALERWPRAFVTDVASVKGVVIDGLRSRGADLARFCGSHPMAGRERSGAVAGRQDLFHGRAWVLTPTEETQDAARQVVADVARSVGAEVLTLEPAEHDAAVASVSHVPQLMASLVAARLEHLAESSVALSGQGIRDVTRIAASDPHLWTQILSGNASAVRDVLGSLATDLDGVIAALDALGSDDDAPGARGTLAKAIAAGN
CG26	JANN	    gi#89056034_Jannaschia sp. CCS1	SVGIVGFGAFGKLIAQSLHGHFDLKAHDPRSDHHDVAANLGVRFTSLEAVARCDMIVIAAPVSSFEDVLVSIATVCRPGTLVIDVGSVKVHPADLMEKHLPDYVNIVATHPLFGPQSACDGIKGLKIAVCPIRGLKHWPLAVFLRKHLGLQVIMTTPHDHDREAATVQGLTHLIAKVLQRMGPLPSRMTTRSFDLLVEAVSMVQTDAPEVFDAIEKANPYSADIRRSFFELAHKLSVELESNV
CG98	Klac	    gi#49644201_Kluyveromyces lactis NRRL Y-1140	TIGIIGLGDMGLLYATRFSKAGWRVICCDRPEFYEELKEKYSSESFNVVENGTLVSRASDYIIYSVEAENIENIVKMYGAASKVGSIVGGQTSCKNAEINAFEKYLPSDCEIVSVHSLHGPKVNTEGQPLVLINHRTKSQESFDLVESLMSCLKSQHVYLSYEEHDKITADTQAVTHAAFLSMGVAWYKIRIYPWTLGVNKWHGSLENVKVNISLRIYSNKWHVYAGLALTNPAAHKQITQYAKSATELFTLFVEGKKDELTKRLQVAKDFVFGNHN
CG1	Kpne	    fig|573.2.peg.6446_Klebsiella pneumoniae	VVIVGGGGQMGRLFEKMLTLSGYQVRILEKNDWARAADIVADAGMVIVSVPIHTTVETIGRLRPLPADCILVDLASVKAEPLQAMLAAHQGPVLGLHPMFGPDSGSLAKQVVVYCDGRQPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVRLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSENNLALIKRYYQRFGEAIGLLEQGDKQAFIDSFRKVEHWFGDYAQRF
CG17	Krad	    fig|266940.1.peg.4186_Kineococcus radiotolerans SRS30216	TVRVVGTGLLGTSAALALTLRGVDVVLVDPSPTAVALARDLGAGRFPAAGDDPRLVLVAAPPDVVADVVAAELIAFPDAVVTDVASVKGGPLAALTARGADLSRYVGSHPVMAGRERSGAVSARTDLFAGRPWVVAAHDLAAPAAVRAVHDLATDCGGVPVTMGAAEHDAAVAVVSHAPQVAASLVAARLREASEPAVALAGQGLRDVTRIAGSDPTLWAQILAGNAAPVADVLEDLRRDLDDVVAALRALARDPAAPGARGRLARVIAD
CG95	1Lcor_3	    No fig or gi#_Lotus corniculatus var. japonicus	KIAIIGFGNFGQFLARTLVRQGHTVLAHSRSNYSDAAKNLGVAFFPNADDLCEEHPEVILLCSSIISTEQVLLSLPLQRLKRSTLFVDVLSVKEFPKSLLLKVLPSDFDIVCSHPMFGPESASCGWNGMPFVYEKVRIGEEEQRVARCQKLLDVFEREGCRMVEMSCTDHDFYSAGSQFITHTVGRVLGMLMLESTPINTKGYESLLNLVENTAGDSFDLYYGLFMFNKNSLEMLERLDFAFEDLKKQLRKQLFENAGKVQILQDEDYAGLLR
CG95	2Lcor_3	    No fig or gi#_Lotus corniculatus var. japonicus	KIAIVGFGNFGQFLAKTIALHGHEVLAYSRSDYSDVAQKLGVSYFNDADDLCEQHPDVILLCTSILSTEKVLKSLPVQRLKRSTLFVDVLSVKEFPRNLFLQHLPPDFDVLCTHPMFGPESGKNGWKGLPFLYDKVRIGGDESRTSRCDQFLDIFSKEGCRMVEMSCAEHDWHAAGSQFITHTTGRFLEKLKLEATPIDTKGYETLLSLVENTAGDSFDLYYGLFLYNLNAMEQLERLDLAFESLKKQLFDRLHGIYRKKVFKNEEKVSVLPD
CG95	Lesc	    No fig or gi#_Lycopersicon esculentum	KIAIIGFGNFGQFIAKSFIKQGHVVLAHSRSDYSLIAQSLNVHFFQDPNDLCEQHPDVILLCTSINSLENVIRSLPIQKLKRNTLFVDVLSVKEFPKNIFLQSLPKEFDILCTHPMFGPTSGKDNWKGLPFMYDKVRIGQEESRIKRVNNFINIFVKEGCRMVEMSCSEHDKYAAGSQFITHTIGRMLQRLGAQTTPINTKGYESLLNLMENTTSDSFDLYCGLFMYNNNSMEVLEKLDAALDSLKRELFGQVFVVRVYNS
CG18	Linn	    fig|272626.1.peg.2025_Listeria innocua Clip11262	TVVIVGLGLIGGSIALAIKAKHPEAHIIGIDVSYHSLEVGKSLGVIDEIGESILIDGPKADLLIFCCPVKETEQLLTRLPGLRLKKNVIVTDTGSTKGTIMEASTALRESGITFIGGHPMAGSHKSGVRAAKELLFENAYYLLTPTKDVAEAKVAELKTWLSGTNAKFLVLSPNEHDEITGMLSHLPHIVAAALVNQTQSFTEEHPAAFRLAAGGFRDITRVASSDPRMWTDISISNQKTLTKQLTIWRDSMNQALEMLESEDANSIYAFFDGAKEFRDSL
CG28	Lint_1	    fig|267671.1.peg.2379_Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130ORPHAN	NILIYGLGLMGASLSLALKQKGISASITGVVGSTKSKIKGQSLKSADQILTSEEFRSTQSWKDYDFIIFGVPVDLTVKLISELPTDFSGIITDLGSTKKEIIHAVETHFSSGHNYISSHPMCGSEESGLEFANSSLYEGRLCILTSPKNVKLGIQDRLKNFWKFVGTTTIEISAEEHDSILSYLSHSPHILSSIMADWAANQKTIKRYTDLSPIPLNGGGFRDMTRIAGSNPKMWAAIFGSNQDEIFRSLSDFRDRLDIILEKLNPKNTLDPEEWERFMEISRRSRD
CG18	Llac_1	    fig|272623.1.peg.1789_actococcus lactis subsp. lactis Il1403	KILIIGLGLIGSSIALGIKKAHPEFEILGSDREEVENIAQKRGIIDSKVELVKGAQEADIIILAVPISVTLELLKQIATFDLKDGLLITDAGSTKSEIVELANQLFSGTKVKFIGGHPMAGSHKSGVMAADLNLFENAYYVLTEESQELRELLKGLHAKFIILDAKEHDKVTGQVSHFPHILASTLVWQSDDYAKEHPLVKHLAAGGFRDLTRIAEADSLMWTSVLLSNPEITLERIENFKKHLDEIALKITKRDSQAIEHFFEEGKKIRQAM
CG18	Lmon	    fig|169963.1.peg.1915_Listeria monocytogenes EGD-e	TIVIVGLGLIGGSIALAIKAKHPEAHIIGIDVSYHSLEVGKSLGVIDEIGESILIDGPKADLLIFCCPVKETEQLLMRLPGLRLKENVIVTDTGSTKGTIMEASTALRESGITFIGGHPMAGSHKSGVRAAKELLFENAYYLLTPTKDVTEDNVTDLKTWLSGTNAKFLVLSPNEHDEITGMLSHLPHIVAAALVNQTQSFTEEHPAAFRLAAGGFRDITRVASSDPRMWTDISISNKKTLTKQLTIWRDSMNQALEMLESEDATSIYAFFDGAKEFRDSL
CG18	Lpla	    fig|220668.1.peg.1693_Lactobacillus plantarum WCFS1	TVLIKGLGLIGSSLALSIKQAHPTVHIIGIDRDDVSLSYARQQGMIDASGTDLAAVASDADVIILAGPVDVIVADLHRLAMMPLKAGVLVTDVGSTKQVVMHAALAIQQHGVTFIGGHPMAGSHKSGVTAGRANLFENAFYLLVPGRTNQAAVQRLQALLQATHVKWLTVTAIQHDRIVGQLSHLPHIVAAALVDQTQVALADSALGLRLAAGGFKSITRIASSDPTMWAAILMTNAELITNQLQGYIDQLLRIKTAIRVHDQATLYEFFATAKVTRDHL
CG12	Lves_1	    fig|314232.3.peg.2934_Loktanella vestfoldensis	KVALIGLGLIASSMCHAIRRSGLARQIVGYARSAETRATAREIALCDLVTDTAAEAVADADLVVLCVPVGAMADVARDIGPHLKLGATLSDVGSVKRAVIDAVAPFVPEGVHFIPAHPLAGTEHSGPRSGFAELFDNRFCILVPVAGTDPAAVARLADLWRGMGSNVDEMDADHHDLVLAVTSHTPHLIAYTMVGVADELRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLHNKEATLEILGRFTEELFALQRAIRLGDGDHLHAYFTRTRSIRRSII
CG17	Lxyl	    fig|281090.3.peg.1564_Leifsonia xyli subsp. xyli str. CTCB07	PVRVVGTGLLGASVGLGLRARGVDVLLADASTAHLRLATDYGAGRPDDGGAEPALVVVAVPPDLVARVVAAELAAHPGAIVTDVASVKVAPLAELEQGGADLSRYVGSHPLAGREKGGPSAARADLFIGRPWVVAVRPENPRAAVSLVEALILDLGATPIELGAAEHDAAVALVSHAPQIVSSLMAKRLSGSTDAALGLAGQGVRDVTRIAGSEPELWVQILGANAPAIVEILRAYRDDLDRVLVALGDVDAPGSRRIIAEEIAGGNAGV
CG80	Mace	    fig|188937.1.peg.4480_Methanosarcina acetivorans str. C2A	VLILGGTGEMGQWFTRFFKERGYKVTVWGKGGKVEVARKLNVPFASELDAAIPENDIVIVSVPINVTEETIAEVAPKMKAGSLLMDFTSTKVKPVEAMQRFAPAGVEILGTHPMFGPTIPTIRGQTVILVPVKERSEKWFPVIRQLFEEGGAHVEITTAAEHDRLVSVVQGLTHFAYISIGTTIDRLDFDIKKSRKFVSPVYSIMLDFVGRILGQNPYLYALIQMENPGIPEVHEAFIEECEELSSLVRAHDEEGFVRKMKAAARKYDD
CGO	MAGN_1	    fig|156889.1.peg.1669_Magnetococcus sp. MC-1	RLTLIGVGLIGASLAQALRKRDLVGEIVGVDRRRASLDYALEQGIIDRVETHAARGVEGATLVLIATPVSTIVSMVEDCVAGLGRGVVVTDVGSVKGRIVERCEALMPEGCAFVGGHPIAGREHSGVEAALASLFDGARTILTPSSVTPRWALELVTEMWESVGATVESMEPHWHDQVLAATSHLPHLMAYNVVNTLSDLEDHLRTEVFRYAASGFRDFTRIASSDPTMWRDICLENKDAILSILGRFKSDLEKLTKRVE
CG6	Maqu	    gi#77952716_Marinobacter aquaeolei VT8	RVAVIGLGLIGGSLASAIRTQQLAGMVTGFDTRQDELALGVELGVIDEAADSIEQAVKGSDLVVLAVPVRATRAVLEQIRPVIEEGAILSDVGSTKSSFVADVEAVFGELPPWVIPGHPIAGSEKSGIRAARPDLFTNHKVILTPAQNADQAGLNRLRTVWEGAGATVLTMSVGYHDEVLAATSHLPHLIAFSLVDTLAGEDENMDIFRYAAGGFRDFTRIAASDPVMWHDIFLSNRDAVLRVIDHFTEDLDQLRAAIACGDGATLLRVFSRAKAAREHFS
CG17	Mavi	    fig|262316.1.peg.277_Mycobacterium avium subsp. paratuberculosis str. k10       	PVCVLGLGLVGGSIMRAATAAGREVFGYNRSIEGAQAATADGFDADTDLTATLSRAADSDALIVLAVPMPALPSMLAHVKETAPQCPLTDVTSVKKAVLDEVVAAGLRDRFVGGHPMAGTAHSGWTAGHAGLFTGAPWVVSVDDHVDPVVWAMVMTLALDCGAVVVPARSDEHDAAAAAISHLPHLLAEALAVVAGDVPLAFALAAGSFRDGTRVAATAPDLVRAMCEGNSDQLVPTADHVIELLRRARDSLAHHKSVADLIEAGHAARTRYDSFP
CG80	Mbar	    fig|269797.3.peg.484_Methanosarcina barkeri st. fusaro	VLILGGTGEMGQWFTRFFKQKGYEVTVWGKGGKTEIASKLGVPFASDLEKAVPESDILIVSVPINVTEETIAEFAPKMKSGSLLMDFTSIKVKPVEAMKKFAPSDVEILGTHPMFGPTIPTIRGQTVILVPVKGRSEKWFPVIRELFEEGGAHVEITTAAEHDRLVSVVQGLTHFAYITIGTTIDRLDFDIKKSRKFVSPVYAIMLDFVGRILGQNPYLYALIQMENPGVLEVHDAFIRECEELSRLVRAHDEESFVKKMKSAARKYGD
CG17	Mbov_3	    fig|233413.1.peg.3747_Mycobacterium bovis AF2122/97	PVCVLGLGLIGGSIMRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPGMLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFNRAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVTAAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQSHGSIADLADAGHAARTRYDSFP
CG80	Mbur	    fig|259564.1.peg.2246_Methanococcoides burtonii DSM 6242 	MLIIGGTGEMGKWFTKFFTDHGYEVVVWGSSQKTEIAKQMGVEFASDLDNAIRTSDIVIITVPIDITADVIRETAPKMKAGSLLMDLTSIKAEPVRAMRETAPDGVEILGTHPMFGPSIPTLQGQIVIMSPTKGRSEKWFPIMRNLFEENGAHIEIIKPEEHDKFVSVVQGLTHFAYITIGNTFKSLDFDVSMSRRFMSPVYEIMVDFVGRILGQNPYLYAHIQMQNEQVLKVHETFISECNILSEIVREQDIEAFCNKMTEAAAHFKD
CGO	Mcap_1	    fig|243233.4.peg.782_Methylococcus capsulatus str. Bath	RFCIIGVGLIGGSAALRARGFCGEIIGVDADPANLDRAEALGVVDRGRVDPEQGVEGADFVLIATPVGTIEPLFRRLRPVWRPECVYTDAGSTKGSVVDAARRVFGKVPSNFIPGHPIAGAERSGVEAADASLFEGKRVILTPLPDSAPDALARVGEFWTYLGAKVERMEAERHDEVLAATSHLPHVLAFTLARMLGRKDEQAEIFRYAAGGFRDFTRIASSDPRMWLDICRANREPLLELLAEYEAALREVAGLIRNDDAGRLYACFSEARSAREKF
CGO	Mdeg	    fig|203122.1.peg.1111_Microbulbifer degradans 2-40	KLVVVGIGLIGGSLAAACKKRGVCSEVIGVARRAEVCERAVANGVVDRATTQISELAGELGEGDVVFIAVPTLTVKKVLAEIKSCLSPAVTITDGASVKGSVRDDVVAIYGGEPSQVVLGHPIAGSEKSGVDAADPELYVDHRIILTPLKGNGVNHIERVTKMWQAVQAEVLEMDVDEHDAVLASTSHLPHAIAFSLVDTLAHDHQNENIFRYAAGGFRDFTRIASSDATMWRDIMLSNKPAVLSAIDMFVANLTRLRGMIEAEDATNITGVFTRAKAARDRF
CG12	MESO	    fig|266779.1.peg.199_Mesorhizobium sp. BNC1CG4	KIALIGIGLIGSSIARVIRREGLAKTIAIATRRAETLARARDLGLGDEYFAKAADAVADADLVIVSVPVGASGSVAREIAGALKPGAIVTDVGSTKQSVIEQMKPALPDFVHFIPGHPIAGTEHSGPDAGFAELFEGRWCILTPFADTDENALSRLTQFWERCGSKVDVMDAQHHDLVLAIVSHLPHIIAYNIVGTADDLETVTKSEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKDAILEMLARFSEDLSALQRAVRWGDGDKLFDLFTRTRTIRRSII
CGO	Mfla_5	    fig|265072.1.peg.206_Methylobacillus flagellatus KT (IG-25)	KLLVFGVGLIGGSLALALKAANKDWHVTGIGRTGDSLQEALALGIIDEAASDPVTALKDVDVVMIATPVAQIASILERIAPHLEENTIVTDAGSTKAEIVEQAHRILGEAASRFVPGHPIAGAEKSGPSAAQATLYQNKKVILTPCAHTDPAAIQAIHELWLSTGAIVRQMSPAEHDTVFAAVSHLPHLLAFALVDELAARPDADQFFEFAASGFRDFTRIAGSSPEMWRDISLANRTALLQELDHYQASLARLRQTLEQGNAASLQAIFERASHARNAWAER
CG1	Mhae	    fig|75985.2.peg.2378_Mannheimia haemolytica	IVIVGGKGKLGGLFGNYLTLSGYNVEALGRDDWDNAEQILANADVVIVCVPIANTLATIERLQSYLTENMILADLTSVKHQPLQKMLEVHNGAVVGLHPMFGPDIASQAKQVVACCHGRFPERYQWLLEQIKIWGAKIEEIEAAAHDNAMTYIQALRHFSTFAFGLHLSRQPVQLSQLLALSSPIYRLELAMIGRLFAQDGSLYADIIADKPENLATIETLKESFEQGLDFFKRNDKAGFIKAFEEVHHWFGDYSEQF
