[Bio] / FigWebPages / ask_cg_representatives.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_cg_representatives.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Scer_Aa_|_CG-01
MPMDFQPTSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYT
KAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELEL
VKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA
SALDNSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALI
AVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVI
RAKIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKN
DIFVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQ
AEEKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINI
SCVINESDSIKALQCIHAKLLSERTNTSNQFEHAIDERLEQLKRLGI
>Hnep_Aa_|_CG-02
MKRTVEKIGGTSISNTQVVLENVLIGGRKGADLYNRIFVVSAYSGMTNRLLEHKKSGEPG
VFSLFAGAGNKWAWTEALASVAEAMEAKNAEMFSGEPEQAVADNFVRERIEDVRNCLIDL
HRLCSYGQFRLDENLTTVKEVLSSLGEAHSAFNTALLLQKHGVNARAVDLTAWRDERDLT
MEERMEDALGGIDLSSELPIVTGYASSRDGLVRQFGRGYTEVTFSRLAAFVQADEAIIHK
EFHLSSADPNLVGQDRVRKIGLTNFDVADQLSNMGMEAVHPKAAKILRQAGIPLRVKNTF
DPKDGGTVISADYAPENPRAEIVTGLKGVFALEVFDQDMVGEKGYDSTILDALTRHSIRI
VSKCSNANTITHYIEGSRKALKRATADIETKLPGAEVSTSRVAIVSVIGADINVPGITAK
ALTALHEAEVPIIGLHQVSRKTDIQAVIQEDDFDKAICALHEALVEQVSVATPRAEALRP
AA
>Lcas_Aa_|_CG-03
MKVVKFGGSSVADAGQFQKVKAIIDQDVNRQIVVISAAGKYGNATRKLTDTLYLIADGME
AGRDVEPLFNQVLARLEAINIALQLNVPLIKLLHTIRHHLAIRYSRDYLVSRGEFLTAHL
MAAYLGYTFVDAANLLFFNKAGAIDEAKTQTAYQQLASQHGIVVPGFYGRDADGHVKLMP
RGGSDISGAWLARLAHADLYENWTDVSGIKMADPRIIKDADSIDVMSYDELRELTYMGFS
VFQEEAVQPVRECGIPTRILNTNAPEVPGTLIIHDDDPANDLKTITGIAGRKHYLVITVR
KYQLALHLEVIQHALGVVAAHHLVVDYLPTGIDSFSLLIREPRRQVSVQELTAEIAAACQ
PDKMEVTENVALIAMVSRKLRQRPAIAGKVLAYLDDNLLNVQLVSQTNDDINLLIGVHDL
DYDKAVRVIYSSIHQNFQRPAPYIEGIA
>Sglo_Ab_|_AK/_HDh_|_CG-04
MRVLKFGGTSVANAERFIRVADILESNSRQGQVAAVLSAPAKITNHLVAMIDRTLNGSDI
QPNILDAEQIFSRLLDGLAAAQPEFDHAALRSVVEQEFAQLKQLLHGISLLKYCPDNVNA
AIICRGEKLSIALMEALLRARGFGVTVIDPVAKLLAQGGYLESTVDIAESTRHINDAAIP
ADHIILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPHQV
PDVRLLSQLSYQEAMELSYFGAKVLHPRTIVPIAQFQIPCLIKNTTNPQAPGTLIGPTSG
EEGNPVKGITHLNNMAMINVFGPGMKEMIGMAARVFAAMSRAGSSVVLITQSSSEYSISF
CVPQHELAGARRALEEEFYLELKDGLLEPLDVISRLAIISVVGDGMRAQRGLSAKLFVAL
ACANINIIAIAQGSSERSISVVVDNDSTTTGVRVAHQMLFNTDQVIEVFVI
>Bfra_Ab_|_AK/_HDh_|_CG-05
MKVMKFGGTSVGSVNSILSVKKIVESAGEPVIVVVSALGGITDQLISTSRMAAMGDAAYE
GAYREIVRRHEEMVQGVIPAGETQTLLHYQVNELLDELKDIFQGIYLIKDLSPKTSDTIV
SYGERLSSLIASRLIQGAVWFDSRTFIKTEKKHNKHTLDTELTNRLVREAFKEIPRVSLV
PGFISSDKVSGDVTNLGRGGSDYTAAVIAAALDADSLEIWTDVDGFMTADPRVISTAYTI
SELTYVEATELCNFGAKVVYPPTIYPVCHKNIPILIKNTFNPDAQGTVIKQHVDHTKSKA
IKGISSINDTSLITVQGLGMVGVIGVNYRIFKALAKNGISVFLVSQASSENSTSIGVRNA
DADLACEVLNEEFAKEIEMGEISPIQAEKNLATVAIVGENMKHTPGIAGKLFGTLGRNGI
NVIACAQGASETNISFVVDSKSLRKSLNVIHDSFFLSEYQVLNLFIC
>Fjoh_Aa_|_CG-06
MRVFKFGGASVKDAEGIKNVYDVLQKVGYEDVILVVSAMGKTTNALEVVIKNYFEKSEEL
NSSVQEIKNYHFQIVLDLFKDEKHEVFAAVNAQFAELEYFLAHNKSPNYNFVYDQVVSFG
ELISTNILSHFMNFMGIQTQWLDVRNFIKTNANYRDAEVDWETTEQNISKNVPRKQLNIT
QGFLGADENNFTTTLGREGSDYTAGIFAYCLNAESVTIWKDVPGVMNADPRYFENASLLN
QISYREAIELAFYGATVIHPKTLQPLQKKEIPLYVKSFINPLLKGTCVSKGVDLEPQYPC
FIVKREQLLISLSSIDFSFIMEENISEIFGLFHEFKIKVNLIQNSAISFSVCVEDKFGNF
NDLNAILSKKFKVEYSENVTLYTIRHFTEQAAEMVEKNKEVLLKQVSRETMQIVTKELN
>Srub_Ac_|_CG-07
MESSAPASANWRVHKFGGTSLADPARIRHVADLLGARTPPVAVVVSAMSGVTDRLLALAE
KAHTDADGLADRLQSLRDDQRAVVTDLLDGDAAASVLRTLDQDLDDLADVLRATRLMGTA
PDTTRDLVAGYGELWSARVLGGVLRDRGLSAAVCDAREVLVVTHEEMGPVVDWDATQERF
ADWRAAHDAPDTIVATGFIATTPDGVPTTLGRNGSDHSAALFAALLEAEALTIWTDTDGV
MSADPQYVPDARRLDGLSYEEAMEMAYFGAGVIHPRTLSPAVEHEIPITIRNTFAPDRPG
TRIHLNDDGASVVKGFSTIDDVALLNLEGSGMIGVPGIARRLFDALEDEGVSVILISQGS
SEHSICFAVPQAQAEVAREAAEHAFYAELDRGQLRTVELVPNCSILAVVGDQMAGTPGVA
ATFFGALGEASVNVRAVAQGSSERNISAVVDRDDARRALRAAHAGFYLSKRTLSIGVI
>Ahyd_Ad_|_AK/_HDh_|_CG-08
MATEAGLKRRHVHKFGGSSLADPVCYRRVASILEQQAEQQGGGRELVVVSAAGKTTNRLI
QLVELAEAGDEAAGEAISALQAYQQSLIDGLLEGELHLELSQQLADDMQLIAKTLEGQFD
RFERNGLLAFGEVWSARLLAALLTSRGDKAIWLDARSFLRAEDGALVKVDTALSSELLKA
RLAEHAGRIVVTGFIAADMEGRSLLLGRNGSDYSASLLALLADGESTTIWSDVAGVYSAD
PRRVKEARLLERLSLAEANELARLGSSVLHSRTLQPVADSRQRLTLRCSYNPDEGCTHIL
RRAPRSGGARIVSSVDQIALIELKVLPQTHYEQTVAAIEAHLARHRLNPLTLQRQPDRRI
LRLAYTLEVAQGAFELLRDFQLQGSFTGLIQREGYSLVALVGAGVTDNAEQCHRFYQLLA
DQPLEFVQVAKDGLSLVAVLRQVVLEPLLIALHSALFSRPNRVGLVVF
>Srub_Ad_|_AK/_DAP_|_CG-09
MMPASGRPWVVCKFGGTSVSSRARWDTIVEVVRTHRAEGRAPFLVCSALQGISDQLEALC
AQLASAEPGAPESTLNTIRERHRALGQDLGVEAEAVLSGEFARLERWVDEIQATDGPSPR
QRAAVLATGELLSTRLGAAYLSAQGLPAEWLDAREFLRATDDPHLPPRRQYLAANCTSHA
DPGLQARLADAPETVYLTQGFIASNALDETVLLGRGGSDTSAAHFAAKLEAERTEVWTDV
PGLFTANPGEVPSGRLLRRLDYDEAQELATMGARVLHPRCLDPARRHQIPLHVRSTEAPS
LDGTIVSGEGPDVGPQVKAISAKTDITAVSMDTLGMWQEVGFLADVFQVFKHHGLSVDLM
ATSESNVTVTLDPVANALDPDILDRLLHDLNRYCDAELIDPCAIVSLVGRHIRSLLSELG
PAFEVFDEQKVHLVTQAASDLNMSFVVDEDQASRLVRELHAQFFGHRAPDAVFGPRWQEL
VEDGTPEETPDVWWRER
>Ctep_Aa_|_CG-10
