[Bio] / FigWebPages / ask_cg_all.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_cg_all.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Afum_Aa_|_CG-01
MLNSCICKAACSCHTRPSSMGDQVQSDSSPYTLSMTNGSSNWVVQKFGGTSVGKFALNII
DHVVLPSLRENKVAVVCSARSSSTKAEGTTNRLLRAARDAEDAQSHEYVSLVEAVRLEHV
QVVEIQIKSEPLRTQLISEINGECERVLKVLEAAQTLGEISARCVDKVISTGEKLSCRLM
AAFLQDRGVDSQYVDLAEVIDFPIGSQGLDQDFYNNLATVLGRKIRDCEGRVPVVTGFFG
TVPGGLLDQVGRGYTDLCAALVAVGVHAKELQVWKEVDGIFTADPRKVPTARLLPAITPA
EAAELTFYGSEVIHPFTMEQVIRARIPIRIKNVMNPKGDGTVIFPDSTYELERTTPGHDP
RLFRTRSPSLMQRPKRPTAVTIKHKILVINVHSNKRSLSHGFFAGIFSVLDRWRLSIDLI
STSEVHVSMALHSEMPLLNGVGRDEYQIIDEDLKGALNDLQKYGTVDIIPEMAILSLVGK
QMKNMIGVAGRMFTTLGENNVNIEMISQGRCPYLVLLD
>Psti_Aa_|_CG-01
MSVSPPLSAKSYNSIVDLRFTASKPQGWVVQKFGGTSVGKFPENIVDDIVLVFSKTNRVA
VVCSARSSQTKSEGTTSRLLKAADIAAESGDFQYMLDVIEDDHVKNAEARVKNKTIQQKL
VADTKREIAHAAELLRACQVIGEISARSLDSVMSIGEKLSCLFMAALMNDHGLKAVYIDL
SDVIPLDYDFTNGFDDNFYKFLSQQLSSRALALSEDTVPVLTGYFGTVPGGLLNGVGRGY
TDLCAALVAVGVQADELQVWKEVDGIFTADPRKVPTARLLDSVTPEEAAELTYYGSEVIH
PFTMEQVIKAKIPIRIKNVVNPKGSGTIIFPDNVGRRGEETPPHPPEAYETLSSSFVLSH
KKRSATAITAKQDIVVINIHSNKKTLSHGFLAHIFTTLDNFKLVVDLISTSEVHVSMALQ
ILQDQELQLKNALKDLRRMGTVDITRNMTIISLVGKQMVNFIGIAGNMFKVLADNRINIE
MISQGANEINISAVINEKDTIRALQSIHAKLLEGTFGFDDHVESAVDLRLESLKFQ
>Scer_Aa_|_CG-01
MPMDFQPTSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYT
KAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELEL
VKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA
SALDNSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALI
AVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVI
RAKIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKN
DIFVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQ
AEEKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINI
SCVINESDSIKALQCIHAKLLSERTNTSNQFEHAIDERLEQLKRLGI
>Fneo_Aa_|_CG-01
MTRDFDSLFFTGPIFVDYSFTARHLESFLSSFPPQVSHAMSSASTPTAPYLEDLVRNSLD
QTLPWVVQKYGGTSVGKSLDNITKIVGSYIDNGSKVAIVCSARSTQTKSLGTTNLLLQAS