CG83	Mhun	    fig|323259.5.peg.1087_Methanospirillum hungatei JF-1  	IGIIGGTGGMGNLFSQVFRNAGHEVLIAGRNTPLKKEDIARLADVIVISVPIRDTVSVIYEIAPLLGEHQILADLTSLKIDPVNAMMCSKARVIGLHPMFGPTVGTIQGQTIVATPARCHENDLSFFQKIFESQGARVTITTAEEHDRMMAVIQGLTHFKAILLAGTMRRLGISPADTESYMSPVYRIETGIAGRLLAQNPDLYADILCMNPQVPSVLDTCKQAFDEMLCIIQEGDRNAFTGEFLASREWYGSFC
CG80	Mjan	    fig|243232.1.peg.633_Methanocoldococcus (Methanococcus) jannaschii DSM 2661	ISIIGGTDGLGKWFARYLKNKGFNVIVTGRDIEKGKNVEKELGVEFTNNNIEAAKKGDIVIVAVPINVTERVIKEVAPHVREGCLLMDITSIKEIPSKAMEEHVKEGVTVIPTHPMFGPSTPSLLRQVVILTPSEKHKNTEWFNKVYNFLKKEGAKVIVIPPEKHDRIMGIVQGLTHFAFISLGATLKELNVDIKESRKFASPIYELMISIIGRIIGQNPYLYADIQMFNPRIKEIHETFINQCKEISEIVKNKDREGFVKIMKEAAKHFGSE
CG80	Mkan_1	    fig|190192.1.peg.795_Methanopyrus kandleri AV19	IAILGGTGAMGRLIARELRDDGHEVVITGSNPHTAERVARELDVEAAPTNVDAAKDADVVVVSVPISVTEDVIREVAPHVPEGSLLTDVTSVKVRPVRAMLEHAPEDVYVLGTHPLFGPTVPSLRGQTVILTPTERSGPWTRRVRRYLERKGARVVETTPEEHDRTMAVVQCLTHAVLLAAGAAIGRFLPSLELDIEEVASPVYRLLMDVVGRIAGQDPRLYAEIQAFNPYGDEAREELLRALRRFHEHAHDHNALTEYIAESRERLGRE
CG17	Mlep	    fig|272631.1.peg.1472_Mycobacterium leprae TN	PVCVLGLGLIGGSIMRATAEAGREVFGYNRSVKGAQSARSDGFDATTKLADALVRAADTHALIVLAVPMPALPAMLAHIRELAPNCPLTDVTSVKTAVLDAVVSVGLQARFVGGHPMTGTAQSGWGAGHGGLFNRTSWVLSVDDHVDPAVWSMVMTLALDCGALVLPAKSDEHDAAAAAISHMPHLLAEALAVAAAEVPLAFAVAAGSFRDATRVAGTAPDLVRAMCEGNSGQLLSSVDRVIELLCRARDSLACNNSVAELVEAGHAARARYDSFP
CG12	Mlot	    fig|266835.1.peg.2723_Mesorhizobium loti MAFF303099	KIALVGIGLIGSSLARVIRREGLAGHVAISTRSATTLKRAEELGLGDSYTTDAKEAVRDADLVIVSVPVGSSGAVAEEIAPALKKGAILTDVGSTKASVIAQMQPHVPDGVHFIPGHPLAGTEKSGPDAGFADLFDNRWCIFTPLPGTDPEALERLSEFWRRCGANIDTMDPQHHDMTLAIVSHLPHIIAYNIVGTADDLESVTKTEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKDAILEMLARFSEDLAFLQRAIRWGDGDKLFDLFTRTRAVRRSII
CG12	Mmag_1	    fig|188.1.peg.9423_Magnetospirillum magnetotacticum MS_1	TVCFVGIGLIGSSLARAMRKHGLARRFLTLDPSEKARKVAVELGVTDAASDNPAAMIPDADLVVIGAPVGATPAVGEAIGPHLKPGTIVTDVGSVKLSVIRDLGPHIPEGVELVPGHPIAGTEHSGPENGFAELFEGRWHILTPVTGGDPKAVDKVAELWRRVGSQVEIMDPHHHDKVLAITSHLPHLIAYTIVGTANDLEGQMQQEVIKFSASGFRDFTRIAASDPVMWRDVFLNNREAVLEVIQRFTEDLTALQRAIRWGEGEVLHKRFSETRAIRRAII
CG80	Mmar_5	    fig|267377.1.peg.1514_Methanococcus maripaludis S2	ISIIGGTDGLGKWFASFLKNRGYDVLVSGRDVIKGKEVEKELGVTYTNNNIDAAEKGDIVIISVPINVTESVIKEVAPHVKKGSLLMDITSIKERPAKLMAEFSKTGVFVLPTHPMFGPETPSLNRQVVILTPTEKEKTNPFFEKIKEFLEIEGAKVIVVSPKEHDKIMGVVQGLTHFVYISLGSTLKDLGIDIKESRNFASPIYELMINIIARIIGQNPYLYADIQMHNPQIKTIHETFIKNCENISEIVQNKDRDSFVENMKNSARHFGN
CG17	Mmar_4	    fig|216594.1.peg.258_Mycobacterium marinum M	PVCVLGLGLIGGSIMRATAAADRVVFGYNRSVEGANGAQSDGFEATTDLAETLARAADTNALIVLAVPMPALPSMLTHIRELAPSCPLTDVTSVKTAVLEEVTEAGLRERFVGGHPMTGTAHSGWGAGHGALFTRAPWVVSVDDHVDPVVWSMVMQLALDCGAVVVPAKSDEHDAAAAAISHLPHLLAEALAVTAAEVPLAFALAAGSFRDATRVAGTAPDLVRAMCEANTGQLVPAADRIIELLNRARDSLACNGSVADLVDAGNAARTRYESFP
CG83	Mmar_6	    gi#110604808_Methanoculleus marisnigri JR1	AGIIGGTGQMGRFFAGVFQAAGWETIVSGTATSLTNRAVAETADLVMVSVPIRATVGVIREVAPLLSEEQVFCDLTSLKVEPVRAMLASRAEVIGLHPMFGPGAASLRGQTIVATPARCSPETLEGLLSVFRDQGAAITLSTPEDHDRMMAVIQGLTHFGTLAKAEAIRRTGADVAETLRFTSPVYRIEMGLVGRLLAQDAGLYGDMLQMNPAVPEVLAQFEEAVRTLREIVESGDAERFRDFFTANAGHYASYLRAATEETDDLISHVVS
CG30	Mmar	    gi#110609330_Maricaulis maris MCS10	PVGLIGLGAFGRLAATHLSPHLDLVAHDPAVAELDSVACVSLAEAASRPVVILAVPVQLIAEACQQIAPHLPEGALVLDVASVKLKPMAAMRAHLPAGTRILGTHPLFGPQSAADGLGGQSIVLCPEPGVDPACIADFLRDDLRLDVHISDADTHDRTMASVQALTHLVSKVITDLDLPAAPYTTRSYDLLKQAADLVAGDSDELFRAIERHNPHAGELRERFFRAARALDERLE
CG80	Mmaz	    fig|192952.1.peg.1275_Methanosarcina mazei Goe1	VLILGGTGEMGQWFTRFFKERGYEVTVWGKGGKIEVAKKLDVPFALDLEAVIPESDIVIVSVPINATEETIAEIAPKMKAGSILMDFTSIKVGPVEAMRKFAPKDVEILGTHPMFGPTIPTIRGQTVILVPVKGYSEKWFPVIRQLFEESGAHVEITTAEEHDRLVSVVQGLTHFAYIAIGTTIDRLDFDVKKSRKFVSPVYSIMLDFVGRILGQNPYLYALIQMENPGVPEVHEAFIKECEELSSLVKAHDEEGFVRKMKAAARKYDD
CG17	Mmic_1	    fig|1806.1.peg.3235_Mycobacterium microti OV254	PVCVLGLGLIGGSIMRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPGMLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFNRAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVTAAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQSHGSIADLADAGHAARTRYDSFP
CG17	Msme	    fig|246196.1.peg.6289_Mycobacterium smegmatis st. MC2155 	PVCVLGLGLIGGSVMRAAAAAGREVFGYNRSVEAVQAATFDGFDATANLDKALARAAADDALIVLAVPMPALGLMLGHIRAAAANCALTDVISVKGAVLREVEMYGLLERFVGGHPMAGTAHSGWAAGSVDLFVGAPWVVSVDDHVDAGVWTQVAQLALDCHAVVVPARSDEHDAAAAAISHLPHLFAETMAEIAGEVPLAYALAAGSFRDGTRVAGSAPDLVRAMCEANAAQLLPALDRGIELLTRARAALADTGSVAELVESGHAARMRYDSFA
CG1	Msuc	    fig|221988.1.peg.1037_Mannheimia succiniciproducens MBEL55ECG1	IVIVGGKGKLGGLFGRFLTASGYFVEALGSKDWDNAKAILAGANAVIVCVPIVKTLETIERLKPYLTEDMLLTDLTSVKRRPLEKMLEIHQGAVVGLHPMFGPDIASMAKQVVVRCDGRYPERYQWLLEQIQMWGARIYQADAAEHDHSMTYIQALRHFATFANGLHLSRQPVKLANLLALSSPIYRLELAMIGRLFAQDGSLYADIIMDKPENLEVIESLKQSYEDSLKFFENGDREGFIKTFNKVREWFGDYSEQF
CG80	Mthe_7	    fig|187420.1.peg.1607_Methanothermobacter thermautotrophicus str. Delta H	ISIIGGTRELGYWIARFLRKEGFRVIITGRDPDTGRSAAGRIGAKYCRDNVRAASLADVVVVSVPIEVTSDVLREVAPHVREGGLLMDVTSVKEEPARVMERFIARGAHYIPAHPMFGPRVSSLEGQVVVLTPSGDNPWLDDVIRFLEERKARVIVTDPSTHDRMMSVVQVLTHFAYISIAATLEAEGVDIRESRKFASPIYNLMIDTIARIVAQNPYLAYSIQTHNTYGQEMRDCFLRTATRLNEMLRDGRMDDFVAGMGLAAKNIDD
CG21	Mthe_3	    fig|264732.1.peg.2464_Moorella thermoacetica ATCC 39073 	RVAILGLGLIGGSLGLALRKRGVKEVAGYDRHPETIETALTLGAINRPAADPATAVQGAQVVILAVPVGALGSLAGSIVPFLDPEAIVTDTGSVKGAVVRDLEAIFRDRARYVGGHPMAGSERAGIAAADGYLLENAVYVLTPTPATDTRALKSLEGLFQSLGSRVITLDPDEHDLIVAGVSHLPHFLAVSLVQAAGELAREHPLALMLAAGGFRDTTRIAGGDPVMWRDIFLYNREAILALLKSWRCQIDALEEMIRAGDATGLETVLNEARALRARV
CG95	Mtru1	    gi#92884247_Medicago truncatula	KIAIIGFGNFGQFLATTFVRQGHTVLAHSRSDYSAVAQNIGVKFFPNADDLCEEHPEVILLCTSIISAQQVLLSLPFQRLKRSTLFVDVLSVKEFPKNFFLEILPNYFDIICSHPMFGPESGSSGWKGLPFVYEKVRIGNNETRVSRCEKFLDVFGREGCRMVEMSCADHDRYAAGSQFITHTVGRVLGMLTLESTPINTKGYESLLNLVENTSGDSFDLYYGLFMFNKNSLEMLERLDLAFEDLRKQLIAHLHDVVRNQLFEDAVKVQNLGD
CG95	Mtru2	    gi#92884247_Medicago truncatula	KIAIIGFGNFGQFLAKTIVRHGHKVLAYSRTDYSDVARELGVSYFNDADDLCEQHPEVILLCTSILSTEKVLKSLPVQRLRRSTLFVDVLSVKEFPRNLFLQHLPPYFDVLCTHPMFGPESGKNGWKGLPFLFDKVRVGRDESRISRCDLFLDIFSKEGCRMVEMSCAEHDWHAAGSQFITHTTGRFLEKLKLEATPIDTKGYETLLSLVENTGGDSFDLYYGLFLYNINAMEQLQRFDLAFESLKKQLFDRLHGIYRRKQVFQNEEKVRDFPE
CG17	Mtub	    fig|83331.1.peg.4002_Mycobacterium tuberculosis CDC1551	PVCVLGLGLIGGSIMRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPGMLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFNRAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVTAAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQSHGSIADLADAGHAARTRYDSFP
CG30	Mxan	    gi#108759735_Myxococcus xanthus DK 1622	SIALLGYGRFGRALSGLLLVAGIPHRVFEPRQDDVPDALRAPTLAESVEGAGLVVLSMPVSGMRSVLEELRPRLSPAQTVLDVGSVKVRPVQVLASVLGRDIPWVGTHPLFGPASLARGDLPRRTVVCPNELHPEAVRKARVLFERIGCEVTELSPDAHDALMVRTHVLTFFLAHGLLKAEAGKDLPFAPPSFQPVARLEEYARLEVPHLFGVVQSENPYARDARVRLLEALTQLHLGCDSGRSGAPEPVAAPPGLTEVREC
CG17	MYCO_1	    fig|164756.6.peg.4730_Mycobacterium sp. KMS	PVCVLGLGLIGGSVMRAAAAAGREVFGYNRSVEGVQGARFDGFDASEHLDEVLGRAAETSALVVLAVPVPALGLMLGHIRDAAPQCPLTDVTSVKGAVLEHVRSFGLQERFVGGHPMAGTAHSGWAAGDAALFVGAPWVISVDDHVDPDVWAHVMTLALDCHAVVVPARSDEHDAAAAGISHLPHLLAEALAVTAGEVPLAFALAAGSFRDGTRVAGTAPDLVRAMCEANSSQLVPALDRSIELLTAAREALARHGSVADLVESGHAARMRYDSFS
CG12	Naro	    fig|48935.1.peg.1935_Novosphingobium aromaticivorans DSM 12444 (Sphingomonas aromaticivorans)	QVTIVGLGLLGGSIGHAVQAYLPGTTVVGYDADPDVREAARGLGLAHRIADEAGEAAIGSDLVIFCVPVGAMGAAAAAIAPGLSVEALVSDVGSSKATVAAALAQALPGHHVIPAHPVAGTERSGPEAGFAALFRNRWCIITPPADADPVLLARLVAFWEALGARVETMDADHHDKVLAVTSHLPHLIAYTIVGTASDLEQVTQSEVIKYSAGGFRDFTRIAASDPTMWRDVFLTNREAVLEMLQRFTEDLTELQKAIRKGDGAFLFDHFTRTRAIRRGII
CG86	Nequ	    fig|228908.1.peg.192_Nanoarchaeum equitans Kin4-M	MILIIGFGRLGQYFYNYLKRKGLNVKVYSRSIKEIEENEFSKFKYAILAIPENSYNEILSKLKENNFNGVIIDLASKKDVVIPIIEQYGFKFLSLHPLFGPSIYEEFSKIVVIKESTDKSFLQFLDFDLIEMSLEEHEKINELQVVTHLLLISYYHFARRFPIKTASAEALYRLSERLLEQNPQILLDIQKEKNAKTYRENYIKFLKEVSNNIEDYIPKERVEGFSRALLLNLSKLWNKDIRKQIMVIDKLILDL
CG11	Neur	    fig|228410.1.peg.323_Nitrosomonas europaea ATCC 19718	KLVVVGVGLIGGSFALALRRAGLVDRVVGMGRSPENMQRALELGIIDEQTSDFAAALSGADFVLLAIPVKQTAGVMQQMAPHLKAHTIISDVGSTKQNVVHAARANLGKRIERFIPAHPIAGTEFNGAEAAFPDLFQDKPVILTPLQENDQQIVDRVADLWQHCGASVSSMLPEQHDQLLAAISHLPHMLAFSLMQHIRTLSHTLSEGDPLALLRFAGSSLNDMTRITASSPEMWRDICLENRAALLAQIEAYQQELSGLQQMLADHDGESLEKLFAEARAIRQAWSAF
CG11	Neut	    fig|335283.3.peg.1872_Nitrosomonas eutropha C71	KLVIIGVGLIGGSFAQALRRAGLVKHITGIGRSPENMQCALELGIIDEQIGDFAAALSGADFVLLAVPVKQAARILQQIAPYLEARTIVSDVGSTKQSVVDAARAYLGKHISYFIPAHPIAGTELSGAVAASPDLFQNKPVILTPLQENDQQAIDYVTALWRYCGARVSSMQPEQHDQILAAISHLPHMLAFSLMQHIQTQSLTLSEGSPLELLRLAGSSLNGMTRIAASSPEMWRDICLDNRIALLAQIEAYQLELSKLQQILTDHDSEALEKLFSEARVTRRNWSAL
CG17	Nfar	    fig|247156.1.peg.306_Nocardia farcinica IFM 10152	PVCVLGTGLIGGSLLRAARAAGYPAFGYNRSSAGVLAARGDGFDVADDLPAVLRRAAREDALIVVAVPMPAVDHLLADIATFAPECVLTDVVSVKGPVAEAVARHGLSARYVGGHPMAGTAESGWAATDPELFRGAVWAVGVDEGTRAEPWRRVVRLALACGSTVVPVTAAEHDRAVARISHLPHVLAEALAVAGAAGGPLALGLAAGSFRDGTRVAGTAPDLVRAICEPNAAALLDVLEETLTVLGAARDSLRADGTLGELVDAGHDGHTDYRTVR