MVVMKFGGTSVGSAAAMRQVIANVAEKKKSSAPLVVLSACSGITNKLIQIADAAGSGCLE
EAQQLVGEVRQFHLDLIGELIESEELQQEVIAKIEVYLTRLERLTEGIEIVGELTERSKD
RFCSFGELLSTSVFAAALNEAGVSCKWIDVRTVMITDDRFGFARPLAEICQKNTSEIIKP
LLDAGTVVVTQGYIGATESGRTTTLGRGGSDLSAALFGAWLHSESIEIWTDVDGVMTTDP
RIVPEAKSIRVMTFSEAAELAYLGAKVLHPDTIAPAVQKNIPVYVLNTWHPDSKGTLITN
DPELLAGKSHGGLVKSIAVKKAQAILNIRSNRMFGRHGFMSELFDVFERFGISVEMISTS
EVSVSLTVDDAVVSEPLIKALGALGEVEIEHKVATVSVVGDNLRMSKGVAGRIFNSLRNV
NLRMISQGASEINVGVVVDESDVQAAVASLHCEFFAESQCDAIFEKPAGS
>Gfor_Ab_|_CG-11
MKVLKFGGTSVGSAVSIRNVKEIISNLPGDKLLVLSAMSGVTNQLVEISEFVKTGSLDQV
SEKIQALKAKHFSLIDELVPDKTSNQSIKDHIVLQLEELVEICQVQPWSNEVDAKIITTG
ERLLTSIFSSYLKFEEVANTLLDARKFMKIHNLENPDTGLVGELLNDTLKSSFESNILIT
QGFVRLNAQNEVSTLKRGGSDYTATILGAAIRAAEIQIWTDISGLHNNDPRFVENTHAVS
QLSFEEAAELAYFGAKILHPQTISPVIGKNIPVYLKNTFTPEATGTCISALAERKGLKAI
SAKDEITAIKIKSNRMLMAHGFLKKIFEVFDTYETSIDMITTSEIAISLTIDNTANLDLI
LQELDQYGEISVDASHSIICVVGEGLIEDRGTSRLFEILQDVPIRMISYGGSSNNISLLV
DTRNKIEVLQKLNEKLFVNQLKSV
>Susi_Aa_|_CG-12
MIVMKFGGTSVESAAAIERVAGIVRAREARRPVVVVSAMGKTTNKLLAIASAAIAGKRNE
YIPQLHDLRDYHSREARLVVPLSERAELDRFLDEHFQELTELVKGLAVLGELTPRSIDAI
SSYGERLSSYIVTLAFRHFGMAAEHIDSRDVIITDRRHTQAAPNFPETYARLQKTIPPLA
AQSVVVMGGFIGSTEDGVTSTLGRGGSDFTAAIVGAGIQAEEIQIWTDVDGMLTADPTIL
AGGHRVKTISFAEAAELAYFGAKVLHPATVVPAIEKNIPVMILNSRRPEVPGTHITAHTV
HCENAVKSIACKRKITTVSIHSTRMLMAHGFLHRIFEIFDRYQTPVDMVATSEVSVSLTI
DNTTHIDLVLGELRQFAEATVEHDSVIVCLVGENIRHTPGVARRVFNSLDGINIRMISQG
ASLLNISFVIAETDLVNAVRLLHEEFFATLDPNVFERKEAVHA
>Atha_b_|_CG-13
EKKTEAITEVDEKGITCVMKFGGSSVASAERMKEVADLILTFPEESPVIVLSAMGKTTNN
LLLAGEKAVSCGVSNASEIEELSIIKELHIRTVKELNIDPSVILTYLEELEQLLKGIAMM
KELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDDFTNGDILEATY
PAVAKRLYDDWMHDPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIGKALGLKEIQVW
KDVDGVLTCDPTIYKRATPVPYLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSY
NPKAPGTIITKTRDMTKSILTSIVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISV
DVVATSEVSISLTLDPSKLWSRELIQQELDHVVEELEKIAVVNLLKGRAIISLIGNVQHS
SLILERAFHVLYTKGVNVQMISQGASKVNISFIVNEAEAEGCVQALHKSFFESGDLSELL
IQPRLGNGSPVRTLQVEN
>Umet_Aa_|_CG-14
MRLVMKFGGTSVGDGARIRNVARLVKGYQDQGNEVIAVASAMTGVTDKLYEMAQVAKDTC
STSDVEKRFGELAKRHETAIHDAIQDQGIRQEVSAEIERRLSELKNALVGVCYLGELTNR
SLAYIYSFGERMSVPILSGALRDLGAKSKPFTGGEAGVITDSRYESARPDPITDIKVREK
LLPLLQEGVIPAVTGFVAADSRGIITVLGRGGSDYSASIIGAAVDADEIWVYTDVNGIMT
TDPRIVPEAKTLPVVTYLEAMEMSYFGAKVLHPKTIEPAVKKGIPVRVLNTFQPDHPGTV
VLMKDNSANCAPIKAVTMIKNIGLVNISGAGLSGTPGIAGKIFSVLGKEDINIIMISQAS
SEFNVSMAIDGAQVDKAIAALRREFNGEIERDLTCDNNVCVVAVVGAGMAGSPGTAGKIF
TALGKSGVNIRMISQGSSEANISFVINKEDAQRAVKILHDEFELHNL
>Mmar-6_Aa_|_CG-15
MKFGGTSVGEADCIGRVADIVESHRSAGDEVAVVVSACSGITDRIIAVADEVIASKEQPD
IGTLLDAMRERHTRLLKETAPDHAREVTAVIDDRLTRLQNILTAVHTLKELTPRSRDYIV
SFGERLSAPIVAAALRQRGIASVALDGAEAGITTTANHGDARALPVSAENIRARVAPLLA
DAVPVIMGFMGATEQGVITTLGRSGSDYSAAVIGAGVDADEIWIWTDVDGVMTSDPRIIP
DARVLDDISYLEVMELSYFGAKVLHPRSIEPAMQKDIPIRVKNSFKPEVPGTLVLRDKHQ
EKRVVKAIALIEKVALVNINGAQMVGRPGVAKTIFSALAEREVNVMMISQGSSEANISLI
IDESHLDAALGALDPLVEQGIVREVTYDHDVAAVAVVGAGMAGTPGTGGRIFSAIGRAGI
NMMMISQGSSEVNVSFVVKAGDGKRALQVLHDEFRLSENSDD
>Mjan_Aa_|_CG-16
MTTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVR
DIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPK
SRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLP
LLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDP
RLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITN
DMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETN
ISLVVSEEDVDKALKALKREFGDFGKKSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGI
AGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEKTNS
>Dgeo_Aa_|_CG-17
MAYSLLVMKFGGTNMQDAQAIRHSASLAARSIREGVKVVVVVSAMAGVTNQLLGLADAAQ
RGDIATANDEIAALRTRHFAAAQELGAAPDSEVVREIRELHETLRQAVYGVYLLRELTPR
SRDLIVAFGERFSAPLMRLALEGQGLLAHHLTGGQAGITTDTHFGNARPLPGTYERIRDR
LGGLLAAGVTPVVAGFMGETEEGAITTLGRGGTDFSATIIGKALDADEVWAWKDVDGVMS
ADPRVVPDARNIEVLSYGEVMELAYFGAKVLHPLAVTPLQESGIPLRVKSAADPDFPGTL
VQEGAHNEAGHPVKAVTAIRRVSIINVTGAGVLGVPEVVASLFEAIARENITLLMVSQSS
SMSNVSLAVQSADAARTLDALRRRVTGELNIEEQPGVAVLAIVGAGMRGQKGVAARLFGA
LAAADVNILMISQGSSELNISVALEDAQVERATRAVHAAFGLGQTAAAAD
>Tkod_Aa_|_CG-18
VVKFGGTSVRDDFREAVTFVSRLWDENEVALVVSAIKGVTDALLKFSRTGEGFEWIEKVH
RDFAKKYGIPFETLAAPLRELKKLSREDFPSFEAYRDHVLSYGEWLSGLAFAEALRREGI
QVELFEPWEILETDGNFGNARVDIAKTSRNLKVVEEALERGRVAVVPGFVGSYNGLRTTL
GREGSDYTAAVLGKGLKARAVLIMSGVDGIYTADPRRVVSARLIPFVSYDELYVASKAGM
KAIHHGAIDVVRGIPIIFGRTRDWSIGTIAGYESSSLPILVHRVAGEEAVITAVGVAEVP
GFDGENGSELGIPLVRLTVPSARLGSTLNLIHLRLIADRISPPRALSIIRGGVSAGNV
>Aper_Aa_|_CG-19
VVGCAPNDLVVVKFGGSVLNGSPGFLAAGRLVLGLLESGLEPVVVVSAVKGVTDALLSSF
ERRDPGVGGAVGKTYLSIARELGLPPESVRDVSLASAEVSKLLWAAEVLGQWTPRVRDLV
VSYGERLSAALMAGLLRRLGVEARWLGGGEAGIVTDGEFGDATPLYGYTEGVIRERLEPM
LEEGVVPVVAGFTGATREGDTTLLGRGGSDLTATLLASALGAGRVVLYTDVPGILSGDPR
VVGEPRRVGYMSYEEAWEVARLGLRKFHPRTFEPLIAGGLGVEVVVSDLRGRSTRIGPGR