CG9	Ngon	    fig|242231.4.peg.1532_Neisseria gonorrhoeae FA1090 	HIALIGVGLIGGSFVLDLKRQGLVRTVTGIDTDRDNLERALERGVIDRASVVIDADSIGGADLVLIATPVATVPAVLTALRPVLPEHTWISDVGSTKSSVIEAFRRCLPGRLHRCIAAHPIAGSDRNGAQAAQFGLFRHRKLIITPHGGEDSDGIALVENLWRAVGADIFTMDAQHHDAVFAAVSHMPHLTAFAYVHQILDHPDGQEYLKFAATGFRDFTRIASGHPAVWADICLANKDSLLQLVQGLGKQLDVLADILTADDREALYRYFEEAKTTRDRWLDG
CG12	Nham	    fig|323097.3.peg.298_Nitrobacter hamburgensis X14 	RVALIGFGLIGGSIARAARAQGLAGEIVATAHSAKTRARVAELGIADRVVETNAEAADGADLVILSIPVGVCGAVAQEIASHLKPGAIISDVGSVKGAVVRDMAPHLPAGVHFVPAHPVAGTEHSGPDSGFAELFINRWCILTPPEGTDPAAVDRLRAFWTAIGARVETMTPEHHDLVLAITSHLPHLIAYTIVGTAEELGDVTSSEVMKFSAGGFRDFTRIAASDPTMWRDVFLTNKDAVLEMLGTFNEDLSKLTRAMRRGDGEALFEHFTRTRAIRRGIV
CG12	NITR	    fig|314253.3.peg.167_Nitrobacter sp. Nb-311A 	RLALIGFGLIGGSIARAVRMRGLAGEIVVTARSAKTRARVTELGIADRVVDTNAEAADGADLVILCIPVGGCGAVAQEIASHLRPDAIVSDVGSVKDAVVRDMAPHLPAGVHFVPAHPVAGTEHSGPDSGFAELFINRWCILTPPDGTDAAAVDRLRAFWTAIGARVEIMTPKHHDLVLAITSHLPHLIAYTIVGTADELGEVTSSEVMKFSAGGFRDFTRIAASDPTMWRDVFLTNKDAVLEMLGTFNEDLSKLTRAMRRGDGEALFEHFTRTRAIRRGIV
CG9	Nlac	    fig|486.1.peg.642_Neisseria lactamica ST-640	HIALIGVGLIGGSFVLDLKRQGLVRTVTGIDTDRDNLERALERGVIDRASAVIDADSIGGADLVLIATPVATVPAILTALRPVLPEHTWISDVGSTKISVIEAFRRCLPDSIHRCIAAHPIAGSDKSGADAAQYGLFQNRKLIITPHGGEDSDGIALIENLWRAVGAEIYTMDAQKHDAVFAAVSHMPHLAAFAYVHQLFEHPDGKAYLKFAATGFEDFTRIASGHPAVWADICLANRDNLLELVRGLGRQLNTLETILLNRDRPSLYRYFEEAKATRDGRSDE
CG9	Nmen	    fig|122586.1.peg.422_Neisseria meningitidis MC58	HIALIGVGLIGGSFVLDLKRQGLVRTVTGIDTDRDNLERALERGVIDQASVAIDADSIGGADLVLIATPVATVPAILTALRPVLPEHTWISDVGSTKSSVIEAFRRCLPDRLHHCIAAHPIAGSDRSGAQAAQFGLFRHRKLIITPHGGEHSDGIALVENLWHAVGAEIYTMDAQRHDAVFAAVSHMPHLTAFAYVHQILDHPDGQEYLKFAATGFRDFTRIASGHPAVWADICLANKDSLLQLVQGLGKQLDVLANILTTDDREALYRYFEEAKTTRDRWLDG
CG5	Nmob	    fig|314278.3.peg.2952_Nitrococcus mobilis Nb-231	RLCVIGVGLIGGSLALALRRAGIVGEIVGCGRNQSNLRRAVELGVVDCYQTNPASAVTGADMIVLGVPLGNVRPVLTTIRDALDSATIITDVGSAKRCVIEDIEAVFGDIPARFVPGHPVAGTEKSGVEAAFADLFQKRRTILTPLAQTDPQAVSAVAALWEAVGAEVISMSADHHDRMLAATSHLPHLLAFGLVDTLARWGGDEDIFQYAAGGFRDFTRIASSDPVMWRDICIANRAALLEALEHYREDLGVLTELVRCLDGQALERVFRNAKAVRDRYLPL
CG11	Nmul_1	    gi#82411378_Nitrosospira multiformis ATCC 25196	KLVVIGVGLIGGSFALALREAGRVQHITGIGRSRENMRRALALGEIDEIADNIESALKDAELVFLAVPVGQTGEIMAQISAYLAPSTIVTDAGSTKQEVVAAARSHLAPHLKNFVPGHPVAGAERSGAGAANADLFRGKNVVLTPLEETSREATQKVTELWEACGARISRMSANRHDEILAAVSHLPHVLAFALMNHVVSAGADGSNDAHDNDLLRFAGSGFRDSTRIAGSSPEMWRDICLGNRKALLNQIDAYQKELTVMREMLSDGDGDALERLFARARNAREHWLLKS
CGO	Noce_1	    fig|323261.3.peg.7_Nitrosococcus oceani ATCC 19707 	RLCILGVGLIGGSLALALKQAKGVGEVVGYERDPIARDKALSLGIIDRAELDLAEALRGADVVVLAVPLGAMEELLQAMAPSLKPGMVVTDVGSVKGSVVASARAKLGEYIVDFVPGHPIAGTERNGPEAAFADLFCLHKVLLTPLPESRAVAVRMVRMMWHQVGAEVIETSISHHDRMLAGTSHLPHILAYTLIDMLAKLGETQEALQFAAGGFRDFSRIASSDPSVWRDICLANKEPLLALLERFRTELHGIGEAIHRGDGAKLAEIFARAKAVRDTHY
CG17	NONO	    gi#32487233_Nonomuraea sp. ATCC 39727	RTLIVGTGLIGTSAALALREKGVAVYLSDVDAHAVRLARALGAGQEWTGQRVDLALIAVPPPSVGQRLADLQQRRAARAYTDVTSVKVDPIADAERLGCDLTSYVPGHPLAGRERSGPAAARADLFLGRPWALCPRPETGADAVRLARELVSMCGAEPYTVSAGEHDTAVALVSHAPHVAASAVAARLRDGDDVALALAGQGLRDVTRIAAGDPLLWRMILAANALPVAGVLERIAADLAAAASALRSGDLDDVTDLLRRGVDGHGRI
CG16	1NOST_1	    fig|103690.1.peg.1451_Nostoc sp. (Anabaena Sp.) PCC7120	QIGILGLGLIGGSLGYDLRSQGHHVLGVSRKRSTCETAVSLGSVDEASVDISLLTAAEVVFICTPIGLIVPQVEQLINHLPQATVVTDVGSVKAPIVEAISPQWENFVGGHPMAGTTDSGIESAQRNLFANRPYVLTPEPTTPKGAIALVEEIVRSLGAKIYYCQPEQHDRAVSWISHLPVMVSSSLIAACISETDSEVLQLAKNLASSGFRDTSRVGGGNPELGVMMAQYNRQALQGALEQYRRNLDELIALVKQENWSALKTKLQTTQQARPNF
CG1	2NOST_1	    fig|103690.1.peg.729_Nostoc sp. (Anabaena Sp.) PCC7120	ITIIGGRGRMGKLFAEKLVAVGHKVSALGQQDWDDAEELLSQADLVIVSVPIEYTLDVIKRTAKYLSVNTALCDITSIKTQPTQAMLTHHNGAVMGLHPMFGPSVTSFSGQKVVVCPGRNDEAFQWLLDFIETQGGELITCTPEEHDEMMVFIQATQHFCRFSLGVFLAQANVDLERSLLMSSPSYRQEIEIIKRLFRQSPSLCVDIMLATEERCQTINDLADTYGRLAKLVVQKDREGLIREFEENKVIFSYPIAEVKG
CG81	Npha_1	    fig|348780.3.peg.1741_Natronomonas pharaonis DSM 2160 	QLLVVGAGEMGQWFARHSGADAVAFADRDSDTARRAAAGLNDAQAVPLDTDERFDVVCIAVPMSAVADAVAAHAGKATAAVVDVAGEMRDSVAALRKHAPDRERASFHPLFSASNAPGNLPVVVDAEGPTVAALRAALSAAGNEVFETTPEEHDRAMETVQAQAHTAVLAYALAADDVDSRFHTALSEPLEALVDDVVGNTPEVYAEIQSRFDGSDAVAEAAQRLADADASEFADLYEEAGR
CG16	1Npun_1	    fig|63737.1.peg.6205_Nostoc punctiforme PCC73102	NIGILGLGLIGGSLGFDLRSQGHHILGVSRRESTCQKAVAIGSVDEASVDLSLLAAAEVVFICTPLALIVPQLEQMIAHLSTATIVTDVGSAKAQIVKAISPLWDNFIGGHPMAGRTDSGIEAAQRNLFVDKPYVLTPIATTPTSAIAVVEEIVRSLGANIYYCQPEQHDRAVSWISHLPVMVSSSLIAACLSETDPDVLELAQKLASSGFRDTSRVGGGNPELGVMMARYNRQALLRSLQQYRHNLDELTNLIEQENWTVLEQKLKSTGKAR
CG1	2Npun_1	    fig|63737.1.peg.2248_Nostoc punctiforme PCC73102	VTIIGGRGRMGRLFQEQLSLVGHNVSILEHEDWEYAEQLLSQAELVLVSVPIEHTVDVIKRAAKYLASNTALCDITSIKTQPTQAMLEHHCGPVMGLHPMFGPNIKSFLGQKVVVCPGRNDDSFQWLLDFLKSKGGELIVCTPEEHDRMMVIIQATQHFCRFSLGVFLAQARVEIEQSLTMSTPNYRQEIDIVKRLFAQNPNLCVDIMLATEERCNAISFLANTYSRLARLVARKDREALIKEFENTQSFFEGKINSFLQ
CG12	Nwin	    fig|323098.3.peg.226_Nitrobacter winogradskyi Nb-255	RLALIGFGLIGGSIARAARMRGVVGEIVATARSAKTRARVMELGIVDRVVDTNAEATDGADLVILCVPVGACGSVAQQIAPHLKRGAIVSDVGSVKGAVVRDIAPHLPAEVHFVPAHPVAGTEHSGPDSGFAELFINRWCILTPPDGTDAAAVDRLRAFWTAIGARVEIMTPKHHDLVLAITSHLPHLIAYTIVGTADELGEVTSSEVMKFSAGGFRDFTRIAASDPTMWRDVFLTNKDAVLEMLGTFNEDLSKLTRAMRRGDGEALFEHFTRTRAIRRGIV
CG12	Obat	    fig|252305.3.peg.283_Oceanicola batsensis HTCC2597 	RVALIGLGLIASSMFWAIRKAGLAGEVTGYARSEQTRETARRIGLCDRVCDSAAEAVDGADLVVLCVPVGAMDSVAREIAPVLKPGSTVSDVGSVKRAVIEAVGPHIPEGVHFIPAHPLAGTEHSGPESGFAELFRNRWLLIVPEGGADEAALARLRALWEGMGSHVDVMEPDHHDLVLAVTSHTPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLTNKDATLEILGRFTEELFALQRAIRTGDGDLLHDYFTRTRGIRRGII
CG6	OCEA	    gi#89094102_Oceanospirillum sp. MED92	KTLIIGLGLIGGSLAKALRSNRRFGQIIGYDRDPDETSVGIELGVIDIAAESLADAVSEADLVVLAVPVKAMETVLVDIAPFIAEDTLITDVGSTKANVVAAAKRVFKTIPTGFVPGHPIAGSEKSGVAAADEGLFDKHKVILTPLAESSSEAVNVFADLWESTGAEVLVMDVEKHDEVLAATSHLPHMLAFSLVDTLAQEQDHNTDIFRYAAGGFRDFTRIAGSDPTMWHDICLANKDALLSQLDRYITGLGRLRTAIECSDSETMLGTFTRARAAREHFS
CG12	Ogra_1	    gi#89070716_Oceanicola granulosus HTCC2516	RVALIGLGLIASSMAWAMRRGGLAGEITGYARSAETRDIAREIGLCDRVCDSAAEAVAGADLVVLCVPVGAMGAVAEEIAPALAPGATVSDVGSVKKAVIEAVAPHIPEGVHFVPAHPLAGTEYSGPRAGFAELFDNRWCLVVPAEGSDEAAVSRLEGFWEGLGANVERMDADHHDLVLAVTSHTPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFMTNKEATLEILGRFTEELFALQRAIRLGDGAHLHEYFTRTRAIRRGII
CG18	Oihe	    fig|221109.1.peg.1782_Oceanobacillus iheyensis HTE831	TILIAGLGLIGGSIARAIRNFSDHKLIGFDVNEESLRYAKDTGIISYYDTNLQHIAKRADIIILAAPITETIKMIEELDEVDFPKQVIVTDTASVKGAILTAAQKINNSNITFIGGHPMAGSHKRGIEASKAHLFENAIYVLSPLEGVSSEQIDVVKSVLATTKCKFLVLKPEEHDEMTGVISHFPHLIASSLVHQAKKWEGTHAYLPNLAAGGFRDITRIASSNPQMWQDIFHHNQSKMSYFLEEWIQEMSHLKLLIETNEKNEILDYLDSAKKYRDGL
CG95	1Osat	    gi#53792620_Oryza sativa ssp. japonica 	KIAVVGFGNYGQFLTRTLVRQGHTVLAHSRSDYSAVAAELGATYFTDAHDLVECHPDVVLLVTSILSAEAVLRSLPVHRLRRDTLFADVLSVKEFPRNLLLGTLPEEFDIICTHPMFGPESAGDGWGGLPFVFDKVRVGDCPARRARAEAFLDIFAREGCRMVEMSCAEHDAHAAETQFLTHTVGRTLAMLELQTTPINTKGYETLLRLVDNTCSDSFDLYNGLFMYNNNSTELLNRLEWAMDSVKKRLFDGLHDVLRRQLFEGSPPLDSVSA
CG95	2Osat	    gi#53792618_Oryza sativa ssp. japonica	KIAIVGFGNFGQFLARTFARQGHTLLAHSRSDYSSLAASVGASYFQDPHDLCECHPDVVLLATSILSAEAVLRSLPVHRLRRNTLFVDVLSVKEFPRNLLLGSLPPDFDVICTHPMFGPESARDGWDGLPFVFDKVRVGDCPARRARAEAFLNIFEREGCRMVEMTCAEHDAHAAETQFLTHTVGRMLAMLELRSTPINTKGYETLLRLVDNTCSDSFDLYNGLFMYNKNSTELLNRLEWAMDSVKKKLFDGLHDVLRKQLFEGSPHAPNNTPVRK
CG17	Pacn	    fig|267747.1.peg.1192_Propionibacterium acnes KPA171202	PVLIVGVGLIGASIGKALMREGTDVHLWDIDRDNSLIAAGHGAGRLGNLADDAYRMIVIATPPAVVAQTVVERLTRHPQAVVTDTASVKGAVLAELTTLATEHEIDISRYVGSHPMAGTQCTGPLTASTELFVDRTWVVAPRTDNRYDDVQQVVALARACGARVVSMDAHEHDRAVAEVSHLPHLMSILTAANLRRARPEHLSLAGPGIRDVTRIARSQTTMWRQILSSNCVEVRSQLEAIRDDLDDLLSRLNDSERLEEFLSVGQAGARKVAGKH
CG85	Paer_2	    fig|178306.1.peg.1339_Pyrobaculum aerophilum st. IM2	RVGIVGGGAMGSWLKREMTSLHEVRIFDVDKSRSDVGSLEELALWAEALIVAVPFWETSGVLKALAPLSRGRLVMDIATFKEGVVETYGLFPQDALVATVHPLFGPGASSIRGQRVLIMAVPGRRGAEEAFRFWSELGARAEWGELEKHDFYVSRTIALSYAVGLALARLYGELGDEVFKYGGTSFKYLATYAFSLLRDPNAAKYAEKAPIDEFIGFLKREDAPKALIDPDAAYRAFYKALEAM
CG2	Paer_1	    fig|208964.1.peg.3164_Pseudomonas aeruginosa PAO1	RLVVVGLGLIGGSFAKGLRSKGLFREVVGVDRDAESCRLAVELGVVDRCEEDLGRACVGADVVQLAVPILAMERVLADLAKLDLGKAVLTDVGSAKGNIVRAARVAFGGMPRYLVPGHPIAGSEQSGVTAAKATLFRRHKVILTPSAETDADALALVDSLWRALGADVEHMEVEHHDEVLAATSHLPHLLAFTLVDSLAKRSENLEIFRYAAGGFRDFTRIAGSDPVMWHDIFLANREAVLRTLDVFRDDLDALREAVDTGDGHQLLGVFTRARVAREHF
CG24	Paes	    gi#68552198_Prosthecochloris aestuarii DSM 271	RISIIGLGLIGASLLQALKRSPLAGEQQIVFKGFDPGFSSQDILRIKELGLDSFETDKTSLYDTDLIILAAPVHTNISLLEEIGRLAPQSVLVSDVSSTKEAIAQRASSLGIDFVGMHPIAGREQQGYQASHETLLEDKTLVLCATAEMMERQRVKNLIELLISARCKVLAMTPHEHDRTVASISHLPQLLSTALINHCRDDIEKAGPGFATLTRLAGSPWHIWQDIIETNSANIAAELRAFCDEIALLADDVQHNRTEKLKLRFDSANDLYTVLNRRKTQ
CG1	Pagg	    gi#267186_Pantoea agglomerans	VVIVGGKGQMGRLFEKMLGLSGYTVKTLDKEDWPQAETLLSDAGMVIISVPIHLTEQVIAQLPPLPEDCILVDLASVKNRPLQAMLAAHNGPVLGLHPMFGPDSGSLAKQVVVWCDGRQPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVNLDQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSESNLALIKRYYQRFGEAIALLEQGDKQAFIASFNRVEQWFGDHAKRF
CG1	Pasy	    fig|171440.1.peg.2864_Photorhabdus asymbiotica subsp. asymbiotica	IVIVGGLGKMGKLFGRLLTLSGYEVRNLEPQDWPDAEQILAGVGMVIISVPIHLTEEVIRRLPPLPDHCILVDLASVKQQPLQAMLDVHKGPVLGLHPMFGPDVGSFAKQVVVYCDGRQREAYQWFLEQLLVWGACLYQINPEQHDKSMSFIQALRHFTTFVYGKHLAQEGADLQQLLSISSPIYRLELIMVGRLFAQDPQLYADIIMSSPENIDLIRRYHQSFGQALEILESRDKRAFVSSFEDVSAWFGDYAPHFMR
CG12	Pber_1	    fig|314260.3.peg.961_Parvularcula bermudensis HTCC2503	RLCLIGLGLIGSSLGHATRRAGAAREIIGVDRHQPNGQKALEIGFIDTLAPDLETAVTGADLVILATPVGAFDAIGKAIGPHLSPGAIVSDVGSVKGVALDVLTPHLPAHIHLLPAHPVAGTENSGPEAGFASLFDGRWSILTPPEGSDPDALSRLTAFWEQLGATVEIMTAAHHDLVLAITSHIPHLIAYNIVGTAADLETVTKSEVIKFSAGGFRDFTRIAASDPDMWRDIFLSNKDAVLEMLGRFSEDLSVLQRAIRDGDGATLHDLFSRTRAIRREII
CG14	Pcar_1	    fig|338963.3.peg.816_Pelobacter carbinolicus DSM 2380	KLAVVGVGLIGGSFALALKEAGLVGEVVGIGRGRANLETALKKGVVDAFTHSLAEGVAGADVVFLATPVQTLAKVAAEVIPHMKPGSVLTDGGSVKAEVICAIEPLLREDIQFVPGHPVAGTEQSGAAAAFASLYRGRRCILTPTSRTDGQALELIKSLWQAAGSEVVVMTPEKHDRVLAGISHLPHMVAYALVDAVANCGGENENILNYSAGGFRDFTRIASSDPTMWRDIALSNRVALLEVLETFEHSLAEVKRDICQGNGEALYDFFLRSKQRRDAIV
CG3	Pcry	    fig|335284.3.peg.415_Psychrobacter cryohalolentis K5	QVCVIGLGLIGASLAQAIKDNGLAERIVAVDRHEPSLEEAIQHGLLDAGSSVLNDVISDSDLIVIAVPVQAAQAVFIDIKNAMDSGLLAIDCIITDVCSTKVNIIDAAKTVFETLPVGLVPAHPIAGAENSGYHARRATLFVNHSVIVCELPTTSHVAIAKLSQLWEAVGASVMPMDAAHHDSILAHTSHLPHLLAFNLVEQLASHDDNLDIFRYAAGGFRDFTRIAASDPKMWHDIFFANQNAIVSALDEYSGYLNDIRQLIIDKDSTALMGLLGRAQAARRHF
CG13	Pfil	    No fig or gi#_Polaribacter filamentus (IG-36)	NVFVIGVGLIGGSMVLDIQKEYTEAVIYGIDLNDNNLTEAVELGVIHKKATFADLEIATIVIVSIPVDAQLEVIPKVLDHINDHCLVIDVGSTKQQICKVLENHPKRRNFLAGHPIAGTEFSGPSAAITGLFKNKTNIICEVEKTAFKLQEKALEIFAKLGMRIRYMDPISHDKHIAYVSHLSHISAFMLGKTVINKEKNERDIFDMAGSGFASTVRLAKSSPAMWTPIFKQNKENILETLEEYISNLKHFKELMEQDNFSEIFNEMENTNYIKQILNG
CG2	Pflu	    fig|205922.3.peg.3160_Pseudomonas fluorescens PfO-1	RLVVVGLGLIGGSFAKGLRESGVCREVVGVDLDPQSRKLAVELGVVDRCEDDLVAACRGADVIQLAVPILAMEKVLARLAGMDLGQAILTDVGSAKGNVVRAATEAFGGMPARFVPGHPIAGSEQSGVEASNSELFRRHKVILTPLEQTDPAALAVVDRLWRELGADVEHMQVERHDEVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDPVMWHDIFLANREAVLRTLDTFRSDLDALRDAVDAGDGHQLLGVFTRARVAREHF
CG85	Pfur	    fig|186497.1.peg.1751_Pyrococcus furiosus DSM	RITISGYGKMGKLFGRVLSEELNSEVKFYSSHTILDFSTLSEAYEWSDVMILASTIDNIKAQIRELREISLSNPKDIMIFDIATFKKDVLTEYQGFPREVKVASVHPMFGPGAKSFRGHfivvpvKGREKDAEDVGKFIEGLGGKVEFMSVEEHDRIVGFVIGVPYLLGIAYLKLSLENNLERFGGTSFRFLTIYGKAVLNDGPRFIEEVIRRSREEIAEFLKSIDSVNVHELSKKVSREEIERAYEKFYKILDP
CG13	Pirg	    fig|313594.3.peg.497_Polaribacter irgensii 23-P	KIYMIGIGLIGGSFAIDIKKHFPEVVIYGIDTNENHLNNAKELGVIDEKATLADLENADLVIVSIPVDVTVTLLPIILDKISENSLVIDAGSTKEAICKAVEHHPKRRNFLACHPIAGTEKSGPTAAISGLYVGKTNIICEVEKTTFKLQEKALNLFSTIGMRIRYMDPVSHDKHIAYVSHLSHISAFMLGKTVINKAKNERDIFDMAGSGFESTVRLAKSSPAMWTPIFKQNKENVIETLDAYINNLKRFKELMERDNFSEIFNEMENTNYIKQILNG
CG1	Plum	    fig|243265.1.peg.1198_Photorhabdus luminescens subsp. laumondii TTO1	IVIVGGLGKMGKLFGRLLTLSGYEVRNLEPQDWPNAEQILAGVGMVIISVPIHLTEEVIRRLPPLPDHCILVDLASVKQQPLQAMLDVHKGPVLGLHPMFGPDVGSLVKQVVVYCDGRQEEAYQWFLEQLLIWGACLHQMSPEQHDKNMSFIQALRHFTTFAYGQHLAQEGADLQQLLSISSPIYRLELIMVGRLFAQDPQLYADIIMSSPENIDLIRRYHQSFGQALEILESQDKRAFVSSFEDVSEWFGDYAPRF
CG24	Plut	    fig|319225.3.peg.2029_Pelodictyon luteolum DSM 273  	SISFIGLGLIGMSLLRALRRSSIALETGIVFTGFDPSFSETDKEDARILGLDRFVEDREELFSADIVVLAAPVQANIAMLDEAARLAPPSTIITDVSSTKANIFHRAEELNLPFIGMHPMAGKELQGFRESAEDLFKDMPIFLCHKDDLLTSMRAEAFKDMLSSVAGDTVMIDPDRHDWIMARISHLPQLISTVLIDYCSPELRRTGAGFASLTRLAGSPWEIWRDIIGTNSKNIADALEVFATKLVELSWEVRDLENESLESRFNQANKAYKFMRL 
CG16	Pmar16	    fig|167539.1.peg.1716_Prochlorococcus marinus subsp. marinus str. CCMP1375 	RIGIVGLGLIGGSLGLDLQKLGYEVYGVVRRKQTLKKAQSRGLAQLISTEFKILKDCSMVIMALPLSQLIHPPEELIHALPENAVITDVGSVKVPVINSWQKLHPRFVGSHPMAGTIETGVDAGKFGLFNNRPWIATPNQATDLKALEIVHQLAIDLGSNWITTDPKMHDQAVALISHLPVFISAALIQTVGNEKNAKLLKLAQAIASSGFEDTTRIGGGNPYLGVAMAENNTSAILDAMTSYRSSIEALEAIIRSKDWSGLQQELEATQSTRPNF
CG16	Pmar_17	    fig|59919.1.peg.1561_Prochlorococcus marinus subsp. pastoris str. CCMP1986 	NIGIVGLGLIGGSIGLKLQRLKHTIYGVTNNNLNKKKAIERNLANVVSCDLGILKECSLIILALPIKDLIYPSNDLINAIPKDAIVTDVGSIKEPIINTWGGIHPLFIGSHPMAGTEEKGVESGFESLLENAKWIITPTSKTNSHSLKTLSKLITSMQCEIYKASPKEHDEAVSLISHLPIFVASSLIKTANAEKNESLLALTQRLAATGYADTTRVGGGNPNLGLDLAINNQTNILKAKEFKKNINEIESLIKNNEWELLSEKLTKAIEIRSNF 
CG16	Pmar_10	    fig|74547.1.peg.1718_Prochlorococcus marinus str. MIT 9313	CAGVVGLGLIGGSLGLDLQALGWKVNGLVHRSTTADRARARGLAHLVSTDPGILADCDLVILALPLAQLLNPDPNLLKALPAAAVVTDVGSVKMPVLELWRDLHPRFVASHPMAGTAEAGVDAGLRGLFQQRPWVATPDNQTDLEALELVRRFAVSLGSQWFTADAANHDQAVALISHLPVLVSAALLRTVGEERDPAVRELARVLSSSGFADTTRVGGGNPQLGTSMAESNTAAILRGLAAYRWSLEQLEEAVLNGHWSQLKAELERSQALRPSF
CG25	Pmio	    No fig or gi#_Petrotoga miotherma ATCC-51224 	TTIIIGTGLIGTSLALAFKETKEISTIIGYDIDNNSLKEALKLGAIDEPAKISDISKADLIIFATPVESTKSILHDTISLAKENTVVTDVGSTKYKITQLFDTFKNKRVNFIGGHPLAGSEKSGPLNAKADLFKGKKYILIKSANCDQVYFNKFERLITKIGAIPIIIDAETHDEILSITSHLPQIISYYLVKTLMNLKEDNENYLKLVGAGFKDTTRLSKSDPQMWIDIFKQNKENILHAIENFEKELTAFKKNLIEDKYNEIKDDLSKISKFEL
CG1	Pmir_1	    fig|584.1.peg.249_Proteus mirabilis HI4320	IVIVGGNGKMGRLFSRLFTLSGYQVESLEADEWQSKSPAIFADAGMVIISVPIHLTVDVIEQLPPLPENCLLVDLASIKQAPLEAMLKAHNGPVLGLHPMFGPDVPSLAKQVIAYCEGRDLSHFEWLLEQLMVWGARVEAITAQEHDKNMSFIQALRHFTTFAYGQHLVKENVDLASLLRLSSPIYRLELAMIGRLFAQDPQLYADIILSSQENINLIRRYHHSLGEAIALLDINTKDEFIGSFNNVSDWFGDYASQFMK
CG1	Pmul	    fig|272843.1.peg.664_Pasteurella multocida str. Pm70	IVIVGGGGKLGSLFARYFTLSGYYVEILEQQDWQSADKILNETDVIVVSVPIAKTVETIKRLKPYLTDNMLLVDLTSVKRAPLQAMLDVHAGAVLGLHPMFGPDIASMAKQVIVRCDGRFESRYQWLITQIQIWGAKFYQVEATEHDHSMTYVQALRHFSTFANGLHLSKQPVQLANLLALSSPIYCLELAMIGRLFAQDAELYADIILDKPENLAVIESLKQSYEESLAFFTHGDKQAFIDSFEQVKQWFGEYSEQF
CG10	POLA	    fig|296591.1.peg.2815_Polaromonas sp. JS666	QLGLIGCGLMGGSFALALKQAGLVKRIVGYSKSPSTTERARQMGVIDVEAPSALLAVSGADIVLLAVPVSATEATFKAIRHLVGPSTLIMDVGSTKRDVVDAARRVLRDNVGAFVPCHPITGKEVSGVEHADADLYSGKQVILTPIERTFTVQLQKATEVWTALGCHVLKMSPQAHDAAYAAVSHLPHLIAFALMNGISGQQEGKDYLSLAGPGFRDFTRIAASDPKMWRDILIANREELLAQSKIFQDTLQSLEQLISGGSGDVLEVLIEQASETRANWRMS
CG24	Ppha	    gi#68549324_Pelodictyon phaeoclathratiforme BU-1	SISFIGLGLLGMSLLQAIKRSPLALESDIFFQGFDPNFSDGDRESVESLGVDRFTDDKKTLYQADLIILSAPVEINIALLDEISQLAPPTTLVSDVSSTKSLIARRARELGLPFLGMHPMAGKEQQGYRESNAELLQGRRIILCDDNNLLAGDKAAFLVALLESAGCTTLLMTPEEHDRVIAKISHLPQLLSTLLMTWCGDSISKSGPGFATLARLAGSSWDIWRDIIATNSDNIADELERFSRELDLLSHEVRKHDLEQLESRFNEANRLYQ
CG1	Ppro_2	    fig|298386.1.peg.5258_Photobacterium profundum SS9	IVVVGGHGQLGGLFCRLFELSGYQVRQLGSQDWDRADEILADAGMVVVSVPINITEQIIGKLSNLPDDCILADLTSIKSGPLQAMLEVHNGPVIGLHPMFGPDISSLAKQVIVYCDGRNPENYQWLLEQFQIWGATLNRISAIEHDQGMTLIQALRHFTSFVYGVHLAEEDPKIEQLMSLSSPIYRLELAMVGRLFAQDAQLYADIIMSAPQNVAMIKRFHQRFGEAIKMLETQDKEAFKQAFNQVEHWFGDYAGHF
CG1	Ppro	    gi#71836770_Pelobacter propionicus DSM 2379	RLAIVGVGLIGGSFARALRQAGAVRHVVGIGRSRANLEHALSQGIVDEISFNATEGVAGAQLVFISIPVCSISAMVGAIAPSLAPGCIVTDGGSVKAEIVRECEKLIPEGCHFVGGHPIAGTENSGASASFATLYQGKRCILTPTERTDREAYETVARLWRVAGANVCSMDPERHDRILAEISHLPHAVAYALVHAVGTADAEGENVLSYSAGGFRDFTRIASSDPVMWRDIALMNRRALLASIDGFSASLAELRRRIDSGDSPGLAEFFTIAKQFRDGIL
CG2	Pput	    fig|160488.1.peg.1756_Pseudomonas putida KT2440	RLVVVGLGLIGGSFAKGLRESGLCREVVGVDLDAPSRKQAVALGVVDRCEEDLAAACVGADVIQLAVPILAMEKVLARLALLDLGDAIITDVGSAKGNVVREARAVFGARLPRFVPGHPIAGSEQSGVEASNATLFRRHKVILTPLAETDPAALVLVDRLWRALDADVEHMSVERHDEVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDPTMWHDIFLANRDAVLRTLDTFRSDLDALRDAIAEGDGHQLLGVFTRARVAREHF
CG23	Prum	    No fig or gi#_Prevotella ruminicola 23	KILVMGAGKMGSFFIDLLSFDHEVAVFERDAKRMRFTYNCQRFTTYDEIKAFEPELLINAVTLKYTIPVFKEVIPYLPKECIISDIASVKTDLKDFYEQTGMRFVSTHPMFGPTFANLQQLSEENAIIIQEGDCMGRCFFKELYRKLGLNIYEYTFEEHDKTVAYSLSIPFVSTFVFAAVMKHQDAPGTTFKRHMRIAKGVLNEDDYLLQEILFNPYTHDQVAQIRTELKELLEIIDQKDAAGMKGYLTKIRNNVKNDIEIKR
CG2	Pstu	    gi#29727034_Pseudomonas stutzeri	RLVVIGLGLIGGSFAKGLHESGLCREVVGFDPNADSRVLAVELGVVDRCVDTLEEACRDACMIQLAAPILAMETLLEQLSRLELGDAVLTDVGSARANLVRCATRAFGGMPARFVPGHPIAGSERSGITAPTASLFRRHKVILTPVHGTDSQALALVDRLWTALGADVEHMDXDHHDEVLAATSHLPHICCFGLVDSLAKRHENLEIFRYPAGGFRDFTRIAGSDPVMWHDIFLANRDAVLATLDDFRTDLDALRAAVDEGNGHKLLGVFTRARAAREHF
CG3	PSYC	    fig|259536.4.peg.787_Psychrobacter sp. 273-4	QVCVIGLGLIGASIAQAIKNNGLAERIVAVDRHEPSLKEAIQHGLLDAGSVVLSEIVSGSDLIIIAVPAQAVQAVFIDIKNAMDSGLLATDCIITDVCSTKVNIIDAAKAVFETLPVGLVPAHPIAGAENSGYHARRATLFVNHSVIICELPTTSHLAIAKLSQLWEAVGASVMPMEAAHHDAILAHTSHLPHLLAFNLVEQLASHDDNLDMFRYAAGGFRDFTRIAASDPKMWHDIFFANQSAIISALDEYSVYLSDIRQLIIDKNSTALMGLLGRAQAARRHF
CG2	Psyr_2	    fig|205918.4.peg.4081_Pseudomonas syringae pv. syringae B728a	RLVVVGLGLIGGSFAKGVRESGLCREVVGVDLDPQSRQLAVELGVVDRCEADLAVACRGADVIQLAVPILAMEKLLALLAPIDLGQAILTDVGSAKGNVVRAARQAFGHMPSRFVPGHPIAGSEQSGVEASNAALFRRHKVILTPLAETDPHAVAIVDQLWSALGADVEHMQVERHDEVLAATSHLPHLLAFGLVDSLAKRNENLDIFRYAAGGFRDFTRIAGSDPTMWHDIFMANRDAVLRTLDSFRTDLDALRDAVDAGDGAQLMDVFTRARAAREHF
CG2	Psyr_3	    fig|223283.1.peg.1711_Pseudomonas syringae pv. tomato str. DC3000	RLVVVGLGLIGGSFAKGVRESGLCREVVGVDLDPRSRKLAVELGVVDRCEADLALACRGADVIQLAVPILAMEKLLALLAPLDLGGAILTDVGSAKGNVVRAAHQAFGHMPSRFVPGHPIAGSEQSGVEASNAALFRRHKVILTPLPETDPDAVAVVHRLWSALGADVEHMQVERHDDVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDPTMWHDIFMANRESVLRTLDSFRSDLDALRDAVDAGDGAQLLEVFTRARTAREHF
CG82	Ptor_1	    fig|263820.1.peg.836_Picrophilus torridus DSM 9790	EIIIGANGRFGSLLCSLLDDRICIDIDNINELGVYIKKADHVFLSVPVDAALNIIDSYDYNNFVEISSVKWPFKKYSGKITSIHPLFGPMSYNRINDVIFINDISRDNSLNELNKIFKNWHFIEMTSDEHDLLMSEIMVKPYIISMMLDCKSDIKTGSYKKLLEVSEIKNKESWKVFNDTLIYNPYTMNVINDLIERLNKTRDLIEHNRL