GGPPLKVVSLSRGVARLVVRGPSMAGKRGFLSRLAGLLAGRGVNILAIRQPPSETAIELV
VDERDLPAAVEELGARSGAAGVRLEVERGFDVVSIVGWGAVEALPEALSAAEKTGGRLLS
TGELSPSISILARGRTSPELARLLHRRVVESWVTG
>Msed_Aa_|_CG-20
MLVVKIGGSIQKDERDFELIANRISQYSSRDRTIVVTSALKGVTNSLIEATENRDKAVEI
VSEIYDRHVKLLSKIVDGPEFDNAFKSISKLADELFRIAWSIKVLDEISARVRDYILSFG
ERMASVTLGAMLRSRKMDAQSYPEPLLVTDDSFGEANVIEDLSAMEARKVLDIPSKIVVV
PGFIGKTPTERYTTVGRGGSDYTATLLGKLLGFPEVRLVTEVPGIMTADPRKFPGAKTIS
RLSLEEAMELAQMGAKRLHPRTFEPMFDRDIRVYIEGLYDEGYTLVQGTCDSSDKLKGIA
VLDDLKLISVESTNIVGKIGSAARVMEKAREAGVNIISLSQPASETTIHIVVDSKNAERL
SSRLQELRDVDSINVQDASAVSVVGCGLRNKELFREVLREASSFEVASISRGLRNVSATF
VVKKDEGFNLAKDLHEVVVKWIN
>Ecol_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Ctra_Aa_|_CG-22
MLRQETAPLVCKFGGTSVGTAQSIRRVCEIIQEERPSFVVVSAVAGVTDWLEEFCRLPKG
KRAALTEKIRERHESIAKELGIEVSLAIFWEILEHFEDVEELFSEDQARILAIGEDLSST
LICSYCCTYVLPLKRLEARQVILTDSQFLRAVPDLALMQTAWGELALQEDTIYLMQGFLG
ATSSGKTTVLGRGGSDFSASLIGELCKARELRIYTDVCGVHTADPKILKDTQLIDSLTFE
EMQELASSGAKVLHQDMLKPCVRAKVPIFVTSTFNVTKEGTWICASLNESTEGPVIKALS
LKSNQALWFVEYNSPLVRLEDVLGCVRSLGFVPGVVMAQSLGVYFTIDWEEYPQTITKAL
EAFGTVSCEGPLSLVALVGAKLASWSMSRVFEALHRTPVLCWSQTDTVINLIINKDFGVA
VTELLHDCLFK
>Srub_Ab_|_CG-47
MPDRSFSSTECASRPVRVLKFGGTSVGSADGIKNAVRLVHAATETCRPVVVVSAAAGVTD
ALVQAAEESRADRGSVEAWTRRVGRRYRALAANTLADEALRARYDTALRTELSELRRALQ
EMAGPNAAAARDVVLAAGERLMVPLLAAALDASGCTSQAVDAATLIRTDAAHGDATVQWA
PTRRQVRDWHRTRAAGLPVVTGFVGETADGKTTTLGRGGSDLSAAVLAWALAAERMERWT
DVEGLYTRDPDAHSDAQPLQRIDFEQARAWTKAGRLGMHPCTLDPLMDAGIPLRVRCTHR
PAAPGTRIVPAPTLAQG
>Nmar_Aa_|_CG-49
MTKLVVAKFGGSAIGPNGVSIPEIIQRITNLKQDSKVIAVFSAPLTLDNGKKRSLTDVML
EQGRNAENGVTPSLDIIKSTYEKILELVDDENKGKCENVIEQNLEKAKKALDEAFESKEF
VDEVRSRALAFSGEILMSHVMNYILRSNKIKAETVDFEDWPIITDNNIESTNFLTSESRT
KMDKTAELVEQNEVVTIGGFIGKTVDNVTTTYERGGSDRTAADLGILFHKSYETSIDFEK
DSAVVSADPKIVESGLREVHQLSYNEARLAGMFGMKILDPIAIKEIVENGVDMPITVTNM
KNPDKITTIKRILDEQKGHPIKIVTGKENCAIFRIETNSIQKLLTSLDKDKRYSEFVILS
PFTKDGIEFSRILFLDGDYVKRNEKYLLGFDSLATITYNRGVITLIGDEMWRVQQVASRT
SAKIGEAGLNILNMDAQEETSRIIIVVEDTKDNIRKAISAIHQEISEINFI
>Nmar_Ab_|_CG-50
MRLVIKYGGTSISSAKDIRAVANHLNSLSKKNQIVVVCSATSGTTDDLIEISQSIKKENK
SKAEQLASKITNRHKQLAKQTIKKADLRKKLLKNFDDDFAELVALIDGMVLLGEVTPRTM
DYLFSFGERLSIKLVSMAVNDSGKKSVPLTGKEVGIVTDSNFGESKPLIDTTRLRVSKNV
ENLFSKKTVPVVGGFVGADQHGHVTTFGRGGSDYSATIIGTCIKADEIWLMSDVDGLMTA
DPKIVKNAKLLKEVSYIEAIEMALFGAKQIHPRTFEPLLSKKIPMKIRSSFNLKNEGTLV
TASPSPSVKNTVKCVSNVRNNGLIDIQGGSMVGTPGTAAKIFATLAKAGINVMMISQNPS
ESSITIVVKNADLDKAVSSLEMELLGKIIKKLEVTTNVAIIALIGSGMRGTVGVASKVFG
AAEKNKVNVSMITQGSSELNLAFVVKNSDTNAAVRALHNAFALDKIN
>Mkan_Ab_|_Orp
MRVVMKFGGTSVGTGESIRKVAKIVTDAAEEHEVIVVVSAMSGVTDELVRAAESAPDWTE
EDVKNFVGKLRRRHGKAASEAISSDLIRREVMGYVDSLLEELEKVLLGLSYVGEVTPRSM
DLILSFGERMSAPIVAGALRDRGLEAEHLEGGEAGVITDDGFGEAEPILPACRRKAQKTL
IPMIESGKIPVITGFIGRTIDGEVTTLGRGGSDYSAAIIGCISEADEVQIWTDVDGVMTA
NPNLVPDARTVPRLSYEEAMELASFGAEVLHPKTVIPARSENIPIRVKNTFNPESEGTLI
TSESEPSEQVVKAVASSSDVGMIDIRGTTMIGRPGVAGRIFSRLGDEGINVIMISQSASE
SNISIVVSRPEVRRAARIIEREFVGERVVERVTTYEDVAVVAVVGEGMRGTPGVASRVFR
AVADAGVNIKTISQGASEVNISFVVAEEDEAAAVNAVHSEFELGEEA
>Susi_Ab_|_Orp
MKDLLVMKFGGTSVGSAERMKVAAQLAAQEQKKRPVAIVVSAMSKVTDLLLDTMRHAEAG
DRAGMERNLNLLRERHEQACRELLPASEQGAVLAKLHDVIDEFERIVNGMAMLGERPPRS
VDEAVAVGERLTVVLVSEHLRVSGTPSVAVNARDVVVTDAVFGNASPLMEPTRVKARATL
RPQLEQGLLPVITGFNGATADGRPTTLGRGGSDFSASIVAAALDASELWIWTDVDGIMSA
DPRLVPDAQVLEEITYAEAAELAYNGAKVLHPRTLAPLVEKAIPVWSKNSFAPEKPGTKI
VPSMAVEHGARAVASMRNVALVSLTPASPEVNGVQVLARALEAIARADVEVLVLTSSSYR
QNFCVLVREDELDRSVQALESALALELAHHYVHPIEVDRNVGLLAAVGEGMQGKPGLAGR
IFTAISRVQVNIIAIAQGSSELTIAVVVRREGLEKAVKAVHAECGLGMRPPVPVFPFGAS
EGRAQRPTKR
>Mxan_Ac_|_AK/_HDh_|_Orp
MRVMKFGGTSVGNAERMRGVADLAAAARKQTRVMMVASAVSGITNLLLEAARAAQEGQPV
ESLHGRFEDVHRGIIRELAPELGEARQRSLEEGLSTLASELRGLLQGVGLLRECSPSVLA
HLSGLGERAACLILGALMHARGLEPHAVEPRDVILCAGDPLQATPLQEETRARFTPLREA
GGPGLMLMPGFFGGDTRGKTMCLGRGGSDYSAALAAAALDAELLEIWTDVDGIFSADPRL
VPEAFPLPEVSFEEAMELAYFGAKVLHPKTIAPARERGIPVRVCNSFRPDHPGTRVTDDA
APPEHPVRGLSFLPGIALVNLGGAGLKGVPGTAARVFESMALANISVVLITQGSSECSIS
FCVQQADAERAVQALEVAFEMERAAGKVDTIEQQRGLAVLSIVGDGMRHRVGVAGTFFSA
LADVGCSIAAIAQGSSERSISAVIAETDGPRALAHVHGRCFGTTEVVELLLA
>Mxan_Ad_|_AK/_HDh_|_Orp
MMKFGGTSVGSPTRLRQVVELIGKHARQGPLAVVVSAMGDTTDWLLDAAHLATEGDLEGA
LAVATRIADLAKANAAALAPGQATALAERVDGLLAPLRQLLHGVSLTRECSAPTRDRVLS
FGELVSATLLAELLTAHRTPATFRDARQLLVTDDRFGAARVDLVRTRERLQAARETWGVE
VPVLPGFIAATPDGRTTTLGRNGSDYTAALVAQGLGASEVTVWTDVLGLHTADPELVTDA
YPVAHLTHGEGLELAAVGARMLHPRTMIPLIESGISLRIRNTMEPEHPGTLIDAIGSRDG
QRPACIATREDLALLGIEVRKLSDQFQLGERVLAALREARVTVWMTAQSANGQSLAVVVP
RPDAEHARSVLVTELAQELSRREVEPLEVRQPVTLLTLVAETMGHGVNVAGRFFSALGAV
GVNVRASAQGASSRSLSCVVDAADTAVAARTTHAAFNLAHQQVSLFVL
>ROSE-4a_|_Orp
MPLLVMKFGGTSVGDAAAIQAVAAITEAQRAAWGRVVLVVSAMSGVTDMLIRGATTAASG
DKHTFRDLDRMLREKHAAALAELVPDDQERTAIDDQIARLIDEFSILCHSVAVLGELSPR
AIDAISSLGERMSVRVVAAALRARGIPAEALDASEFVVTTAHFGDARPLQEVTRERTRAR
ILPLLGRGIVPVITGFIGATEQGVTTTLGRGGSDYSGAIIGAALDADEVDIYTDVDGVMT