CG82	Ptor	    gi#91216681_Psychroflexus torquis ATCC 700755	KIGCIGLGLIGGSFALSMKRNFSDVQVFGMDKNSEHLQKALTLNIIDQVLEESAWSEMDVVILSIPVDHASLLLQEILDKIHPQALVMDMGSTKGQLCEAVAKNPKRHQFLAAHPIAGTEFSGPEAAFDSLFDHKTMILCEAEHTEVSLLQIAKSLIAPLHMTLKYMGAKAHDKHLAYVSHLSHISSFMLGKTVLDIEKNDRDIFDLAGSGFASTVRLAKSNPVTWTAIFKENQEEVQYALEEYIQNLKAFQKQLETQNYKGIHQQLAEVNDLKPILNG
CGO	Pubi	    fig|335992.3.peg.1115_(Candidatus) Pelagibacter ubique HTCC1062	NILIIGCGLIGSSLLRAISEKKIAKKIFVYEKSKSNILKIKKLKLPCEITNDLKQIIPNLDLIIFCTPLGEYEKIILKINRYLLPKTIITDVGSSKEKSMDLIKRKLKKGIFWTSSHPIAGSEVSGPENGVKNLFLKKWCILIKEKNTNRKHLLILTKFWKKIGSKVAIMDSKKHDTIFSMTSHLPHLIAYNLVKTATDFEKQQRYELIKFSAGGLRDFSRIAASNEIMWRDIFFNNQKNISKVIDLFIKNLRSFKRDIQFKNNKSIIKKLVNTKKVRKKI
CG24	Pvib_1	    gi#71481353_Prosthecochloris vibrioformis DSM 265 (Chlorobium vibrioforme f. thiosulfatophilum)  	TVSFIGLGLIGMSLLRALKASVPAGKNSPVMSGYDPSFSESDREAVLCLGLDRFTDNRNELFSADLVVLAAPVETNIALLDELKELAPKSTLVADVSSTKTMICRRAKELSIPFIGMHPMAGKEQQGYRESSEELIRGSRVILCGEPDDLNSFRGTLLREMLEAAGCRISLMDAEEHDRVTACISHLPQLVSTALMTRCAGALESSGPGFLSMARLAASPWSIWRDIISTNSGNIADELERFSLELKELADEVRRNDRKKLEGRFNEANRQHTLLKEMNRK
CG19	Ralb	    No fig or gi#_Ruminococcus albus	KIAIVGLGLIGGSLAKAIKKNTEHSCFALDIDRAAIAGAVAQEAIDGEITVDELHSCDVVMVCLHPAQTINFIIENKSKFKKGSIVIDSCGVKAAIVNAVEKPLADEGVHFLGCHPMAGREFSGFAYSVDNLFEKASFIMTPSDELPVRIVREVSQLAYEIGFARVVTSTVEEHDRIIAFTSQLAHVVSSAYVKSPSLLKQSGFSAGSFKDMTRVAKLNENMWTELFMMNRQPLIDEIDCIIAHLTEYRDAISAEDADGLRELLKTGRELKELS
CG12	Rbac	    fig|314271.3.peg.844_Rhodobacterales bacterium HTCC2654 	RVALIGLGLIAGSMAHAMRRGGLVGEIVGTARSAETRDVAREIGLVDRVVDTAAEAVAGADLIVLAVPVGAMGAVAEEIAPHLAPGATVTDVGSVKGAVIEAVGPYIPEGVHFVPAHPLAGTEHSGPRSGFASLFDNRFTLIVPAEGSDRDAVARLDALWRGMGANTEEMDADHHDLVLAVTSHTPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLSNKEATLEILGRFTEELFALQRAIRTGDGELLFDYFTHTRAIRRGII
CG27	Rbal	    fig|243090.1.peg.3009_Rhodopirellula baltica SH 1 (Pirellula sp.)	SVAIIGLGLLGGSVALSIRRRWPSVRLTACARSPETRALALDRAIVDEVFDRPDAAANGCDLAVIATPVNRIAALAQELAEQFPELTLTDVGSTKGGLVRELAGTTAAQQFVPAHPIAGSEKSGAEHARADLFDDKPIVITPSGEELPQHITAATEFWRGTGGRIVTMPAEQHDATLALTSHLPHLLSSLAARQITREMLALVGTGWLDTTRVAAGDADLWTAIVSENRDAILSAIEQSRSDLDTLQTIVDQGNDIALRTWLDTAKQIRQSA
CG13	Rbif	    gi#88806861_Robiginitalea biformata HTCC2501	KAVIIGIGLIGGSLARDIRRSDPEATVLGMDISDAHLEAARELGLIGGKASDADLAAADLVVVSIPVDRIVEELPSILDRVGDETLVIDAGSTKAPICREVASHPKRRNFLACHPIAGTEFTGPAAAVEGLFDGKVNIICEVEETAFAIQERALDLFRELGMRIRYMNPEAHDRHIAYVSHLSHISSFMLGKTVIEKEKNERDIFDMAGSGFESTVRLAKSSPAMWTPIFEQNKKNVLETLDEYIANLKEFRALLDSDQYEALYEAMEQTNRIREILKG
CG12	Rcap	    No fig or gi#_Rhodobacter capsulatus	RVALIGLGLIASSMAHAMREKGLAGEIIGHAKSPETRATALEIGLCDRVFDTAAEAVEGADLVVLCVPVGAMAAIAAEIAPHLAPGATVTDVGSVKQAVVEAVAPHMPDHVQFIPGHPLAGTEHSGPRSGFATLFVNRWWLITPLAGNDPAAVARLKGFLTALGANVDEMEVARHDLVLAVVSHTPHLIAYTMVGVADHLRRVTQEEVIKYSASGFRDFTRIAASDPTMWRDVFLTNKEATLDILGRFTEELFMLQRAIRMGDGQMLFDYFTETRAIRRGII
CG12	Retl	    gi#86359392_Rhizobium etli CFN 42	RIALIGIGLIGSSLAHDIRRLGLTKEIVVATRSADTLKRAEELGLGDRYTTSSQEAVRDADLVIVSVPVGASESVAKEIAGSLKPGAIVTDVGSTKASVIAQMQPHMPDSVHFIPGHPLAGTEKSGPDAGFPGLFEGRWCIFTPVAGTDETALKRLRGFWEALGSKVDEMDAEHHDKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCLHNRDAILEMLARFSEDLAYLQRAIRWGEGDKIFELFTRTRAIRRSIV
CG7	Reut	    fig|264198.3.peg.3327_Ralstonia eutropha JMP134 	KVVIVGVGLIGGSLALSLKRAGVVGTVVGVGRSAASLDKAKALGVIDEAASLEVAMQGASLVVLCAPVAQNFALLHALEPHLQPGTIVTDAGSTKSDVIMAAKTALGDKVAQFVPAHPIAGRELNGVEAALDDLYVGKKVVLCPLQENSRADVAAVRAMWEATGADCHVMSAVQHDAVFASVSHLPHLLSYALVAQVANAEDAALKLDFAGGGFRDFTRIAASSPEMWRDICIANKDALLREISIYESVLAHLKTKIKEGDGAALERLFARASDTRLKWGAA
CG10	Rfer_1	    fig|338969.3.peg.3314_Rhodoferax ferrireducens DSM 15236 	QLGLIGCGLMGGSFALALKRAGLVKRVVGYSKSPSTTERAYQMGVIDVEAPSALLAVSGADIVLIAVPVAASEATFKSIKHLVTPQMLIMDVGSTKRDVVDAGRRALREQIGSFVPAHPIAGKEVSGVEHADADLYSGRQVILTPIERTLTIQLQKAVDVWSALGCRVVQMSPESHDAAFAAVSHLPHLISFALMNAISGQPQGKDYLSLAGPGFRDFTRIAASDAKVWRDIMISNREELLAQTKIFQRNLQALELMISSGNGEALEGLIEQASLTRAHWRMA
CG10	Rgel_1	    fig|279263.3.peg.1701_Rubrivivax gelatinosus PM1	QLGVIGCGLMGGSFALALKRAGLVKRVVGYSKSPSTTEKARRLGVIDTAAESALLAVSGSDLVLLAVPVAATEATLKAIRHLVEPGVMLMDVGSTKRDVVDAARRVLKDKVGCFVPAHPITGKEVSGIENADAYLYANRQVILTPLAQTDAALVQKATDVWAAIGCQVLKMSPENHDAAFAAVSHLPHLLAFAYFASVAKQPAGRDFLSLAGPGFRDFTRIAASDPVMWRDVLMSNREEILKQSQRFRHTLDALEHVMKLGNSEALEDLIRNASEMRAGWQMS
CG12	Rleg	    fig|216596.1.peg.4473_Rhizobium leguminosarum bv. viciae 3841  	RIALIGIGLIGSSLAYDIRRLGLAREIVVATRSPDTLKRAEELGLGDRYTTSSQDAVKDADLVIVSVPVGASESVAKEISASLKPGAIVTDVGSTKASVIAQMLPHMPDNVHFIPGHPLAGTEKSGPDAGFPGLFEGRWCIFTPVAGTDEVALKRLRSFWEALGSKVDEMDAEHHDKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCLHNRDAILEMLARFSEDLAYLQRAIRWGEGDKIFELFTRTRAIRRSIV
CG7	Rmet	    fig|119219.1.peg.2049_Ralstonia metallidurans CH34 	KVVIVGVGLIGGSLALSLKRAGVVGTVVGVGRSAASLDKAKALGVIDEAASLEVAMQGASLVVLCAPVAQNFALLHALEPHLQPGTIVTDAGSTKSDVIMAAKTALGDKVAQFVPAHPIAGRELNGVEAALDDLYVGKKVVLCPLQENSRADVAAVRAMWEATGADCHVMSAVQHDAVFASVSHLPHLLSYALVAQVANAEDAALKLDFAGGGFRDFTRIAASSPEMWRDICIANKDALLREISIYESVLAHLKTKIKEGDGAALERLFARASDTRLKWGAA
CG12	Rnub	    fig|89187.3.peg.541_Roseovarius nubinhibens ISM	RVALIGLGLIASSMFWAMKRAGVAGEVTGYARSDATRQTARDIGLCDRVCDTAAEACEGADLVVLCVPVGAMGDVAAEIRPVLAPGATVSDVGSVKRAVIEAVGPHIPEGVHFIPAHPLAGTEQSGPTSGFAELFDNRWNLIVPVPGSDEAAIERLERFWQALGANTERMDADHHDLVLAVTSHTPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLTNKDATLEILGRFTEELFALQRAIRMGDGDHLHEYFTHTRAIRRGII
CG12	ROSE	    fig|314262.3.peg.2107_Roseobacter sp. MED193	RVALIGLGLIASSMFWAMKRAGLAGEVTGYARSAETRDTARRIGLCDRICDSAAEAVEGADLVVLCVPVGAMGAVMGEIGPVLKPGATVSDVGSVKAHVIEAVTPHIPKGVHFVPAHPLAGTEHSGPEAGFAELFDNRWSLLVPVEGSDRTAVDQLRALWEGMGANVDEMDADHHDLVLAVTSHAPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLTNKEATLEILGRFTEELFALQRAIRTGDGDHLHDYFTRTRAIRRGII
CG12	ROSE_1	    fig|314264.3.peg.2308_Roseovarius sp. 217 	RVALIGLGLIASSMFLAMKRAGVVGEVTGYARSSDTRDVAREIGLCDRVCDSAAEAAEGADLVVLCVPVGAMGAVAAEIAGALKPGATVSDVGSVKKAVIEAVGPQLPEGVHFVPAHPLAGTEHSGPRSGFAELFDNRWCLIVPQDGSDRAAVERLERFWQALGSNTDEMDAEHHDLVLAVTSHAPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLNNKEATLEILGRFTEELFALQRAIRIGDGEHLHAYFTRTRAIRRGII
CG12	Rpal	    fig|258594.1.peg.4419_Rhodopseudomonas palustris CGA009 	KVALIGFGLIGGSIARGAKSLGLAGEIVTTARSESTRARVRELGIVDHVVESNAEAADGADLVILCIPVGACGDVAQEIAPHLKHGAIVSDVGSVKGAVVKAMAPYLPEDIHFVPAHPVAGTENSGPDSGFAELFINRWCILTPPEGTNAEATEKLAAFWRALGANVEIMTPEHHDLVLAVTSHLPHLIAYTIVSTAEELEGVTQSEVLKFSAGGFRDFTRIAASDPTMWRDVFLTNKDAVLEMLGEFQEDLSKLTRAIRRGDGDALFEHFTRTRAIRRGIV
CG12	1Rrub_1	    fig|1085.1.peg.904_Rhodospirillum rubrum ATCC-11170 (JGI) 	RVALIGVGLIGSSLARAIRRHGLARTIAVADQGEGVAARALALGLCDEAGEDAVAAVRGADLVMLCTPVGAGEAIARAIGPALAPGAIVSDVGSVKARVIEMIAPHLPAGVHLVPGHPVAGTEKSGPESGFAELFEGRWCILTPLPTTDARAVDKVAELWRRVGMVIETMDPDTHDKVLAITSHLPHLIAYTIVGTAADLEDHLSQKVIAFSAGGFRDFTRIAGSDPVMWRDVFLNNREAVLEILQRFTEDLTALQRAIRWGEGDTLEALFTKTRAIRQAVI
CG30	2Rrub_1	    fig|1085.1.peg.3401_Rhodospirillum rubrum ATCC-11170	TLGLIGLGAFGAFCVPHLSRFFHILGHDPARDGAARALALGVLPATLAEAAAASIVIPAVPVAVLAEVTAAIAPHLRPGALVVDVCSLKVEPMAVLERILPAGVIVVGTHPLFGPASGAKGIKDLRVAVCPGHGPAGAKAEDRVAAFLARRLGLAVHRVSAVEHDRQMAYVQGLTHLLARIVTKLDVPEMSLATGTFDHLMRMVHTVDRDSEALFRTITEANPFVGDLKARLGAITAEVCAPRDGAELQPPALSSALAASGVSTSISTDAPSARASIATSQV
CG7	Rsol	    fig|267608.1.peg.906_Ralstonia solanacearum GMI1000   	RLVIVGVGLIGGSLALALRRAGVVGQVIGVGRSGASLEAAVRLGVIDEALPMEAAVRGADMVVLCAPVAQTLPLLLAMQPHLGPDTIVTDAGSTKSDVIMAAKTALGDQVSQFVPAHPIAGRELNGVEAALADLYVGKKTVLCPLQENRRADVARVQAMWDAAGAYCHVMSAVQHDAVFAAVSHLPHVLSYALVAQIINAEDAALKLDFAGGGFRDFTRIAASSPEMWRDICLSNREALLRELTTYEAVVGRLKAMIAERDAEALERVFRRASEARLAWPQR 
CG12	Rsph	    fig|272943.3.peg.1478_Rhodobacter sphaeroides 2.4.1	RVALIGLGLIASSMAHAIRAAGLATEITGHARSAETRAAAVEIGLCDRVFETAAEAVAGADLVVLAVPVGAMGAIAAEIAPHLAPGATVTDVGSVKQAVITAVAPHVPEGVHFVPGHPLAGTEHSGPRSGFATLFRNRWWLLTPPEGADPEAVARLRALCEGMGANVEEMDAAHHDLVLAVTSHTPHLIAYTMVGVADHLRRVTQSEIIRYSAAGFRDFTRIAASDPTMWRDVFLTNKEATLDILGRFTEELFALQRAIRLGDGDHLFEYFTRTRAIRRGII
CG22	Rxyl	    fig|266117.1.peg.2540_Rubrobacter xylanophilus DSM 9941 	TLGIVGVGLIGGSVGLAARGAVGEILGVDRPEVLEEAASLGAVDRPSTLKEVREADLVVLAAPISRIRELLGKLSPARGLVTDVASTKTGIVREAERHGLRFVGGHPMAGSQLSGVANARPDLFRGARYFLTPTERTDPEAYREVSRFVQLLGAIPTAVAPEKHDLLMATLSHLPHLMAAALLKVASDISPEALSFAGPAFRDLTRVGSSNPSLWADILAENAPALGEALGAFAGAMAQLGSEIQDRRSMERRFREARRAYEALGG
CG84	Saci_4	    fig|330779.3.peg.447_Sulfolobus acidocaldarius DSM 639 	RVTIIGYGGMARSLSSLFHLSGHNVVITGRDKRKAERLANEFKFVYMEEKSALDWSEYVILSISPSGLDYAESVLKYAKEKVVMDIFSTKSNTFRKLQTLSEQFSFEYISTHPLFGPILYPVGERIAVIPSQKSTRTQEVIEFWRKCGLVPVLTTPEEHDKVMAIVQVLAHFYMLGLLRSSNTLKKELEVGNKIDELQTTNFREISKILDRINSLLPVILEIQKDNPYAHKVRDLGMRELQDVLKSLGE
CG12	Sala_2	    fig|317655.9.peg.2749_Sphingopyxis alaskensis RB2256	RVAIVGLGLIGSSVARAVKARLPGVAVAGYDASDAVRVEARALGFCDAVADGAAAAVADADLVVLAVPVGRMADAAAAIAPGLKADAIISDVGSSKAGVAAALAKALPDHAVIPAHPVAGTENSGPAAGFATLFDGRWCIVTPPAGAPQDAVTAVTSFWQALGARVETMDAAHHDMVLAVTSHLPHLIAYTIVGTASELEEVTESEVIKYSAGGFRDFTRIAASDPVMWRDVFLANKDAVLATLQRFNEDLTVLQQAIRRGDGARLEEWFTRTRAIRRSII
CG1	Sama	    fig|326297.3.peg.3526_Shewanella amazonensis SB2B	IVIIGGQGQLGRLFAQMFALSGYEVRLLDKDDWDHADELFDGAGLVLVTVPIATTCSLIRERLDHLPEHCILADLTSVKGAPLKAMLETHKGPVVGLHPMFGPDVGSLAKQVVVVCHGRAPEKYQWLMEQIGIWGARLVEADAGRHDKAMQLVQAMRHFSSFVYGLNLCREQADIDTLLEFSSPIYRLELAMVGRLFAQSGELYADIIFAQEESLTAISDFIDNYRDALELLKTGDRAGFIARFNEVSNWFGNY
CG18	Saur_2	    fig|93062.4.peg.1582_Staphylococcus aureus subsp. aureus COL 	TVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADISQLDKAKSIGIINEKCLNYSEAIKKADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHECNLLKHNIHLVSGHPMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDYVTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNKTYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDAL
CG17	Save	    fig|227882.1.peg.6523_Streptomyces avermitilis MA-4680 	TALVIGTGLIGTSAALALAGRGVVVHLADHDPEQARTAAALGAGTDEAPEKPVDLVIVAAPPAHVAATLADAMRRGLGRGYLDVASVKGGPRRELEALGLDRSVMSTYIGSHPMSGREKSGPLAATGDLFEGRPWVLTPTRDTDTEVLNLALELVSHCRAVPVVMDADAHDRAVALVSHMPHLVSSMVAARLENAEETAVRLCGQGIRDVTRIAASDPRMWIDILSANPGPVADLLTDVSADLDETVRALRSLQSSDEAKRRAGATGIEDVL
CG1	Sbal	    fig|325240.3.peg.4134_Shewanella baltica OS155	VVIVGGKGQLGGLFSQMLTLSGYQVNLLDKDDWQQADSLFADAGMVLVTVPIAITCELIREKLTQLPADCILADLTSIKTEPVKAMLEAHSGPVVGFHPMFGPDVGSLAKQVVVVCHGRSPEKYQWLLEQIAIWGARIVEAEPERHDSAMQLVQAMRHFSTFVYGLNLCKEEADIDTLLQFSSPIYRLELAMVGRLFAQSPELYADIIFAQQDSQHAIGDYLDNYREALELLKRGDRNEFIKQFQSVAKWFGDFAPQF
CG1	Sbon	    fig|12149.1.peg.2668_Salmonella bongori 12419	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQQDWPHAGDIVSDAGMVIVSVPIHVTEQVIAQLPRLPSDCILVDLASVKSGPLQAMLAAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRQPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGDAIDLLEQGDKQAFIDSFRKVEHWFGDYAKRF
CG17	Scae_2	    gi#7688712_Streptomyces caeruleus(Streptomyces spheroides)	TAVIIGTGMIGTSIGLALRKQGVDSYLMDTSPVALRIAEAVGAGTAEEPPETVDLAVVAVPPVHVAPVIASHQSRGTARFYVDVAGVKVSTRRELDALGCDLATVVGGHPLVGRPGSGPLAARGDLFDGRPWALVPAVGTDAAALNRALELVAACGAIPVVLDAEAHDRAIALGTLVPQIALTLVAARLTEADSGALRLLGSVWSEIPQLVGVDSATSWTQVLAANAAPVVGELEKLSRDLASLLETLRGVADGDGSLAEPDGRLLEFIQ
CG98	Scer	    fig|4932.3.peg.431_Saccharomyces cerevisiae	VIGIIGLGDMGLLYANKFTDAGWGVICCDREEYYDELKEKYASAKFELVKNGHLVSRQSDYIIYSVEASNISKIVATYGPSSKVGTIVGGQTSCKLPEIEAFEKYLPKDCDIITVHSLHGPKVNTEGQPLVIINHRSQYPESFEFVNSVMACLKSKQVYLTYEEHDKITADTQAVTHAAFLSMGSAWAKIKIYPWTLGVNKWYGGLENVKVNISLRIYSNKWHVYAGLAITNPSAHQQILQYATSATELFSLMIDNKEQELTDRLLKAKQFVFGKHT
CG17	Scoe_1	    fig|100226.1.peg.1728_Streptomyces coelicolor A3(2) 	TALVIGTGLIGTSAALALTERGVTVHLADHDPEQARTAAALGAGTDEAPDGPVDLAVVAAPPALVADVLADAMARGLARGYIDVASVKGGPRRELEARGLDLSAYIGTHPMSGREKSGPLAATADLFEGRPWVLTPTRDTDTEVLNLALELVSHCRAVPVVMDADAHDRAVALVSHMPHLVSSMVAARLEHAEEAAVRLCGQGIRDVTRIAASDPRMWIDILSANPGPVADLLTDVAADLEETVRALRALQSTDEDKRREGGTGIAEVL
CG1	Sden_1	    fig|318161.3.peg.1131_Shewanella denitrificans OS-217 	IVIVGGAGKLGALFSQMLSLSGYQVKSLDKDDWQQAKALFSGAAMVIVSVPISLTCALIRRELSQLPADCILTDLTSVKAEPLRAMLDAHSGPVLGLHPMFGPDVGSFAKQVVVVCHGRQQDKYQWFLDQIAIWGARIEITDAKNHDEAMQLVQAMRHFSSFVYGLNLFKNNADIANLLRFSSPIYRLELAMVGRLFAQAPELYADIILAQPGNVQLMSDYLQHYQHALETLKRGDRDEFIRQFSQVSTWFGDYAPAF
CG13	Sden_2	    fig|326298.3.peg.2020_Sulfurimonas (Thiomicrospira) denitrificans ATCC 33889 	NIAIVGLGLMGGSLAKSLKNIDFIENIVGSDHNINHQKEALELGLVDKIVEFDEVKNYDVIFLAIPVDGVISAFENLLDVRESTTIIDLGSTKAKIIDSISSKIRKNFVAAHPMTGTENFGPRAAIDNLYNGQVVVLCDIENSGELQANIAKKIFKALNMKLHSMSAHQHDRHAAFISHMPHAISYSLANTVMNQENKRNILALAAGGFRSMSRLAKSSANMWEDIFRQNKTNLLEAIELFEKELSILKEHIKNDEWDEVHKNIEAGNRLHDIL
CG1	Sdys	    fig|216598.1.peg.4845_Shigella dysenteriae M131649 	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQHDWDRAVDIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNGPLQAMLAAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRF
CG16	Selo	    fig|1140.3.peg.870_Synechococcus elongatus PCC 7942 	RIGIVGLGLIGGSLGFDWRDRGHRLLGYSRRPATCERAIARGVVDHASPDPAVLTEAEVIVLATPLGVLETTVRELRDYWHPEAIVTDVGSVKQPIVAALDPLWPRFVGGHPMAGTAENGIEAALRGLFQNRPYVLTPTDQTDPAAIAVVAQLAQELGSVVLHCDPASHDRAVATISHLPVFISASLIQTCLQEPDPAVQTLAATLASSGFCDTSRVGGGNPELGVMMARYNQAALLEQIDRYQIQLERLKTAIAAADEPAIAAILQQNQEMRPRY
CG1	Sent_2	    fig|209261.1.peg.2450_Salmonella enterica subsp. enterica serovar Typhi Ty2 	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQQDWPRARDIVADAGMVIVSVPIHVTEQVIAQLPPLPSDCILVDLASVKSGPLQAMLAAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRQPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGDAIGLLEQGDKQAFIDSFRKVEHWFGDYARRF
CG18	Sepi	    fig|176280.1.peg.1047_Staphylococcus epidermidis ATCC 12228  	NILFVGLGLIGGSLASNLKYHYSNFNILAYDSDYTQLDEALSIGIIDQKVNDYATAVEIADIIIFATPVEQTIKYLSELTNYNTKTHLIVTDTGSTKLTIQSFEKELLKHDIHLISGHPMAGSHKSGVLNAKKHLFENAYYILVFNEIENNEAATYLKKLLKPTLAKFIVTHANEHDFVTGIVSHVPHIIASILVHLSANHVKDHSLIEKLAAGGFRDITRIASSNAQMWKDITLNNQNHILSLLNEIKEQITGIENLIREQNSNSIYDFFVKAKDYRDQL
CG1	Sfle	    fig|198214.1.peg.2489_Shigella flexneri 2a str. 301 	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQHDWDRAADIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNGPLQAMLAAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRF
CG1	Sfri	    fig|318167.3.peg.2662_Shewanella frigidimarina NCIMB 400	VVVVGGQGKLGQLFSQMLVLSGYEVKSIDKNDWQDAAAIFDGAGLVIVTVPINVTCEVIRDKLTQLPENCILADLTSIKEAPLTAMLAAHKGPVVGLHPMFGPDVGSLAKQVVVVCHGRHQEAYQWLLQQIEIWGARIVEAEAERHDKAMQLVQAMRHFSTFVYGVNLCKEEADIGNLLQFSSPIYRLELAMVGRLFAQDPELYADIIFAQPGSQHAISDYLDNYRDALTMLQTGNRQAFVEQFQRVAKWFGDFAPQF
CGO	Sfum_1	    fig|335543.6.peg.3883_Syntrophobacter fumaroxidans MPOB 	VGVIGGKGEMGRLFSGFFQSCGFRVNVGDLGTNPTAREVLESSDIVLFSVPLHRTEAIIRDLVPYAKPHQLLLDLSSLKVGPVREMLRSASFVVGLHPMFGGRISTFRGQTIVACPARIPTPDWLRLRSLLSAGGMEVKESTPEEHDRMMSIIQVLFHMTTMLTGRVMRRMGIDLAEVLEYASPGYRVELSQVGRLFAQSPELYSAIIQGNPGTGEVLAQLREGLELYGGWFEKQELSGFVKDFERSARYLGEF
CG18	Sgor	    No fig or gi#_Streptococcus gordonii str. Challis 	TVYIAGLGLIGASLALGIRRAHPEIEILGYNRSEESRRVALERGMVDRVTDNFVAFAPLADVIILAVPIKQTIAFIKDLADLKLKENVIISDAGSTKAEIVAAAEKYLQNKPVRFVGAHPMAGSHKTGAKAAHVTLFENAYYIFTPSSLTKSGTLEEMKDLLSGLQARFIQVDPVEHDRVTSQISHFPHILASSLMEQTAAYSQEHELTQSFAAGGFRDMTRIAESEPGMWTSILLTNPQAILERLEDFKKQLDKAAAIEAKDETAIWEFFDRGRQSRKQM
CG18	Shae	    fig|279808.3.peg.2461_Staphylococcus haemolyticus JCSC1435	NILFIGLGLIGGSLASNLKYYQPNLTISAFDADKDQLEKALSIGIIDKKIEDYSEGVKNADIIIYATPVQQTELYLKELPNYQTQSHLIVTDTGSTKSNIQSYEKFLLNNDIHLVGGHPMAGSHKSGVLNSKKHLFENAYYILVYDDARNAESAKKLQTLLSTTSAKFITTSAQEHDYVTGVVSHIPHIIASSLVHLSETNSKNHTLVTQLAAGGFRDVTRIASSNADMWRDITFSNQENILHLLEMLQQQLDSISSHIRLNDTNEVHSFFSGAKKFRDQL
CG12	SILI	    fig|292414.1.peg.467_Silicibacter sp. TM1040 	RVALIGLGLIASSMFWAIKRAGLAGEVTGYARSAETRDTARRIGLCDRVCDTASAAVEGADLVVLCVPVGAMGAVAAEIAPALMPGATVSDVGSVKRHVIEDVAPHIPEGVHFVPSHPLAGTEHSGPESGFAELFDNRWCLLVPVDGSAPEAVARLRALWEGMGAHVDEMDADHHDLVLAVTSHTPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLTNKDATLEILGRFTEELFALQRAIRTGDGQHLHDYFTRTRSIRRGII
CG17	Slav	    gi#15029332_Streptomyces lavendulae 	SLAVVGTGLIGTSVALAAARRGVTVHLLDASASAVRTAELLGAGTARPPEEPVDLAVLAVPPSKVADVLSEQQVRGLARSYTDVASVKAGPERDVLARAPRPTHFVGGHPLAGRERSGPLAARPDLFQDRVWVLTPSRLTSKPAFDRALDLIGLCGGVPTVMQSGAHDETVALTSHAPHLMASLVAARLGGRSPVSALLVGQGFRDATRIARGEARLWTDIIETNAAEVAGVLTALQTDLTELLTAVQDLSVRDPRNRARSRRNLIGLL
CG4	Smal_2	    fig|40324.1.peg.2028_Stenotrophomonas maltophilia K279a	VGIVGSAGAYGRWLTRFFQQHMQLPVIGHDPADPGSHTPEQLLAQADVLVFSAPIRHTPALIAEYVRQSAGREQDRLWLDVTSVKEAPVQAMLASQAEVVGLHPMTAPPKAPTLKGRVMVVCEARLRHWQPWVDSLCTALQAECVRATPQHHDQMMALVQAMVHATHLAQAGVLRQYQPQLGDLAAMMPYRSASFELDTAIISRILSLNPAIYEDIQFGNPYVAPMLERLVGQLQTLQAQVGQGDDTARDAFREGLLSANRSAFGEQA
CG1	Smar	    fig|615.1.peg.3937_Serratia marcescens Db11	IVIIGGNGQMGRLFNRLLTLSGYQVRVLDQEDWPQAEQLLADAGMVIVSVPIHVTEQVISRLPPLPDDCILVDLASVKNRPLHAMLAAHSGPVVGLHPMFGPDVGSVAKQVVVYCDGRQPEAYQWLLEQLQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSEENVALIKRYYQRFGEAIKLLEHGDKQAFIDSFRKVEHWFGDYAQRF
CG12	Smel_2	    fig|266834.1.peg.3955_Sinorhizobium meliloti	TIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSAAEAVEGADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHFVPGHPIAGTEHSGPDAGFAGLFRGRWCILTPPAGTDEEAVARLRLFWETLGSMVDEMDPKHHDKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCLHNKDAILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIRRSIV
CG18	Smit	    fig|246201.1.peg.707_Streptococcus mitis NCTC 12261 	TVYIAGLGLIGASMALGIKRDHPDYEIVGYNRSQASRDVALKEGMIDRATDDFASFAPLADIIILSLPIKQTIAFIKELANLDLKEGVIISDAGSTKSAIVDAAEQYLACKPVRFVGAHPMAGSHKTGAASADVNLFENAYYIFTPSSLTGQDTLEEMRDLLSGLHARFIEIDAKEHDRVTSQISHFPHIIASSLMEQTAVYAQEHEMARRFAAGGFRDMTRIAESEPGMWTSILLSNRETILERIEDFKERLDEVGQAISKGDEEQIWNFFNQAREQRQAM
CG18	Smut_1	    fig|210007.1.peg.708_Streptococcus mutans UA159	TIYIAGLGLIGASLALGIKRDHPHYKIVGYNRSDRSRDIALERGIVDEATADFKVFAALADVIILAVPIKKTIDFIKILADLDLKEDVIITDAGSTKYEIVRAAEYYLKDKPVQFVGSHPMAGSHKSGAVAANVNLFENAYYIFSPSCLTKPNTIPALQDLLSGLHARYVEIDAAEHDCVTSQISHFPHIIASSLMKQAGDFSESHEMTKHFAAGGFRDMTRIAESEPGMWTSILLTNQEAVLDRIENFKQRLDEVSNLIKARDENAIWAFFNQSRQIRKNM
CG1	Sone	    fig|211586.1.peg.1265_Shewanella oneidensis MR-1 ATCC 700550 	VVIVGGKGQLGGLFQQMLRLSGYQVKVLDKDDWQQAECLFADAGLVLVTVPIAITCDIIREKLTQLPRDCILADLTSIKTEPMQAMLAAHKGPVVGFHPMFGPDVGSLAKQVVVVCHGREADKYQWLLEQIAIWGARIVEAEPECHDNAMQLVQAMRHFSTFVYGLNLCKEEADIETLLKFSSPIYRLELAMVGRLFAQSPELYADIIFAQQESQHAIGDYLDNYREALELLKRGDREEFINQFQMVAKWFGDFAPQF