TDPRLAPDARVIPVLSYAEMGELAYFGAKVLHPRTIRPIVERGIPLRVRNTFNPYHPGTL
VVQDVESNGQTVKAVTAIRNLSLVTVEGRGMIGVPGVAARTFGAVASVGANVLMISQASS
EQSICFVVPSSTIPQVTYALEHNLAMELARRDIDRIWAREDVAIVTAVGAGMRDTPGVAA
RVFGALADNHINVIAIAQGSSECSISTVVAAADCDAAVRAVHRLTGV
>Rxyl_Aa_|_Orp
MSSAEPLVIKFGGTSVGDGEGFARAARITAGAAAEGRPVAAVVSAMSGVTDALLAAAAGT
ATAGTRTARGLARDLRRALGERHLAAARCAVSGDLLPEVEARVLSLLDRLEEELARRALP
EAERRAEIAVCGERLSAEILAGALRAAGAPAAVAADPIATGPGGEEVLSEETRARCTRHV
RPLLEEGLVAVVPGYAGRSPDGAVTTLGRGGSDLSATALGRGIGAGEVWIMTDVDGVLDA
DPRLVPGAATLPRLSYREAGAFAALGAEVLHPRTMEPAAAAGIEVLVRNTFDPHSPGTRI
SARECGPGLRALALRRGLSVEPLEALDGRSGDVFCLLGADVYGIRALVERPSGSAAAVIG
VGSPGDEELAAGLRRLHRAGIRPLWAGNTAAGLAFVVAGSRAEEALRELHAALLRREALA
GEAVA
>ROSE-4b_|_Orp
MVVMKFGAVAVSDASRVNDLVRIVRHAIDEGEAVVVVCTAIADLTNLLIGAGRAAARGNL
TAAEQARRELWQRHRTLAERLVTDDWERETLYRAWADLLKSFDRIVRAIATLGEHSPRSS
DAVAAIGERFIGLLLAVALRRGGVAAQLIDGAELIVTDDHFGNARPLPEETTARARARLL
PLTQSRIVPVVTGYIGATRQKITTTLGRGGGDYSATLIAAALEADEVVIWTDVPGILTAD
PKLVPEARTLPELSYIEATEIATLGAEVLHPRSLTPLANRNIPLHIRSLEQPHIPGTRIV
AAPHISSDTARTIISAPSISLIEISMSPLAAAELGWAPDLAARILAELTGCGIEVLTFAQ
SFSERGLVLAVRATDAEYAYERIEACLQPERDSKALRAISLRAPVALVAVISAPESTRLA
PRALTALARVQGTVLAMVHGNTSRHLSFIVPEEELSAVVRALHRELMAG
>Msta_Aa_|_CG-23
MGIVVAKFGGTSVGSGERIYKAANSVVNEYMQGNQVVVVVSAINKTTDESIKLVNESIGE
LVTEKQLAGILSMGEMQSVRIMAATIESLGVKAEFIDPFSEKWPVITDSNYLNAKIDKKE
TQKRVTKYIKKLLNQGIIPVVCGFLGCDVDGSVTTLGRGGSDVSAFLIGHCLGADEVVIV
TDVKGVMSTDPRKLNTARKLDKITVEEMIDLANYGAQVLHPNALRYKDPNIKAKIISFEY
GDLRVQGTDIIGPAHEEYDVITITKCDDKLSVLAVVGENLMNQQCIIAQITQKVCENKLN
IYGISTGESSITLFFKEDEAIKAHEKLHDLVIGGDTLSSISLGQKIAMISVVSHDFIDTP
GIIASITKPLHENEINIVELSSSQTAVVVFVDWNDGDKAYDLIKETLQ
>Mmar_Ac_|_CG-52
MALPDQPQPDQADRPLKLCVLKFGSSVLFKPDDYARAAHEIYRHVRAGEKVVAVVSALDG
ETDALFGVGNDVGQGCSDALLARLVRCGELKSAALMGLALERSGIPSAVLDPHEMGLRAE
GEALDANLTGLDASRVLKRFASVDVIVAPGFFGEGADGPVTLGRGGTDLTAVEFAHWLGA
DRVRLIKDVDGVYTDDPAKVANAKRFDQLDYDEAARVSRGLVQDKAITRAKEQDVVIEVA
ALGRPYATRIAAVEQRAGDGLEMKPMRVAVLGHGAVGAGVCAHLLAHPGRFTLNPVLVRD
PAQHSAGAAAELSFTDDPARALG
>Mthe-3_Ab_|_CG-24
MKVLVQKFGGTSVASPEQRLVVTGHIERACRVGYQVVVVVSAMGRRGAPYATDTLLELLG
DNEVEPRERDLLLACGEVISGVVLTGLLKSKDLPAVFLTGGQAGIITDAQFGDARILRVE
PRRIQSYLDQGRVVVVAGFQGVTESGEVTTLGRGGSDTTAVALGVALGAEAVEIFTDVDG
VKTADPHIVSDARTLSTITYNEVCQMAYEGAKVIHPRAVEIARQKNIPLRIKSTFNDGPG
TLVVAWQPGVTGVHISRDRVITGITHMDGLTQLRVSLPSGEGAGEVFPLLAQNNISVDFI
NIFPGELVFTVKSEVARQARELIEGLGLKVTARPGCAKVATVGAGMRGVPGVMATIVTAL
EREGIKILQSADSYTSIWCLVDRKDMERAVQTLHREFKLNDGKTGEVKVYAVG
>Cglu_Aa_|_CG-25
MALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGDTTDELLELAAAVNPV
PPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLTTERHGNARIVDVTPGR
VREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVY
TADPRIVPNAQKLEKLSFEEMLELAAVGSKILVLRSVEYARAFNVPLRVRSSYSNDPGTL
IAGSMEDIPVEEAVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNV
SSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLYDDQVGKVSLVGAGMKSHPGV
TAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEAVVYAGTG
>Tmar_Ab_|_HDh/_AK_|_CG-26
RVAKYKVLGGAEKFSVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTT
DHLIELAKTIDENPDPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKR
YGSARIIDINTDIISRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGAD
LCELYKDVDGVYTADPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVL
IKNAHKETRGTLIWEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGV
NIDMIIQGMKSGEYNTVAFIVPESQLGKLDIDLLKTRSEAKEIIIEKGLAKVSIVGVNLT
STPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDRE
>Adeh_Aa_|_CG-27
MPVVVQKYGGSSVGTVEKMRKVAEKVAAARRAGKDVCVVVSAMGDTTDDLLSLAKQISPA
PARRELDMLLSAGERISMALLSMALNDLGVPAISFTGSQSGIITTDSHSAARILEVRAFR
VQEELAKGKVVIVAGYQGVSTRKEVTTLGRGGSDTTAVALAAALGADCEIYSDVAGVFTA
DPRVVPSAARLEALSYEEMQELAAAGAKVLNAQAVEFAKERGIAIHARSTFGGPEETVVK
GGAHPERIAGVAMQKGLALLGFPAARLGDVLAILERHGAVALEIAVPGERAGVALDLENV
HDWPVLRAQLAAEVPGLAAEDEAIGAVSVVGTGISAGHRVLRAVTATLAELGARPRALFT
SPLRVTAYCDAAVLKDAARRLHEQLVG
>Cbot_Ba_|_CG-28
MATIVQKYGGTSVATVEKIKNVAKFIVKRKREGNDIVIVVSAMGHTTDNLINLAKDISNV
PDKRELDALISTGEMVSSSLLSMAIKELGEDAISYTAYQINISTNGQHGKSLINDIDKKK
IDKSLKEGKVVVVAGFQGINCDGNITTLGRGGSDTSAVAIAAKLNNAICEIYTDVDGIYS
VDPRVYDRAKKLDYIDYEEMLELSSLGAQVMHSRSIELAEKYNIPIYVGLSNSNIKGTVI
RRMNNMNMEMKSVTGLATSDDDVAITMEDINENINIVADIFSKLAEKQINVDMISQTAPI
NSRISLSFTIPKEDLQEGMKIIRNYASKDKIKIDENLTKFSIVGIGMKNTSGVAAKMLKI
FSDNNIKVKMITTSEIRITCAINVRDKINAINLVVKEFNL
>Tpet_Aa_|_CG-29
MNVVVQKYGGSSVATPERIKNVAQRIKKKVDEGYKVVVVVSAMGKTTDNLIKLAKEISPK
PDSRELDMLLATGEQVSAALLSMALKDLGIKAKSLNAFQVKIKTTSHHTSARIVDIDDSV
IWENLKDYDVLVVTGFQGVNEHGDLTTLGRGGSDTSAVALAAKLRVPCEIYSDVDGIYTC
DPRVHPRAKKLAYITYDEALELTALGAKVLHSRSVEIAKKYGIPIYCASSFTEEEGTMVV
ERLPEWLEEPVVTGATISHGQIKVSISFLPKDVKYITAIFEEVGKKALNVDMISLVPSNG
KIFLSFTILEDHKEDLDEALKEALRDVEGWKSTYEGGFAKLSIVGVGMRTSPGVAARFFE
ALERAGVTPELVTTSEIKISCLVPEEKAEEALKSVIEEFEL
>Ssap_Aa_|_CG-30
MNLERSVLKFGGSSVSDFTKIKNIAEMLSLRIAQGEQLIVVVSAMGKTTDELMANVSTLT
TSPKDQELALLLTTGEQQTVSYLSMVLNDIGVRAKAMTGYQAGIKTVGHHLKSRIAEINP
ETFEQAFEENDVLVVAGFQGINDDLEVTTLGRGGSDTTAVALAASNHTPCEIYTDVDGVY
ATDPRLYKDAKRLDYVSYEEMMEMSALGAGVLETRSVELANNYNIPLYLGRTLSNVKGTW
IMPQTEILEKKAVTGVALDTHMMHVTISYPLPDNKLLTKLFSQLEDGSVNVDMISQIVNL
EGLQMSFTIKDTDVAQISSILETLKEDFSALDFRINEEYVKISLIGSGMRDMSGVASKAF
ITLIENDISFYQTTTSEISISCVIDAENGERAVQTLYQAFDI
>Lint_Aa_|_CG-31
MTNIIVQKYGGTSVGTPERIQNVAKRIKSYHDKGQQVAVIVSAMGHTTDELVDLAAKISS
NPPKREMDMLLSTGEQISTALLAMALWEIGVPATSFTGSQIKLLTDGNFSNAKIKMIDRS
RIDSALNEGKVVIIAGFQGIDAEENITTLGRGGSDTSAVAVAAILGAKECEIYTDVDGVY
TADPRVVPSAKKHKQITYEEMLELASLGAGVLHSRSVELGMNYDVVIHVRSSFNDNIGTL
VVSEDKIMEKLKVSGVTAKNDQARITIAGVPDKPGLAAGLFGELSSKHILVDMIVQSSPH
NGINTISFTIPKKDVHEAKPILEGFSKSHNAKEPEINENIAIVSAVGVGMKSHVGVAAGM
FKALADNGINIEMISTSEIKISCVIAESQAKIAVNKIHDVFGLSS
>Bhal-1_Aa_|_CG-33
MSIIVQKYGGTSVGSVQRIEHVANRIIATAASGKKVVVVVSAMGKTTDELVGLASEITDE
PRKREMDMLLATGEQVTIALLAMALHKRGQEATSLTGWQAGMITESHHGNARILEVERAR
MDELLDKVHVVIVAGFQGIDQQGEIMTLGRGGSDTSAVAIAAALKAERCEIYTDVTGVFT
TDPRVVKQARKLQTISYDEMLEMANLGASVLHPRAVEFAKNYEIPLLVASSMVDEPGTMI
EEEGTMEQNLLVRGIAFENDVTKVTVHGLPNEIHTLPTLFAHLSAAGINVDIIIQNQTDS
GMAISFSITQSSLKETLARLEELKGELSFQGIDYEEELAKVSIVGSGMVSNPGVAAKMFE
ILAANDIAIKMVSTSEIKVSAVIDEELMVLAVEMLHEQFKLHEEEPAVAVKV
>Ddes_Aa_|_CG-34
MRILVQKFGGTSVANLECMQQVKQKVLHARENGYKVIAVLSAMSGETNRLLNMAGQWSQC
PDEAEVDALISTGEQVSVSLFAMLLQNEGIKARSVLGFQIPLKTNTAYSRARILDIRKDT
LVELLEAHDVLAVAGFQGINDDNRITTLGRGGSDTSAVALAAALGCECEIYTDVDGVYTT
DPNMCSAARKLDRISYDEMLEMASMGAKVLQIRSVEFAKKYKVPVRVRSTFTNDSGTLLT
QEDSQMEAVMVSGIAYDKDQARITLRGVPDTPGVAASLFCPLADAGIVVDMIVQNPSLDG
VTDMTFTVPRKDLTRALELVEKTRAEVGAKEVLHDLNVCKVSAIGVGMRNHSGVASKTFA
TLRRENINILMISTSEIKITCLIEEKYTELAVRTLHDAFGLDKDQSQAG
>Cjej_Aa_|_CG-35
MLIVQKYGGTSVGTLERIEAVANRVIQSAQQGNQLVVVVSAMSGVTNTLIEQAEYFSKTP
NGKDMDMLLSSGERVTSALLSIALNEKGCPAISFSGRKAGIITDSVFTKARIHHIDTKAI
KSELQNGKIVVIAGFQGVDEEGNVTTLGRGGSDLSAVAVAGALNADLCEIYTDVDGVYTT
DPRIEPKAKKLDKISYEEMLELASLGAKVLQNRSVELAKKLNVNLVTRSSFNNNEGTMIT
KEDGMEQALVSGIALDKNQARVTLRNIEDKPGIAAEIFSVLANENINVDMIIQNVGVDGA
TNLGFTVPQNELELAKNAMQKILSSKTTIESDSAVLKVSIVGVGMKSHSGVASKAFKALA
DEGINIGMISTSEIKISMIVHEKYGELAVRALHECYGLDK
>Pcar_Aa_|_CG-36
MALVVQKYGGTSVGDVDRIRNVARRVAKTYDDGNDVVVVVSAMSGETNKLVALANELCDF
PSEREYDVLVSTGEQVTIALLSMCLQSMGYKAKSYLGHQIPIFTDSTFSKARIESIDDKN
IREDLNNGTIIVVAGFQGIDHDGNLTTLGRGGSDTSAVAVAAALKADVCEIYTDVDGVYT
TDPRIVADATKIEKISYDEMLEMASLGAKVLQIRSVEFAKKYGVIVHVRSSFNDNPGTLV
TKEDEDMETVLVSGVTYNKDEAKISVMGVPDKPGVAAKLFTPLTTSNITVDMIIQNVSND
GLTDLTFTVPRGDFKKALKAVEETAREIGAAGVRSDENIAKVSIVGVGMRSHSGIASKMF
RVLSQEGINIQMISTSEIKVSCVIDAKYTELAIRVLHQAFGLDKKDSKAE
>Rrub_Aa_|_CG-37
MARIVMKFGGTSVGDVDRIRNVARRVKAEVDAGNEVAVVVSAMSGETNRLVGFCDSMTNM
YDAREYDAVVATGEQVTIGLLAIALQDIGVEARSWMGWQIPIHTDEAHGKARILSIDTTV
LEQRLASGQVAVVAGFQGLGPNNRVTTLGRGGSDTSAVALAAALKADRCDIYTDVDGVYT
TDPRIVPKARKLDRITYEEMLEQASLGAKVLQTRSVEMAMKHRVRVRVLSSFSDAPGTLV
CDEDEIVEKELVSGIAYSRDEAKITLVKVSDRPGVAARIFGPLADANINVDMIVQNVSED
GHSTDLTFTLPRSDLARALKVLEGARDDINYRELTTSSAVVKVSVIGVGMRSHAGVAQTM
FRALSEKGINIHVISTSEIKVSVLIAEEYMELAVRALHSAYGLDAA
>Wend_a_|_CG-38
MDKIIIKKFGGTSLTDLNRVANLIKNDIEKGCNVIVVVSAVAGFTDQMVFQARQISNLSY
RQELSEYDVMLSAGEQISCGLLAITLQSIGVNAKSWLAWQLPIVTDDFYSESKIKTIKIE
RVKRSFAEGYTAAIIAGFQGINDDRITTFGRGGSDISAVAFAVAFGVRTCEIFTDIDGIY
TADPRIVPKARKLKFISYDEMLEMSSSGAKILHNRSVQLAMKHNIKVQVLSTFKEVEGTT
VLHKRDVLERYLITGITYSTNEALVTFTNLANNLRTLRDIAGANVKIDMIHGSSFVISKF
DIDLMEKLLNKNENYAINDNVAKISIIGIGVMSNTEVMHRTLKVLSEKKIEILAITTSEI
KISIIVQKECAVALVKDLHTEYELDMQH
>Sama_Aa_|_CG-39
MTKIYVKKFGGTSVGTFERIEAVADAIAKAHFEGERQVLVLSAMAGETNRLYAMAANIDP
LAPARELDMLVSAGEQVSIALMSIALARRGVNARSLLGSQVKVRTNSQFGRASIESVDTG
LLMQLLDEGAVPVIAGFQGVNEQGDVTTLGRGGSDTTAVAIAAALEAAECQIFTDVTGVF
TTDPNIDPDAQKLDSISFEAMYEMARQGAKVLHPDSVACARRHGVVLRVLSSFESGSGTL
IRFDEPEHSGSGIVGIAVTRGQGLVSVAGLVDQPQAEVALFQALANASVDTDLVVQLAEE
KALAFTLAQGALDKVLTLIDRLALEQPLADVRHESPLAKVSLVSTGKAVMAEVGARVTEL
LEAQNIRVKLLSTSEIKLSVVIDEVHLQHAVRSLHRAFDLNKV
>Nmen_Aa_|_CG-40
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLSTGEQVTIGLLAMALKDIGVEAKSYTGWQVALKTDTAHTKARIESIDDEK
MRADLAAGKVVIVAGFQGISSEGDISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNLG
>ACIN-1a_|_CG-41
MALIVQKYGGTSMGTPERILNVARRVKRWHDHGHKVVVVVSAMSGETNRLLALAKAITDT
PDPRELDQMVSTGEQVTISMLAMALNSIGVEAKSYTGRQVGIKTDSAYNKARIEAIDTDV
MTKDLDAGRVLVVAGFQGVDEEGNTTTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVAPKAKKVDRISFEEMLEMASLGSKVLQIRSVEFAGKYQVPLRVLSSFDNDNDGAF
DEEFKQNVGTLITTEAEDTMEQPIISGIAFNRDEAKLTILGVPDEPGIAAKILVPISAAN
IEVDMIVQNVEEDGTTDFTFTVNRGDLAKAKKILEETASNIGAREVSTRDDIVKVSIVGV
GMRSHAGVASKMFMALAEESINILMISTSEIKVSVLIEENYLELAVRTLHTAFGLDREHG
ESSARA
>Voku_Aa_|_CG-42
MALIVQKYGGTSVASVERIQAVAQKIKAFKEKGHQLVVSVSAMSGETSRMTALAQTIQDI
PSLREMDVLLTTGEQVTIALLTMALQQLGCDAVSYTGPQVCIMTDSEHGKARIKSIDNHR
IFHSLDQGKVVVVAGFQGVDENGHITTLGRGGSDTTAVALVTALKADECQIYTDVDGVFT
TDPRIEINARRINVVSYEEMLEMASLGSKVLQIRSVEFASKYKVPLRVLSSLIDNPLGTL