CG18	Spne	    fig|171101.1.peg.1230_Streptococcus pneumoniae R6	TIYIAGLGLIGASMALGIKRDHPDYEILGYNRSQASRDIALKEGMIDRATDDFASFAPLADVIILSLPIKQTIAFIKELANLDLREGVIISDAGSTKSTIVDAAEQYLAGKSVRFVGAHPMAGSHKTGAASADVNLFENAYYIFTPSSLTSQDTLKEMKDLLSGLHARFIEIDAKEHDRVTSQISHFPHILASSLMEQTAVYAQEHEMARRFAAGGFRDMTRIAESEPGMWTSILLSNSEIILDRIEDFKERLEAIGQAISKGDEEQIWNFFNQAREQRQTM
CG98	Spom	    fig|4896.1.peg.867_Schizosaccharomyces pombe	QVGIIGFGDMGRLYAEYISKAGWRVNVCDRPENYESIQATYGNGGYTVLKDGFQVSRTSDYILYSVEAEHIDKVVALYGPATKVGAIVGGQTSCKAPEMNAFEKYLPEDVDIISCHSMHGPKVNPKSQPLVIIRHRASDEHFEIVNEILSCFKSSVVYLSAKEHDRITADTQAVTHAAFLTMGLAWHANNQYPWEINRWCGGIENIKMNLSMRIYSSKWHVYAGLAILNPEAQRQIQQYASSVTELFKLAISGKAKEYEDRIRNAGKFVFGENM
CG12	1Spom_1	    fig|246200.3.peg.3549_Silicibacter pomeroyi DSS-3 	RVALIGLGLIASSMFWAIKRAGLAGEVTGFARSEATRDTARRIGLCDRVCESAAEAAEGADLVVLCVPVGAMGQVAAEIGPVLKPGATVSDVGSVKRAVIDAVGPHIPEGVHFVPAHPLAGTEHSGPESGFAELYDNRWCLLVPTEGSDPQAVARLRALWEGMGANVEEMEADHHDLVLAVTSHVPHAIAYTMVGVADHLRRVTESEVIKYSAAGFRDFTRIAASDPTMWRDVFLNNREATLDILGRFTEELFMLQRAIRMGDETYLFDYFTRTRAIRRGII
CG30	2Spom_1	    fig|246200.3.peg.1790_Silicibacter pomeroyi DSS-3 	SVGLFGFGAFGRLIATHLTPHLPCLVHDPALPDGANLPAGLSIASQAEAAGCDLVILAMPVAGIAEACRAIAPHLRPGAVVADVGSVKMTPAAIMQATLPGHVALIGTHPLFGPQSARHGIAGHKIALCPLRGRAHLPVAAFLRARLGLRVILTTPEAHDREAATVQGLTHLIAQAMNRMGPLPDRMTTASFDLLKQAVEMVRHDPPGVLAAIESANPFAPRVREEFLGLIEGLDRAYAGRD
CG17	Sros	    gi#24940594_Streptomyces roseochromogenes subsp. oscitans	TAVIIGTGMIGTSIGLSLRKQGVDTYLMDVSPVALRISEAVGAGMAEEPPEAVDLAVVAVPPAQVAPVIASHQSRGTARFYVDVAGVKVSSLRELEALGCDLATVVGGHPLVGRPGSGPLAAQDDLFDGRPWALVPAAETDASALNCALELVALCGAIPVVLDAEAHDRAIALGTLVPQVVLTLAAARLTEADSIALRLLGGVWSEIPQLIGVDSATSWTQALAANAAPVVSELEKLSLDLTTLLETLRAVADGSGSPAEPDGHLLEFIQ
CG18	Ssap	    fig|342451.4.peg.734_Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305	QILFVGLGLIGGSLASNLRYYHDDIEITAFDADTSQLDKALSIGIIDYQSTDYKTSVENADIIIYATPVQQTVKYLQDLPNYQLKKHVIITDTGSTKSTIQQYEQFLLNHDIHLVGGHPMAGSHKSGVLNAKKHLFENAFYILVHNETDNDAAFEEIQHLLQTTSAKFISTTAEEHDFVTGIVSHVPHIIASSLVHLNAQHVEDSSLVKTLAAGGFRDITRIASSNPIMWRDITIENKNTILRILKEWKNQMSDVINIIEHNNPDELYDFFNDAKVYRDQL
CG18	Ssob	    No fig or gi#_Streptococcus sobrinus 6715	TIYIAGLGLIGGSLALGIKRDHPNYEVIGYNRSDKSRNIALERGLVDQATANFAEFAPRADVIILAVPIKQTIDFIKALADMPLKDNVLITDAGSTKAEIVIAAEKYLDPSKVQFVGSHPMAGSHKSGAIAADVNLFENAYYIFTPTNLTRETTIPEMKDLLTGLHARFVQIEAAEHDRVTGQVSHFPHVLAASLMEQAGDYAKDHELTNHFAAGGFRDMTRIAESEPGMWTSILLSNQEAVLGRIADFKTHLDNVAQLISAGDADGIWNFFNQARLTRKAM
CG84	Ssol	    fig|273057.1.peg.273_Sulfolobus solfataricus P2	RVVIYGYGGMAKSIVSILSLAGHEVSITGRDLSKAEMLANQFKCVSMSLLKAIDWGDIIIFAIPPSAILNNSDELFSKALKDKIVMDISSSKFKIFGFLEELSRKLEFRYISTHPLFGPIEYPIGERVVIIPSKTSSNDDVMKVENFWRKSGLVPVITDVETHEKAMAIVQVLTHYYLLGLSNAIDTLSLELGVDYSNFHTTNFRELNKILKRVKDLKNVITEIQNQNPYSYKVRNIGLEELKKIKEELEGGK
CG1	Sson	    fig|216599.1.peg.1580_Shigella sonnei 53G 	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQHDWDRAADIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNGPLQAMLAAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRF
CG18	Ssui	    fig|1307.2.peg.1363_Streptococcus suis 89/1591	TILIVGLGLIGSSLALCIRKDHPDYHLIGFDPNEQSCQIALGKGMVDEVSTELEGVAKQADVILLCVPIQVSLRLIEEFSALELKDTVLITDAGSTKSAIVAAAEEHLAPRQINFIGGHPMAGSHKSGASAADLHLFENAYYIMTPCQATKQDAVPRLTDLLSGTGARFVQIDAAEHDRVTSQISHFPHVLASSLMHQAGEYAQDHPFTNNFAAGGFRDMTRIAESEPSMWTNILLTNADSILNRIEEFQARLSEISDVLRSGDQKAIWDFFDKGRQTRKAM
CGO	Sthe	    fig|292459.1.peg.1361_Symbiobacterium thermophilum IAM 14863	TVAIWGVGLIGGSIGMALRQRGLADEVIGIGRPATRAAAADASGPGGGAGAWEVPEAVRLGAVDRMVTDPAAALARADLVILAMPVQPMIDLAPRAAPLLRPGTVVTDVASVKEAVVAAWERHLPDGVAFVGGHPMFGRERSGVAWASADLIPGCRWVLTPGQRAVTVLKAGRSGAEVSPLELVWDLAAALGALPVVMSPAEHDRRVAGASHLPQLVATALAAAALDLDETQPGTLELAAGGFRDATRIADSPAALWHEIWANNRPALREAVAAFRGVLADLEAAVDAGDFGALAAVFERAHAARRRVG
CG18	Sthe_5	    fig|299768.3.peg.345_Streptococcus thermophilus CNRZ1066	TIYIAGLGLIGGSLALGIKRDHPDYEILGYNRSDYSRNIALERGIVDRATGDFKEFAPLADVIILAVPIKQTVAYLKELADLDLKDNVIITDAGSTKREIVEAAERYLTGKNVQFVGSHPMAGSHKSGAIAADVTLFENAYYIFTPTSLTKETTIPELKDILSGLKSRYVEIDAAEHDRVTSQISHFPHLLASGLMEQAADYAQAHEMTNHFAAGGFRDMTRIAESEPGMWASILMTNGPAVLDRIEDFKKRLDHVADLIKAEDESAIWEFFDNGRKKRKEM
CG84	Stok	    fig|273063.1.peg.2438_Sulfolobus tokodaii str. 7 	NITVIGYGGMARSLISLFSLVGHNVVVTGRNKEKAERLASEFKVVYMDLDSALNWGEYIILALSPSSFDYILRISPKFTSKVVMDIFSSKNEIFKELEKLSEIYSFNYISTHPLFGPITYPVGERIVIIPSKTSKNVNEIVNFWRECGLNTTVSTVEEHEKAMAIVQVLAHFYILGLHRSIDELRKELGIENLSNFYTTNFKELNKIIEKVSNILPVILEIQKSNPYAYKVRDIGVNELQKIKEELGG
CG17	Stoy	    gi#21911427_Streptomyces toyocaensis	AMAVIGTGLIGTSVALAASRQGVVVYLSDRNPSAARTAAALGAGLTQTPAERVDLAVLAVPPSQVGTVLTEVQKRELAVSYTDVASVKAGPEQVALAQAPDPSRYIGGHPLAGREQSGPLAARAELFRDRPWALTPSPMTSNATFNRALELVALCGAVPVVTQSQAHDDAVALTSHVPHLLASLMAARLRDAPAEMSRLAGNGLRDVTRIAGGDSRLWGDILQSNAGAVVGVVKRVHEDLTRLVAALDQLAERGGEDRDDGLRTMMELLD
CG1	Styp_1	    fig|99287.1.peg.2578_Salmonella typhimurium LT2 	VVIVGGGGQMGRLFEKMLTLSGYQVRILEQQDWPRARDIVADAGMVIVSVPIHVTEQVIAQLPPLPSDCILVDLASVKSGPLQAMLAAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRQPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSERNLALIKRYYKRFGDAIGLLEQGDKQAFIDSFRKVEHWFGDYARRF
CG12	SULF	    fig|52598.3.peg.2337_Sulfitobacter sp. EE-36	KVALIGLGLIASSMFWAMKRGGLAGHVSGFARSAETRDTAREIGLCDEVCDSIAKTVKDADLVVLCVPVGVMGSVAAEMAGHLKPGCTVTDVGSVKADVIAQVGPLLPDGVHFIPAHPLAGTEHSGPRSGFAELFDNRWCLLVPVPDTNANAISRLRNLWDGMGANVEEMDAEHHDLVLAVTSHAPHLIAYTMVGVADDLRRVTDSEVIKYSAAGFRDFTRIAASDPTMWRDVFLTNKEATLEILGRFTEELFALQRAIRMGDGDHLHDYFTRTRAIRRGII
CG24	Susi	    fig|234267.9.peg.7488_Solibacter usitatus Ellin 6076	NVVIVGTGLIGASFGLAMRKAGYKGRITGVSSAQAIADAVAVGAIDGGATLEEAVPEAELVFLSQTIGRIMDTIRHLDPLLQPGTLVTDAGSTKCEIVDLARQCITRVQFLGGHPMAGKETRGAAAADAELFRNRTWILTPDTAEELRTSCALEFRMLLHKIGARVLTLDADEHDRVVSLTSHLAQLASTALAATVADKLGGPPRLEAAGPGLEDMTRLALGSYELWRDILATNSDHIDRALGVYIQELEHMRENLRTRQLQQEFERGRELAVRIR
CGO	Swol_1	    gi#114566874_Syntrophomonas wolfei str. Goettingen 	DVLIVGVGLIGGSLGLALKDSPLVHRILGSDRDTASLDKALEMGVIDQAISLEEGARQARLVFLCTPLRFYSEIINRIRPYLKPGSIVSDVGSTKEEVCRLLAALPEGIWAIGGHPMAGAETRGVQGADRYLFENAVYALTPLPGVPAPVLDFMVELLQSTGARIRFMEATLHDQLVATVSHIPHLTAVALVALTEGKAENLMMAAGGFRDTTRIASSNPELWEDILFSNREQIVPHLDQLISSLAVIKEALAGGDHDNILRLLHEAKAIRDKI
CG16	SYNE	    No fig or gi#_Synechococcus sp. PCC7002	KIGIVGLGLIGGSLAIAFREKGLEVLGVSRKNTTCETALTKKIVTKASTDMGLLRDADVVFLCTPIKAILPTAQTLIPHLKPTAILTDVASVKGEIAQAIAPLWPNFIGGHPMAGTAEQGIDAALPGLFINAPYVLTPTPETSPDAVKILQDLILLLQSRFYCCAPEIHDQAVAWISHLPVYVSASLIAACGSEINLEVLQMAKALASSGFRDTSRVGGGNPELGLMMAQGNQQALLKSLTHYRQQLDQVIADLETENWEAIAQFLAATQQQRPDF
CG16	SYNE_1	    fig|84588.1.peg.2051_Synechococcus sp. WH8102	CVGIVGLGLIGGSIGLDLRAQGIKVQGLVHRSSTAERAMERGLVSAVSTDPACLACCDLVILALPIPALLKPNAEFLEALPAEAVVTDVGSVKQPVLQEWKGRHPRFVASHPMAGTAQAGVEAGQRDLFQGRPWIATPDAETDSAALAVVEDLARRLGSRWFTAGAAQHDQAVALISHMPVLVSAALLRAAGDERDPEIRALAQALASSGFADTSRVGGGNPDLGVAMASSNREAVLKALAAYRWSLEQLEDAVIKTNWDQLHKELTRTQHLRPGF
CG16	SYNE_4	    fig|316279.3.peg.1511_Synechococcus sp. CC9902 	RVGIVGLGLIGGSLGLDLQAKGWDVQGLVHRSVTAERAKERGLVSDVSTDPACLAGCDLVILALPIPLLLHPEPSLLEALPAEAVVTDVGSVKQPVLEAWRDRHPRFVASHPMAGTALAGVEAGIKGLFRGRPWIATPEPKTDASALAMVQSLALSLGSHWLTAAAAQHDQAVALISHMPVLVSAALLRAVGDERDPEIRRLALVLASSGFADTTRVGGGNPDLGVAMASTNRGALLRSLAAYRWSLEQLEDAVLQENWPQLQIELKRTQALRPDF
CG16	SYNE_5	    fig|110662.3.peg.1551_Synechococcus sp. CC9605 	RVGIVGLGMIGGSLGLDLQARGWTVQGLVHRQATADRAMARGLVGAVSTDPSCLSDCDVVILALPIPLLLNPPDELIEALPEAAVVTDVGSVKQPVLEAWRQRHPRFVASHPMAGTAQAGVEAGVVDLFRGRPWIATPDAATDPAALAKVRDLAVSVGGHWLTSTAFQHDQAVALISHMPVLVSAALLRAVGDERDPEIRQLAMVLASSGFADTSRVGGGNPELGVAMASTNRDAVLRGLAAYRWSLEQLEDAVLQQSWSQLALELRRTQTLRPDF
CG16	SYNE_3	    fig|1148.1.peg.1391_Synechosystis species PCC6803  	KIGVVGLGLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLVDEAGQDLSLLQTAKIIFLCTPIQLILPTLEKLIPHLSPTAIVTDVASVKTAIAEPASQLWSGFIGGHPMAGTAAQGIDGAEENLFVNAPYVLTPTEYTDPEQLACLRSVLEPLGVKIYLCTPADHDQAVAWISHLPVMVSAALIQACAGEKDGDILKLAQNLASSGFRDTSRVGGGNPELGTMMATYNQRALLKSLQDYRQHLDQLITLISNQQWPELHRLLQQTNGDRDKY
CG82	Taci_3	    fig|273075.1.peg.248_Thermoplasma acidophilum DSM1728 	AAIIGKEGRLGRVLSSILTGNGVQIDDGADLAFLSVPIKAAMEYIERRDRTYVELSSVKSVFRKYSGSIVSIHPLFGPSSYNDGLHRTIIFVTDISNVKYKEIIEEMFRGYDLVSMSAEEHDRMMVSDMVIPYLMSMIARRIEAGYHTRSFDMARSLASIVEGENPEVVMDTIRLNPFSGMARDMINDVMSVIP
CGO	Tcom	    No fig or gi#_Thermodesulfobacterium commune DSM 2178	IGIIGGKGKMGEFFARFFQKKGYYVLVSDKDTQLNNQSLLQEAKVILISVPMSVFPKVVEEIAEFTTPEHWILDVCSLKLEPYKIMKSLLKKPEVLATHPLFGPYETSLKGKTIAYFPIRGKNLLNWFIKVMSEDGLSLIKISPKKHDQIMGLVQVLNHFWLVLLGNIINHSGFRLEEIVSLATPSFLKQLEILQRLAYQDEKLYTKIQVDNPYGKRFRTLFYRECKKLIKALNSSEAQVFFETNFKEVKT
CGO	Tden	    fig|292415.3.peg.543_Thiobacillus denitrificans ATCC 25259 	RLAVIGVGLIGGSFALALKQAGAVGEVVGVGRKPASVEQARARGLIDRAGDWSEAGQADCVLLAMPVGETETVLRALEPHLTARTIVTDAGSTKSGVVATARAALGAKWRNFVPGHPIAGSEQSGPDAARADLYRGRKVVLTPDADTDPHALAIVKALWQAVGAEPELLDAATHDRVFAAVSHLPHLAAYALVDELAQRADRDTFFRFAASGFRDFTRIAGSSPEMWRDIALANRDALLGELNAYVAALQTLSTAVAAADGTALLEIFSRARDARAGWIDT
CG16	Telo	    fig|197221.1.peg.2434_Thermosynechococcus elongatus BP-1	RIGIVGLGLIGGSLGIDLRAKGHYVVGLSRRPETYERAIARGAIDWGSTEPEILRALDLVFLCPPIGSILPVALEIIPSLSPETVLTDVGSVKGEIVPALEKLWPRYVGGHPMAGTAESGIEAAQAHLFENAPYVLTPTLHTQSAAIDCVAGVVNDLGAKLLYATPSDHDRAVAWISHLPVLVSAALILANAQEANEPIRTLAQQLASSGFRDTSRVGGGNPALGRMMAEYNRAALRHCLIHYRATLDDLIRQVEQEDWERLQITLEQAKAYREQV