ITREENIVEQVVISGIAHNKDEAKLSLIGVLDEPGIAFKILNPISSANIEVDMIVQSVSA
REGLTNFAFTVHRNNFKTASKILNNVCKEIGAIAVQSDDKVVKVSLVGIGIRSHAGIATQ
MFEVLHNEGINIQMISTSEIKISVVIDEKYLELAVRSLHAVFELDKE
>Pput_Aa_|_CG-43
MALIVQKFGGTSVGSIERIEQVAEKVKKHREAGDDLVVVLSAMSGETNRLIDLAKQITDQ
PVPRELDVIVSTGEQVTIALLTMALIKRGVPAVSYTGNQVRILTDSSHNKARILQIDDQK
IRADLKEGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVPQARRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKEGPGTLI
TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISASNIEVDMIVQNVAH
DNTTDFTFTVHRNEYEKAQSVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASCM
FEALAKESINIQMISTSEIKVSVVLEEKYLELAVRALHTAFDLDAPARQGE
>Deth_Aa_|_CG-44
MAVVVHKYGGTSVGDAERIKHVAKRIIAARQKGSDVVAVVSAMGDTTDDLIALAHKLNDC
PEPREMDVLLSTGEIVSSTLLAMALKNMGQDAISLSGQQAGIRTDSAHSKARITGIDPKR
IHDELAKGRVVIVAGFQGVSDCQDVTTLGRGGSDTTAVALAASLGASICERYTDVDGVYT
ADPRLIPDARRLAEISYEEMLELSSYGAKIMHPRAVEIGQVYNIPILVASSFNENPGTLI
HGGENMEIRNRVSGIAHDFEVAKITILGVPDKPGIAAGLFAPLAKAGVSVDTIVQNSSQD
HITDLTFTVTKSDLGKALEVIGPIAKDIQAREVLSDSRIGKVSIIGTGMLNAPGYAARMF
KALSDAGINILLISTSEIRITCIIEEDKVKDAVKAIHKAFEMEKD
>Dred_Ab_|_CG-45
MLVVKKFGGSSVADPERIKRVARRVVEEHQKGNQVVVTVSAMGDTTDDLVSLAKQVTNDP
SEREMDMLLSTGEQISIALLSMAIRDLGSDVISLTGGQVGIYTDDVHSKAKILKIETSRV
KEELEQGRVVVVAGFQGIKSNHDITTLGRGGSDTTAVALAAALKADICEIFTDVDGVYTT
DPRLVPEASKLKNISFDEMLELASLGAQVLHPRSVELAKQYGIPIHVRTSFDHREGTIVE
EAPNMENAPVVSGVAHDYNVAKIGLFDVPDQPGVAKKIFKALSKHNLNVDMIIQSAMRNN
MNDIGFTTTQDDLRKALQTIEAIQQEVGFRGYNHDEDVAKVSIVGAGMISHPGVAADMFE
ALADEGINLEMITTSEIKVSCVIKRSETEKAVKALHKKFKLDNLAEASIYNR
>Aehr_Aa_|_CG-46
MALIVQKYGGTSVGTTERIKNVARRVQASRERGDDVVVVVSAMSGETNRLLALAEEIGPN
PPAREVDVLVSTGEQVTIALLTMALESIGTPARCYTGPQVRILTDSAHSRARILDIDAKQ
INDDLRLGRVVVVAGFQGVDESGAITTLGRGGSDTTAVAIAAALKADECQIYTDVDGVYT
TDPRVVPKARRLERITVEEMLELASLGSKVLQIRSVEFAGKYKVPLRVLSSFKEGPGTLI
TYEENPMEEPLISGIAFNRDEAKLTVLGAPDVPGIAASILGPISDAGIEVDMIIQNVSTS
GATDFTFTVHKRDYEQALKILQDNKDKLGAREIYGDPKIVKLSLVGVGMRSHAGVASTMF
KALSAEGINIQMISTSEIKISVVVDEKYLELGVRTLHTAFGLDDENAQVEVEGDNA
>Asal_Aa_|_CG-48
MALYVQKYGGTSVGTLERIEAVAERVQLTRAQGHDVVVVVSAMSGETNRLLGMAQRLDPD
ANRREMDVLVSTGEQVTIALLAIALNKRGCAAVSMTGDQVRIHTDSAYGKARISHIDTEQ
VQAELGAGKVVVIAGFQGRDEHNAITTLGRGGSDTTAVAVAAAIKADECQIFTDVDGVYT
TDPRIEPKARRLSTITFEEMLEMASLGAKVLQIRSVEFAGKYRVPLRVLSSFVDGEGTLI
TYGGERMEAPLVSGIAFNRNEASLTILGVPDRPTVAAQILNPISDANIDVDMIVQNTLGD
GTADFTFTVNRDDYRRARALLEETASELGAACVQGNGEIAKVSIVGVGMWNHPGVARTMF
KVLGEEGINMQLISTSEIKISVVIDEKYLELAVRALHAAFGLDNEPHEQPLGNNP
>Mmar_Aa_|_CG-51
MTRVVAKFGGTSVGTIERIRHAAGLVADAARRGETMTVVVSAMAGETDRILGLAGAFGSG
LGDRETDVALAAGEQVSSALMALALREAGLEAQSFLGWQLPVITDGPPGASRIAGMDVAV
LEAAIDAGIIPVVAGFQGITETGEVRTLGRGGTDLSAAALAAALQARCDIYTDVDGVYTT
DPRVEPDARRLDTISHDEMLELAAQGAKVLQTRSVEFAKARGVPMRVLSSFLEAGASRGT
DVVSEQAIAERRLVSGVAYARDQARIALHGASNRSDMAARCFASLAEAEVGVDMIVQAHA
RQPGTVTLEFSIAHRDLDRAQAVLEDAMTGVRISAETGLAKVSVVGAGLRQRADVARSLF
AVLGDQDIAVKVLATSEIKISALIENDAVERAVRALHAAYGLDQV
>Pmar_Ca_|_CG-32
MALLIKKFGGTSVEDITKIKAIAQSIIQSKEAGNDIVVVVSAMGHSTDHLNKLAESISKN
PNSRELDMLLSTGEQVTMALLSMSLNEYGIPAISLTGSQVGIVTESIHGKARILDIKTER
IQNYINQGYVVVVAGFQGSTLSHTGSMEITTLGRGGSDTSAVALSTALGAETCEIYTDVP
GVLTTDPRIVPNAKLLDIISCEEMLELASVGASVLHPRAVEIARNYGIKLYVKSSQALSN
GTLLHSKIKPLALKRGGLELTKTVNSLEVLEKQTVFSISKLPDRPGIAAQIFETLSKANI
NVDLIIQATHDGKSNDIAFTVNDFELTKTIDQCKLITKQLGGEYDFKKNMTKLSIQGAGI
MGRPSVSADLFDTLFQANINVRLIATSEIKVSCVIDIENISKAIRFVSEKFKLSDKQIFI
NPVIESEDQPEVRGIALDKNQVQVSIRNLPDKPGVAASICLALAENNLIFDTIVQSERLT
SLKTKDISFTMSKQDRERANTIFHSLTKKLAGSFIEDGPAIAKVSTVGAGMAFKVGTAGK
IFRALANKNINIEMIATSEIRTSCIVLEQDCDQAVNAIHSYFQLDK
>Rbal_Aa_|_Orp
MSLIVQKFGGTSVADTEKIRAAARKAIRAQKAGHRVVMVVSAMGKNTDTLLDLASQISDE
PPAREMDMLLSTGEQVSVALVAMAIHSMGSKAVSLTGGQIGLKTDNSFSKARIQSIDTGR
IERLLDAGNIVVAAGFQGIDDDLNITTLGRGGSDTTAVALAAVLGADACEINTDVDGVYT
TDPRLLAEARRVDVISYDEMLELASLGAGVMHSRSIEFAKKFEVPIHVRSSFSDQDGTMI
VAQPESETAPVSGAALTRDEARVTVLGVPDVPGMSQKIFSAIAAQKVAVDMVVQNVGTSG
KADVSFTVAGGELKKTLAALEGILDSLGADGVTHDDQVSKVSVVGLGMAHQKAVAASMFR
ALAEANVNIHMITTSEIKISCLVPRDQANEALRAVHEAFSLDQRPSDAKTWNEIKASNAK
EADVADVVARLQNDALEALTLTDISIVPAQARVTLDGVPDQVGVAADMFEQIGEAGIFVD
MIVQGYDGEDGSTSVSFTVEQADLDAAQKVAREICGKHSMRDVRGASGITKLSVSGIGLR
SHTQVGTVLFEQLASAGINVEMIATSELQVNVVIQSDQAGDAATRLKQAFAEALH
>Mthe-3_Aa_|_CG-Orp
MALIVQKYGGTSVNGPERVKNVARRVVNTRRAGNDVVVIVSAPGDMTDDLIAMAHEISPN
PPAREMDMLLATGEQTSIALLAMAIHELGEPVISLTGPQVGILTDNVHSKARIMEVSCER
LRRELEQGKIVIVAGFQGKTCEGEITTLGRGGSDTTAVAVAAALKADVCQIYTDVDGVYT
ADPRVVPEARKLPVISYDEMLELASLGAQVLQPRSVEFGKLNHVVLEVRSSFNDHEGTLV
KEVTEMERKMVVSGVAGDRNVARIALHDVPDRPGIARTLFVALARESINVDMIVQSAMRD
GINDIAFTVGRDDLQKAVEVTERVRQEIGASKVTSNDRVAKVSIVGAGMITNPGVAADMF
ACLAEEGINIHMISTSEIKVSCIIDEEHLTRAMQALHRHFKLDRE
>Mxan_Ab_|_Orp
MALIVQKYGGTSVGDVARIKSVALRCLAAQEAGHDVVVVVSAMSGETNRLMKLVAQITDR
PDEREQDVVVATGEQVSIGLLAMAIHAQQGKATSFLGQQVRIVTDSTFAKARIKSIDAQP
IRAALARGHIVVVAGFQGVDESGSVTTLGRGGSDTTAVALAAALNADACEIYTDVDGVYT
SDPNMVPSARKLDRITYEEMLELASVGAKVLQIRSVEFAMKYKVPLWVKSSFTDDPGTLV
CEEDSSMEDVLVRGVAYDRNEAKITVCGVPDVAGAAAKIFGPLDEKHIVVDLIVQNPSKD
GRTDVTFTVGKADFLTAQEVVRKVAEEIGASGIETDGDIAKVSIVGVGMRNHSGVAARMF
RALSAEGINIQMISTSEIKVSCVVQAKYTELAVRALHTAFGLDQPMPPEGVSAVSEMAAL
MGEKV
>FRAN-2a_|_Orp
MAIIVQKYGGSSLATIEKIRGVARRVVDTAAAGKQVVVVVSARGRTTDELLGEARALGGH
WRSRESDQLVSTGEVVSAATTALALRELGQPAVSMTGGQAGIQVSGEFGSAAVHSVTPDR
LRTSLEEGKVVVVAGFQGVDASGDVRTLGRGGSDTTAVALAAALGATCEIYTDVDGVYTA
DPRLVPRARLLPTVPAPLMHEMAHTGAGILHPRAVDLAATRRIPVQVRNSLGTNPGTVVE
VVPGNPLESDGVVAAVTQDEDTTLVMMRGRGEPLDSWAALARMASAKVAPADLFALADST
HGSTLGFTSSPARQIDLAHIARQAGGTVELRDDLGRLSLVGTRMNLCGAVIETLAEILST
HGIRSPWIAISERRISILVPRGGMRRLALTIHDALVLGRGLEAHSSDR
>Sgri_Ab_|_Orp
MTTQGSRPTGDVVVQKYGGSSLATVSQVRQVADRVGALARSGRRVVVVVSAQGDTTDELV
GRAEAVNPRPAGHELDQLLATGETASAALMAMALQRGGLAATALSGARSGVLATGPHGAG
VIVAVDTDQLRTLLDAGRTVVLAGFQGVTAEGDIITLGRGGSDTTAVAVAAELRSGHCEI
YSDVPGVFTADPRVVPDARLMPDIDIDVMTEMAFAGARVMHARAVELAALYDVDILVGRS
TATRTGTRIHRRDGNDMLEDRTAVSAVVHDADIARITLRTHDTPDPSADVFRFLAKESIP
ADMTTVSSAPDGGFSLGFTVRRSHAADVGRSFSDLMAPRPHGVEVEDQVAKVSIVGQGLL
SRPEYASRMLASLVGSGISARSLTASQLRVSVTVPRSDAVRAVGLLHSEFGLGAEAGAVP
ASLTPRP
>Twhi_Aa_|_Orp
MSLIVQKYGGSSLASANNLKRVAERVSRAYYGNNRLVVVVSAMGSTTDRLLTLAHEVSVE
PERRELDVLLSTGECVTASLLAMAINSIGLPARSFTAAQAGIVTDEHHCNARIITITPTL
IEDALNAGEIAVVAGFQGVNRKGQVTTLGRGGSDTTAVALAAALKADRCEIYSDVEGVFT
ADPRIVPKARLLESIPIDHMLELSTAGARILSLRSVVFAKRHNVSVKVGSTFSDTSGTIL
CNEGEAMEEPVITGIATDTSQARITIVGLPDIPGSAAEVFSALSVAEVAVDNIVQNFSSS
NTGFIDLSFTSPKAQGPAVTSALRENQTRIGYKDLQYDDEVGKITVVGSGIQHSADISAQ
LFRLLSDAKVNVEMISTSEMRISFVVRANVVAEVARLIHTSFGLDADLRAVVHSEGRV
>Rxyl_Ab_|_Orp
MERRHRQRERPLGIVVQKYGGSSVATAEHIKAVAGKIQRARKAGLDLVVVASAMGKTTDR
LLRLAGEVSSDPSPREIDQLLATGEEQSVALLAMALHDRGVPAVSLTGPQAGMRATGRYG
SGVISEIRPGRIRRLLGEGRVVIVAGFQGMNALGDVMTLGRGGSDTTAVALAAALGADRC
EIYTDVDGVYTADPRIVPGARRIPVISYAEMSEMAWRGAKVMHPRAVELGALYGVEIHVL
SSFDEESPGTIITGGEKVEHLETRETVAGIVHDTDVARITLNGVRTGPGTLSKVFTPLAE
RGISVDVIVESGIKEGVADIAFTVSRADFAEARSAAGEVARALGGSVEGEEGLAKVSVVG
TGMLNRPGYAARMFSALGSEGIPIRMVSTSEIQVTCVIPAERVQEAVRRLHRDFELEERE
DV
>Aaeo_Aa_|_Orp
MKILVQKFGGTSVGTLERIELCAKRVIKALEKGYKPVVVSSAMAGETDSLIELAKKVHPR
PPEREMDTLLAVGEQKAIALFAMTLNKLGYPAVSLCGWQVPIITDNVHTKARIRKIGISR
LLSLIEEGYIPVVAGFQGVTEDWEITTLGRGGSDTTAVALAAALKADCEINTDVPGVFTA
DPRIVPNAKKIKKISYEEMLELASLGAKVMQIRSVEFAAKYNVRIHVRSTFSEEEGTWIV
PEDEVMEKVAVRGITVDTKETRFTVVRVPDKPGIAAEIFKALGDAHIVVDMIVQNVSHEG
YTDMSFTVNKTDADKAEEIVKKIAQKIGAKEVVRDDKVAKISIVGIGMKSAYGVAGRMFD
ILARNGINIKAISTSEIKISCLIDEKYAELAVRALHEEFIEEMEEFETINGKNKE
>Sthe-17_Ab_|_Orp
MGLVVQKFGGSSVATAEKYRRVARRIAWKKRQGNDVVVVVSAPGDMTDDLIERARSITDR
PSAREMDVLLATGEQISIALLTMALHELGVDAVSLTGPQAGFQTDDHHRAARIVNIDTAR
IRRELAAGRVVIVAGFQGMDDHGDITTLGRGGSDASAIALAAYLSADQCQIFTDVDGVYS
ADPRIVPTARRLDEISYDEVLELAAAGAQVMQLRSVELAKQYGVEFEVLSSLAPLPDEGG
EERGTKVVAKLSPNNHRIVSGVAVDSKVAHITLLGLPDRPGVAYRAFKALGDARINLDMI
VQSAGTGCGNGPTADISFTCARDDLETALEVCNRLLPEFPGARVVYDTDVAKVSIVGSGV
ASNYGVAARMFEALAEKDINIELITGSEIKISCLVRASRAMEAVRAVHDKFELGDVAPIV
>Tthe_Aa_|_Orp
MALVVQKYGGTSVGDLERIHKVAQRIAHYREKGHRLAVVVSAMGHTTDELIALAKRVNPR
PPFRELDLLTTTGEQVSVALLSMQLWAMGIPAKGFVQHQIGITTDGRYGDARILEVNPAR
IREALEQGFVAVIAGFMGTTPEGEITTLGRGGSDTTAVAIAAALGAKECEIYTDTEGVYT
TDPHLIPEARKLSVIGYDQMLEMAALGARVLHPRAVYYAKRYGVVLHVRSSFSYNPGTLV
KEVAMEMDKAVTGVALDLDHAQIGLIGIPDQPGIAAKVFQALAERGIAVDMIIQGVPGHD
PSRQQMAFTVKKDFAQEALEALEPVLAEIGGEAILRPDIAKVSIVGVGLASTPEVPAKMF
QAVASTGANIEMIATSEVRISVIIPAEYAEAALRAVHQAFELDKA
>Chyd_Aa_|_Orp
MLVVQKYGGSSVANPERIKNVARRVAEYYRAGHRVAVVVSAMGDTTDELLDLMGEISPNP
PAREIDMLLSTGEQVSVALLAMALHELGVPARSFTGLQAGIYTDEVHTKARITEIKPERV
IACLNSGKVAVVAGFQGVNREGDITTLGRGGSDTTAVALAAALKADICEIYTDVDGVYTA
DPRIVPDARKIKEISYEEMLELASLGAVVLQPRSVDFARNYKVEVHVRSSFNYNEGTVLK
EERDLEKKGVVTGVAHDKNVVKIGVFGVPDQPGVAYRLFSELAAHNINVDMIIQSAGKEE
GQNDISFTIGKNDLAKTVEILEDVVKKLSARGYTYDEKVAKVSIVGAGMVTYPGVAAKMF
EALYEENINIQMISTSEIKVSCIIAEDAVERAVNAIHKKFELGNGV
>Swol_Aa_|_Orp
MSLIVAKFGGSSVASIDKIKHIAGRIKGMRDKGDDIVVVVSAMGDTTDELIELASLTGHD
LCKREMDMLLATGEQQSAALLALTLNNFACSSISLTGWQAGIKSDDSHSKARITGIETGR
IKNELKQGNVVIIAGFQGLSPQGDITTLGRGGSDTTAVALAACLDALRCMIFTDVEGVFT
ADPRIVKEAKKLPQISYEEMLEMASLGAGVLQPRAAEFAMLYNVDVEVLSSFSHNPGTII
TEVANMENHRAVSGIAHDLNCARFALFDVPDQPGIAKTLFKTLAAENINVDIIIQSAMRD
GRNDIAFTIEEKELSRAIPVVEGLVKKICASGMTYGNDVAKVSIVGAGMQSNIGVAAAMF
EALADEGINIHMISTSEIRVSCVIDECHIKAAIKALHRKFELDKIE
>Pubi_Aa_|_Orp
MKTVVLKFGGTSVGSIDRIKSVAKIISSYKKKKMGVIVVSSAMSGTTNELIKKTKELSNT
FDAAEYDVLLATGEQATCALIAGRLKHLGFKARSWMSWQLPIITEGPYSSSRISKINKGK
ILSFMKSGGIPIITGFQGINLENRLTTLGRGGTDASAIMLAKFFNTDACDIYTDVDGVYT
TDPRNHSKAKKIHKISYDEMLEMASLGAKVMQPTSVQDAKLNNINFSVKSSFQKKKGTLI
TGTKKTFSNQIITGITSTKNDSKVTIVGVKDRPGVAAAVFKPLSLNQINVDMVVQNISLN
GKETDLTFTIKSEDVKKTEKIIKQNKRISFRKLTYDNNVSKVSIIGVGMITTPGITYRMF
QALASKKINIMVISTSEIKISVLISNKQIKKAVAVLHKEFKLD
>Sfum_Aa_|_Orp
MALVVQKYGGTSVANPERIKAVAEKVVGRRRKGDDLVVVLSARAGETDRLIALAHEVSLS
PDAREMDVLLATGEQTTVALFSMAVRNLGVEAISMTGYQAGINTDRSYGQARISGIETRP