CG13	TENA	    fig|313598.3.peg.1203_Tenacibaculum sp. MED152 	AIYIIGVGLIGGSFAIDIRKENPTAIIYGIDTNEGYLDESLALGVIDRKATLDDLENADLVIVAIPVDATVKLLPTILDKIGDNTLVVDAGSTKEAICKEVEHHQKRRNFLAAHPIAGTENSGPKAAISGLYKGKTNIICEVEKTTFKLQEKALELFRAIGMRIRYMDPGSHDKHIAYVSHLSHISAFMLGKTVINKEKNERDIFDMAGSGFESTVRLAKSSPAMWTPIFRQNKDNVIETLEEYINNLQQFKELMQQDNFSEIFNEMENTNYIKQILNG
CG16	Tery	    fig|203124.1.peg.1189_Trichodesmium erythraeum IMS101	NIGIVGLGLIGGSVGLDLRTLGYPVFGVSRREQTCQKAIALGAVDEASLELSLLSIADLIFICTPISYIIPTLEELIPFLSPSAILTDVGSVKVPIVEGVSKIWPNFVGGHPMAGKAESGIEFAQLGLFEDRPYVLTPNENTPLESVKKVEAIAKLLKSKVYFCDPYEHDRAVAWISHLPVMASSCLISACMSESNPTIVKLAREFASSGFHDTSRVGGGNPELGRMMAEHNCLEVLRSLISFRDEIDELIQYIERKDWQIIEEKLRYTEQNRRLF
CG23	Tfor_2	    No fig or gi#_Tannerella forsythensis ATCC 43037	KILILGAGKMGSFFTDLLSFDHEVAVLEQDPKRMRFIYNALRMQSVDEIDAFAPEMVINCVTLTHTLDAFRSVLPHLRPYCIISDIASVKTNLLEFYKDCGFPYVSTHPMFGPTFANLGNLMQENAIIISEGDHLGKIFFKDLYEKLKLNIFEYTFEEHDKVVAYSLGIPFASTFVFVATMVHQDAPGTTFRRHMKIARGVLSEDDYLLTEILFNPRTPGQIDRIQRELDELQKIIAERDTEAMRGYLARLRKKSTRES
CG17	Tfus	    fig|269800.4.peg.764_Thermobifida fusca (Thermomonospora fusca)	SAVVIGTGLIGTSIALALRQRGVDVALSDRDSAALELACELGAGTPLVEDLPEPADIAVVAVPPSAVPAALRDAQQRGLARVYTDVASVKTSVVRQAAELGCTMASYVPGHPMGGREKQGPSAARADLFLGRSWALCPTPQTDPVAVKTATLLAELCGANPLVVDETAHDRAVALVSHAPHAVSAAVAASLLDGDDTALALAGQGLRDMTRIAGGDVDLWREILSHNAGPVAAVLEQVAADLAAAAAALRTGTLDTVVDLLRRGRAGHARV
CG85	Tkod	    fig|69014.3.peg.6_Thermococcus kodakaraensis KOD1 (Pyrococcus kodakaraens)	RIGIAGYGRMGRLFERCLGGRFEVIFYSEHGRSDVGSLEELYLKSDVIMVASSLDTVPKRLERLAEISREHGGKKIVFDIATFKSRVVEAYAGFGEETRVASVHPMFGPGAKTIEGKRFITVPIPGREKDAEEVADFIRSIGGNVSFLDWKTHDRLMGFVIGVPYFIGLSYLSLSRELGLEEFGGTSWAFLETYGKAVLHDSPDFIREVLSMSREQIEEFLDFMRKNPPDPERLREKLEWEEIEEAYERFYRALE
CGO	Tmar	    fig|243274.1.peg.339_Thermotoga maritima MSB8	KISVLGAGCIGGSIALKLKEKHHVTAFDRDEETMKALEENGIETVSKESDLYDTDLLVLALPMSVEERFLKETDFSGKILDVASVKTPFMEIARERGLNFTGGHPMAGNERKGKSGWDREMFDGKIFFLCSLDGKEDGMIENIVKDLGARPLWIDYRIHDEIVAAVSHVQYLISLSARYVGKPFEEYAGPGYLSNTRLSKQNMEMALDMIRYNKENILKYLENARNFLNVLYHLTEKEDFENLKKVIREVIS 
CG20	Tten	    fig|273068.3.peg.479_Thermoanaerobacter tengcongensis MB4	KVAVVGLGLIGGSIAKALRKYTDIDVVGVDIDTKTLDKALREGTISEAFREINFALDVDALFICTPVGKIADSVKKIYPHLKKGCIITDVGSTKKVVMEEIEKFPPSDFYFIGGHPMAGTEKAGYDYSHPDLFVNSFYFLIPSSSVEEGILEIFVKEIIKKIGAKPVIVDYNEHDRIVGVISHVPHIVSTALSNFAHRECKDALKYAAGGFKDTTRIALSQTEMWKDIIFSNREVVLDLLRNYKNLLEEFVYHLERGDEEFLVDFLDKARECRKI
CG5	Ttep	    No fig or gi#_Thermochromatium tepidum RCTE01225	RLAIIGVGLIGGSLARALRAAGAVSEIIGCGRSLANLERALELGVVDRITQNPAEAVHEADMVFLAVPLGAMRGVLAAIRDQVRPEAIITDGGSVKCSVVEDARAVFGAVPPRLVPGHPIAGTEHSGVEASFAELYRQRRVILTPLPETDPEAVVQVTAMWEACGAEVATMSVAHHDEVLAVTNYLSYMLAFGLVHSLPPLLQSYEMFAYRIGGVPHSLRILSLFALLVHHRLSLHCTLTFLFLLSSLPPFSLTLFRSRAVS
CG22	Tthe_2	    fig|300852.3.peg.856_Thermus thermophilus HB8	KVGVFGVGLLGGSVALGIKERFLAEEVHAYDQDPMALEKVLFLGVADRVHTEVGPWVGELDLGILAAPVGALAELGKALAPWAHPESLWTDVGSVKAKVVAALEGLLPHYLGGHPMAGSERAGVENAHAGLLQNAVWVLTPTERTSPRAREGVRGLVEALGAYPLEMPPGRHDELVARVSHLPYLLAVALNRMVAQSPHRDLLMFLAAGGFRDLTRVASGSPRMSRDMVVENKEALKEAIEELREVLLELEGLLDEPEGLLRAAEEAKRTRDSLP
CG82	Tvol_2	    fig|273116.1.peg.1350_Thermoplasma volcanium GSS1	VGIIGKQGRLGRVLQAILDENGFDVVENNWDIAFLSVPIGAAISYIEKYDGPFIEVSSVKTPFKKYAGRIVSIHPLFGPASYKDGVHRTVLFIKDISMPEYRDLIAEMFRGYEIVDTTADVHDKEMAKSLALPYAVAIISKNIDTAFRTKSFDTFKGIVRILENENEEVMLDTINKNPYAQYMYDIVKNLGMVIQ
CG17	Twhi	    fig|218496.1.peg.55_Tropheryma whipplei TW08/27	YVHIIGAGLIGGSIALGLSRAGLKVSASDISPAAQRLSKLGDISIGPPNQNPDLVFVCTPPDVTAAEVVSSLDRFPETCVVDVSSVKTRIYREVLRKTHPAKRVFYIQSHPMAGREIGGIQGASADLFSGWPWIVCHSFVCGDGNDQMNGENSVHQKNYLTRNTEDEAEWSLGKNLLHCINLLGAFPVFMDRDRHDRSVAAVSHVPHILSSLIALSLANTDQGTVAICGSGIKDMTRLAASNPELWTQIIFSNRREILQSLGVFSGLLKRMLHTLEKLDNPAYRTDLFSQLAEAQAQQAR
CG98	Umay	    gi#71020197_Ustilago maydis 521	EIGIIGMGDMGRLYATKMRDAGWKKVNVCDRPENHEKLCKELQGSGLNVLRDGHLVSRRSDFIIYSVEAAFIDKVVEQYGSSTKIGSIVAGQTSVKAPEKAAFEKHLPQDTYIISCHSMHGPKIDPTGQPLILIQHRAPDEKMRLVERIMACFKSNFVYLTYEEHDTVTANTQAVTHAAFLSMGTAWCCSNQYPWESERYPGGIETVKINICLRIYSAKWHVYAGLALLNPAAKTQVTQFAQSCTDLFKLMVAEREQQLMDRVFAARKKVFGWEK
CG1	Vcho	    fig|243277.1.peg.686_Vibrio cholerae O1 biovar eltor str. N16961	VVIVGGNGQLGRLFGRMFKLSGYQVKVLGSQDWDKADELLSDAGLVVVTVPIHLTLGVIEKLRQLPDDCILCDLTSIKAKPLAAMLQVHKGPVVGLHPMFGPDVPSLAKQVIVYCDGRGNEHYQWLLQQFAIWGASLCQIDADEHDRGMTLIQALRHFTSFAYGLHLTKENPNLAQLLKLSSPIYRLELAMVGRLFGQDPHLYGDIILSSPENIEMIQRFHRCLSDAVELVSAGDKASFVAQFERVSQWFGDYSQQF 
CG1	Vfis	    fig|312309.3.peg.604_Vibrio fischeri ES114	IVVVGGNGQLGGLFAKMFKLSGYQVRILGSKDWDNSDEILDNAGMVVVTVPINLTIDVINKLSRLPEDCILCDLTSIKQKPLAAMMEVHKGPVVGLHPMFGPDVPSLAKQVIVMCDGRGKEHYSWLKNQFEIWGAIVRDISANEHDHGMTLIQALRHFTSFAYGQHLAKENPDIEQLLNLSSPIYRLELLMVGRLFAQDPNLYADIILSSDENIEMIKRFHQRFGDAISLLEEHNRSGFIKNFEEVEAWFGDYAEQF
CG1	Vpar_2	    fig|223926.1.peg.547_Vibrio parahaemolyticus RIMD 2210633	VVIIGGNGQLGGLFGRMFKLSGYQVKVLGSKDWGRADEILKDAGLVVVTVPIHLTEGVIEKLGNLPQDCILCDLTSIKSKPLQAMLNVHAGPVVGLHPMFGPDVPSLAKQVIVYCDGRGKEQYQWLLQQFGIWGASLCQIDAQEHDHGMTLIQALRHFTSFAYGMHLSKENPNIEQLLKLSSPIYRLELAMVGRLFGQDPNLYGDIILASQENIDMIKRFHQRFGEALAILDSKDKAKFVESFEQVSDWFGQYSQQF
CG27	Vspi	    no fig or gi#_Verrucomicrobium spinosum DSM 4136 	HIAVVGPGLLGGSMLMALRAGLPGAHLRAWARRPEAAVELTERGFADLASTKLDDVLNGVGLVVLCTPVETMPALAAEMVTLQSVVAPDCVVTDVGSVKETVVTALEDVFARSTYRFVGSHPMAGSERAGLEAARPDLFQRAACLITPTLFTAESALTTVRAFWSLLGGRVLEMSPEEHDRKVARISHLPHVAAAVTALAALHEDPSAAACAGNGFRDTTRVAAGDPALWTGILLENRQEVQASVRAARDLYNELLAILENVDDRALHHFLQNAKTLRDGV 
CG1	Vvul	    fig|216895.1.peg.466_Vibrio vulnificus CMCP6	VVIIGGHGQLGGLFARMFTLSGYQVKILGSKDWHLADEILDGAGLVVVTVPIHLTQGVIEKLTQLPSDCILCDLTSIKSKPLKTMLDVHSGPVVGLHPMFGPDVPSLAKQVIVYCDGRGAEQYQWLLQQFKIWGASLCQIEASEHDHGMTLIQALRHFTSFAYGMHLSQENPSLDKLLKLSSPIYRLELAMVGRLFAQDPNLYGDIILSSQENIDMIKRFHRRFGEALEMLDQHDKARFVERFTQVSDWFGGYSQQF
CG13	Wsuc	    fig|273121.1.peg.325_Wolinella succinogenes DSM 1740	QAGIIGLGLMGGSMGLALKETKMFKTVVGMDASPIHTQQALFLGLVDECVTMEEMRECDVIFLAIPVDSIIETLQKLPPLAPHVTVIDLGSTKRKIVESVPSSIRRNFVPAHPMCGTENFGPKAAFKELYQNRIVVLTDIEGSGEFQRALAKEIFIRIGMNIVKMDSASHDRHAAFISHLPHIISYALANTVLSQEDPQSILALAAGGFRDMSRIAQSSARMWTDVSKQNKEELLQTIDFFGKEMILAEQLIKEERWEELYEWMEKANTLHHIL
CG4	Xaxo	    fig|190486.1.peg.1502_Xanthomonas axonopodis pv. citri str. 306	VGIVGIAGAYGRWLAQFLRTRMQLEVIGSDPADSDSMDEATLAQRADVLMFAAPIRHTAALIERYVELTGARAAAQLWLDVTSIKQAPVAAMLTSQADVVGLHPMTAPPKSPTLKGRVMVVCQARLRHWSGWVQSLCSALQAECVYATPEHHDRVMALVQAMVHATHLAQAGTLRDYAPLLGELRALMPYRSASFELDTAVIARILSLNPSIYEDIQFGNPYVGEMLDRLLLQLQQLRALVGQGDDAARAQFRTQFLHDNAQALQHDA
CG4	Xcam	    fig|190485.1.peg.1454_Xanthomonas campestris pv. campestris str. ATCC 33913	VGIVGIAGAYGRWLAQFLRTRMGLEVIGVDPALPDGLDDATLVARADVLIFSAPIRHTAALIERYAALAGARAAEQLWLDVTSIKQAPVAAMLASQAEVVGLHPMTAPPKSPTLKGRVMVVCRARVQRWSGWVDALCSALQAECVYATPEHHDRVMALVQAMVHATHLAQAGTLRDYAPLLGELRTLMPYRSASFELDTAVIARILSLNPSIYEDIQFGNPYVAEMLDRLLAQLQELRGLVVQGDDAARLRFRQAFLDANAQALQHDA
CG4	Xfas	    fig|160492.1.peg.2324_Xylella fastidiosa 9a5c	VGIVGSAGAYGHWLGRFLRERMGLKVIGYDPADPASLSPAELLRCADVLVFSVPIRQTAALIGEYVAMADGTDAGQLWIDVTSIKQAPVEAMLASQAEVVGLHPMTAPPKAPTLKGRVLVVCEARLHHWRPWLMQLCEALEAECVAATPEHHDRLMALVQAMVHACHLAQAGVLRDYLPLLGEFQSIMSFRSMSFELDMAMIARILSLNPSIYEDIQFGNSYVLEMLDHLLSHLLELRALVSCGDDAARTRFRADFLEANHQVFGEQA
CG4	Xory	    fig|291331.3.peg.4549_Xanthomonas oryzae pv. oryzae KACC10331	VGIVGIAGAYGRWLAQFLRTRMQLEVIGFDPADSGSTDEATLAQHADVLIFAAPIRHTGALIERYVELAGARAASQLWLDVTSIKQTPVAAMLTSHAEVVGLHPMTAPPKSPTLKGRVMVVCQARLQHWAAWVQSLCDALQAECVYAAPEHHDRVMALVQAMVHATHLAQAGTLRDYVPLLGELRALMPYRSASFELDTAVIARILSLNPSIYEDIQFGNPYVGEMLDRLLLQLQQLRALVAQGDDAARAQFRTQFLHDNAQALQHDA
CG1	Yent	    fig|630.2.peg.825_Yersinia enterocolitica 8081	VVIIGGEGQMGRLFSRMLTLSGYQVKTLEQQDWAQAESILADAGMVIVSVPIHITEEVIARLPKLPSDCILLDLASVKNKPLQAMLAVHEGPVVGLHPMFGPDVGSLAKQVVVYCDGRDPEAYQWLLEQLQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSEDNLALIKRYYKRFGEAITLLEQSDKQAFVQSFQKVEHWFGDYAERF
CG98	Ylip	    gi#50556274_Yarrowia lipolytica	LVGVIGMGDMGRLFANHWNSQGWKVLACDQESHYEKLKEEFADSEIEIVQNGHYVSRKCDYILYCVEAENIGKIVSIYGPSTKVGSIVGGQTSCKAPEMAAFEAHLPSDVDIISCHSLHGPKVNPEGMPLVIIRHRNTEEWKFEFVQSLLESLKSKIVYLSAEQHDKITADTQAVTHAAFLTMGKAWQANGQYPWQISRWIGGLENAKMNISLRIYSNKWHVYAGLAISNPAAKVQIQQYASSAGDLYKLMITGKEQELLDRLTAARDFVFGGLK
CG1	Ypes	    fig|214092.1.peg.3269_Yersinia pestis CO92	VVIIGGQGQMGRLFSRMLNLSGYQVRTLEQEDWSQAESILADAGMVIVSVPIHITEEVINRLPKLPADCILLDLASVKNKPLQAMLAAHEGPVLGLHPMFGPDVGSLAKQVVVYCDGRDPQAYQWLLEQLQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSEDNLALIKRYYKRFGEALTLLEHHDKQAFVQSFEKVEHWFGDYAERF
CG1	Ypse	    fig|273123.1.peg.967_Yersinia pseudotuberculosis IP 32953	VVIIGGQGQMGRLFSRMLNLSGYQVRTLEQEDWSQAESILADAGMVIVSVPIHITEEVINRLPKLPADCILLDLASVKNKPLQAMLAAHEGPVLGLHPMFGPDVGSLAKQVVVYCDGRDPQAYQWLLEQLQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSEDNLALIKRYYKRFGEALTLLEHHDKQAFVQSFEKVEHWFGDYAERF
CG12	Zmob	    fig|264203.3.peg.916_Zymomonas mobilis subsp. mobilis ZM4	HIAIIGLGLIGSSAARATKAYCPDVTVSLYDKSEFVCDRARALNLGDNVTDDIQDAVREADLVLLCVPVRAMGIVAAAMAPALKKDVIICDTGSVKVSVIKTLQDNLPNHIIVPSHPLAGTENNGPDAGFAELFQDHPVILTPDAHTPAQAIAYIADYWEEIGGRINLMSAEHHDHVLALTSHLPHVIAYQLIGMVSGYEKKSRTPIMRYSAGSFRDATRVAASEPRLWQDIMLENAPALLPVLDHFIADLKKLRTAIASQDEDYLLEHFKESQKARLALK

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3