IMEKLHEGRIVVVAGFQGYDDEGNITTLGRGGSDTTAVALAAALGADVCEIYTDVEGVFT
ADPNVYSKARKLDRISYEEMFEMASMGAKVLHLRSVEFGMKYHVPIMVLSSFTDAPGTLV
TKEDEEMEKVVVSGITYNKNEGRITITNVPDQPGMAARVFRPISDAGINVDLIVQSGAGI
PGRADISFTVPKTAHKKAMEIVEAVAREIDAGPVHGNASIAKISIIGLGMRNHSGVAAKM
FDSLARENINLKMISTSEIKISCIIEEKYAELAVRVLHDAFELETAPHGRIEVQEET
>Phal_Aa_|_Orp
MALIVQKFGGTSVGSIERIEAVADLVVKTKQQGHQVVVVLSAMSGETNRLINLAKQIDTR
PSSRELDVLISTGEQVSVALLAMAIIKRGHSAVSLLADQVNILTDNMFGKARITDVAATR
LKHELEHNRIAIIAGFQGRDIEGNVTTLGRGGTDTSAVEIAGAIKADECQIYTDVNGVYT
TDPRVEPNARRMSQVTFAEMLELASLGAKVLHIRSVEAAGKHNVPLRVLSSFYPDAGTLI
SFEESDMPGNVVSGIAFNRDECLINVEGVLSGTQYLAKILKLFADNGIEIDMINQVNHNV
DKVDYAFTVHTNDYLHALDVLTEQQAQLTAQNIFGLTTVAKVSAVGMGMKSHSGVASLFF
DALAAENINVILVSTSEIKISVLIDEKYLELAVRALHKIFLTENE
>Ping_Aa_|_Orp
MALLVQKYGGTSVGNIERIKSVAEKIKATKADGHDVVVVLSAMSGETNRMIALAKEITAN
PSPREMDVLLTTGEQTTIALLSMALHSLGLDAVSMTGDQIRLKTDSCHSKARILDVETKN
IKEHLKLGRVVVVAGFQGRSETNEITTLGRGGSDTSAVAIAAALKADECQIYTDVDGVYT
TDPRVEPNARRLDRITFEEMLEMASLGAKVLQIRSVEFAGKYNVPLRVLSSFKDGGGTLI
CYEENKMESPVISGIAFNRDEARLTLSGVPDKPTVAAQILSPIGDANIDVDMIVQNTLGN
GKTDFTFTVHRDDYEQTKELLEKVCVLLHADNVQGNKEIAKVSVVGVGMWNHPGVAKTMF
ETLGQEGINMHQIATSEIKISVLVDSKYLELAVRALHKAFKLADDPTEEK
>Dnod_Aa_|_Orp
MALIVQKYGGTSMGSVERIETVADRIVRARQAGHDVVVTVSAMSGETNRLIALAQRFAAQ
PSPRELDVLMSSGEQVSMALLAIALEKRGCPALSLAGWQVGIFTDSQHTKARIQHIDDGA
IYRALSAGKVVIVAGFQGVDEAGDITTLGRGGSDTTAVALAAVLKADECQIYTDVDGVYT
TDPRIEPRARKLEQISFVEMLEMASLGSKVLQIRSVEFAGKYHVPVRVLSSFSDDETGTL
ISSVEGAIIEATHVTGIAFTRDEVMIQLMHLPDDMNTLYQILRPIGCADISLDMVAQTRN
DDGSINFSFIVPHQEKDRVIEFIVEQFSHIAALSVLQTEIAKISLVGLGLRSHTGIIGRI
LQALMQENIPVHCFATSETRVSLVTDLLYLERAVHCLHDAFQLEKADECRESF
>Cbur_Aa_|_Orp
MALIVQKFGGSSVANLEGIQNVARLISEARQEGHSVVAVVSAMYGETDRLIKLAQSISGS
NWREYDALISTGEQVSAALLSMALEARNCPAHSYTAAQIRLRTTNEHKKARIVDIDPEIL
HSDLKEGRVPVVAGFQGVSDAGDITTLGRGGSDLTAVALAAALEADECQIFTDVDGVYTS
DPKIVPQARRIPKITFDEMMEMSSLGAKVLQNRCLEFAGKFKVPVRVLSSLRKGPGTLIT
FEWDSAEQPLVSGIAFDRRQAKLTIQGIPERPGLASYILGPISKANIEVDMIVQNVPTID
ANIDFSFTLPRDDYKDAFSIMKQVANELAAGAVLGSDQVAKISLVGVGMRSHAGIASQMF
SALGQEGIHIHLITATEVKISAVIDEKYLELGARTLHSAFKLNQEIKFT
>Mcap_Aa_|_Orp
MALFVHKYGGTSVGSPERIKNVAKNVIRARSRGDDIIVVVSAMSGETNRLVALAHEMHER
PSTREMDVLLATGEQVTIALLSMALEAAGCPACSYTGGQVRILTDDAHTKARILDIDTDR
IRSDLAAGRVVVVAGFQGITEAGDITTLGRGGSDTTAVALAAALKADECLIYTDVDGVYT
TDPRIEPKARRLDRITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSSFAAGPGTLI
TYEEASVEKPLISGIAFNRDEAKLTVKGVPDKPGVAYQILGPVAHANIEVDMIVQNVAED
ATTDFTFTVHRNDYRKALDILQATCTALGAREVTGDDKIVKVSLVGVGMRSHAGIAARMF
EALAREGINIRMISTSEIKISIVVDEKYLELAVRTLHEAFNLDREPDAV
>Csal_Aa_|_Orp
MALYVQKFGGTSVGSVERIKAVAEKVKRFRDEGHQVVVVVSAMSGETNRLIDLASQINDE
PTPREMDMLVSTGEQVTISLLAMALHKLDVEATSYTGAQVGIRTDSAHTKARIQRIETDD
IQADLDDGQVVVVAGFQGVDDEGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVCSKAQRLSAITVEEMLELASLGSKVLQIRAVEFAGKYNVPLRVLSSFEDGPGTLI
VAEEEETTMEEPLISGIAFTASEAKLTLLNTPDVPGVASKILGPIADANIEIDMIVQNVA
PAGDYTDFTFTVAKSDYKQTKSILQDQVIPALGGGELRGDDNIAKVSLVGVGMRSHAGVA
SKMFRVLADENINIRMVSTSEIKISVVIDEKQMELAVRALHTAFGLDKDSIQGE
>Tcru_Aa_|_Orp
MALIVQKYGGTSVGNVERIQNVADKVAKFIDEGHQVVVTLSAMSGETNRLTALAKEVQEQ
PSRREMDVLLTTGEQVTIALLSMALQQKGYDSISYTGWQVPIKTNDIHSKARIEEIDSDK
IRNQLDQGKVVVVAGFQGVTPEGDITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
TDPRVVPEAKRLDVVTFDEMLELASLGAKVLQIRSVEFASKYKVPLRVLSSMKEGGGTLL
ISEEDFEDLDMEKPLISGIAFSRDEAKLMILGVPDKPGVAYQILGPISDANIEIDMIIQN
QSVDGTTDFTFTVARGDLHAAQKILEKTAESLGAREVICDDTIVKISMVGVGMKSHSGIA
STMFKTLADHNINIQMIGTTEIKISVVIEESYLEEAVQALHAAFELDK
>Crud_Aa_|_Orp
MIIIQKFGGTSVGTKKRIKSLKNIIKKYRNLNIRIVIILSAMSGETTKMLRLAKYFKYKK
LKSIDFMLCIGEQMSVSLFNLLLNSVKILSIPLISSQIGFITNNNYSNARIILIKNIVLI
KKILKKKQIPVLTGFQGITLNGNLTTLGRGGSDTSAVAISIYLKATECQIYSDVKSIFVS
DPRICLNYRINFLPFENMLELSSLGSKILFVRSIELARKYNVNIRLLSSFFKKKGTFISK
KKKFVNSMERVLISGISYTSNEVKITVANIPNVSGVLSKILGPIISNGICIDMVIQNSLN
HLKFTNFTFLIEEFFLKKVIFLIKKFFITKIGGRVEYEKHISKVSVIGIGLRSHNYIIGK
IFYSMSKLGINIILVSTSETKISILIKKKFTVLAIKNLYKIFNKQFFVKRNG
>MAGN-2a_|_Orp
MKRVDVALIVLKFGGTSVGSIERIRNVARMAMAEQQAGNQVVVAVSAMSGETNRLVGLVE
DLTQFYNKREYDVVVSAGEQISIGLLATAIESMGQKAKSYLGWQVRFITDGSHSKARIKE
VEAFRIQADLDAGAIVIVAGFQGVDSHNNITTLGRGGSDTSAVALAAALKADRCDIYTDV
DGVYTTDPRIVTKARKMDRISYDEMLELASLGAKVLQTRSVELAKKYSVPVRVLSSLEPG
SGTMLTKEEDTMESVVVSGLAYDKNEAKITILGVPDKPGVAANLLGRLGDANINIDMIVQ
NVSPAGDATDMTFTVPKADFPQAMKVMEDAVKDVGARQLQGNSDIAKISAVGVGMRSHSG
IAQKMFKALADEGINILMISTSEIKISVVIEEKYTELAVRALHDAFELEKDPSDRINA
>Faln_Aa_|_Orp
MAGDVVVLKFGGAAFAAPGAHQGIARHVADRLRAGGSSASPGGARAIVVVSAVAGETDRL
GTALRAVSPAPDRDLLAAALMTGETVNVALMTAALRDAGLAAVALTAADTGFVGAGEPHC
ADLRRIDGSVLASLVEPAGTVLVVPGGQAVDGDGRPIMLGRNSSDLSAIAAAIAVGARAC
EIFSDSPGICTADPRLVPDARTLAAVDYDTMITMSRHGAKVLHHSAVAWAQRHGVEIRCR
SLLPDGAVYSVVRAGRTSAAAVLVHGTGTVWAGDPDLVRATLAELGSDAVAIPEAAAVPE
VAVTEVAAVPEVAAVPDVAVTDVAVTEVAVTEVAAAAATAGIAGTAAVGEPVGGTVAHLV
LADAARDLRPRGLRHRADLRLVTTLFPDGRLQHRLVPAAEAPTVARAQHDVVVA

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3