REALQPALSSSGDGRSGSMSGTATPFYPKRVGSGFFGKDQSTSMVSSVSSLSQLEPQLGR
SGSPSPFQSSSSRSPPRSPATPSQDSSVSQEPAFHATVDLIKKGHLEAARASLKEGPLRD
ELEEEIERDCESLRSFLYAAQIIDEISPRSQDSIVGTGERLACKIVAAALRDRGVDSELV
VLDNIVDASMSAASEAISVDAGDQGVAQLGQEFYDQLSFRLGERLRECGQRVPVVTGYFG
PVPGSLLAQIGRGYTDLCAALCAVGLKASELQVWKEVDGIFTADPRKVPSARLVPIITPD
EAAELTYYGSEVIHPFTMEQVIRARIPIRIKNVENPSGAGTVIYPDLGFPRGLDTEPPKA
ERIVEGVDERMPTAVTIKDEIIVLNIHSNRKTLSHGFLARIFGTLDRAGVVVDLISTSEV
HVSMAMQDFLNRKRLERLVKDLEKIGEVTVSKDMAILSLVGRNMRNAIGSAGLMFASLAR
AMINIEMISQGASEINISCVIENKDAIKALNVIHESCLSYPRSPATEMAGLQLQ
>Hnep_Aa_|_CG-02
MKRTVEKIGGTSISNTQVVLENVLIGGRKGADLYNRIFVVSAYSGMTNRLLEHKKSGEPG
VFSLFAGAGNKWAWTEALASVAEAMEAKNAEMFSGEPEQAVADNFVRERIEDVRNCLIDL
HRLCSYGQFRLDENLTTVKEVLSSLGEAHSAFNTALLLQKHGVNARAVDLTAWRDERDLT
MEERMEDALGGIDLSSELPIVTGYASSRDGLVRQFGRGYTEVTFSRLAAFVQADEAIIHK
EFHLSSADPNLVGQDRVRKIGLTNFDVADQLSNMGMEAVHPKAAKILRQAGIPLRVKNTF
DPKDGGTVISADYAPENPRAEIVTGLKGVFALEVFDQDMVGEKGYDSTILDALTRHSIRI
VSKCSNANTITHYIEGSRKALKRATADIETKLPGAEVSTSRVAIVSVIGADINVPGITAK
ALTALHEAEVPIIGLHQVSRKTDIQAVIQEDDFDKAICALHEALVEQVSVATPRAEALRP
AA
>SILI-1b_|_CG-02
MTHTVEKIGGTSMSRVNELVGTLFTGGRKPDDLYGRVFVVSAFGGITNLLLEHKKTGEPG
VYARFADAESDHGWHEALSRVGDEMRKAHEAVLENAGDVAQADAFVSERIEGARNCLIDL
QRLCSYGHFRLAEHMLQIRELLSGLGEAHSAYVTALLLQRAGVNARFVDLSGWRDEGDVT
LEERISSALNDVDPATEMPIVTGYAQCAEGLMREFDRGYSEVTFSCLAALTGASEAIIHK
EFHLSSADPKLVGEGVAQKLGHTNYDVADQMSNMGMEAIHPKAAKTLRQADVPLRVTNAF
EPEDPGTLIDDKPADQPAVEMITGLDIIALELFEQDMVGVKGYDAAILEVLTRHDVRIVS
KTSNANTITHYLDTSLTVLKRVEKDLAKIYPNADISARLLSMASAIGRDLKGLSVLTRGL
QAIADVGLASLGASQGPRNVDVQFIVEREDLKPVISALHKVLVEGRPAKQEKPIKAAA
>Acry_Ab_|_CG-02
MSMAPSVEKIGGTSIAATDAVVGNVLIAGRAGRDLYRRIFVVSAYGGITDLLLEPKKKTD
AAKPPGLYASFAADGEKGDWRDALDAVAAAMRARNEEVFGTSPERAVADDFVAARIGETR
ACLDDLDRLRGHGHFRLDEPLATLRELLAGLGEAHSAHNTALLLRARGVNAAFVDLTGWQ
DGRNLDLDERIRTGLDGIDSATTLPIVTGYVKCSDGMVRKYDRGYTEMTFARLAVLTGAR
EAIIHKEFHLSSADPKVVGVGKARKIGRTNYDVADQLANLGVEVIHPGAARGLRQAGIPL
RVRNTFDRHDEGTLICADYVSAAPRIEIVTGIRELRALQFFEQDMVGKKGYDAAILDTLT
KHRARIVSKSSNANAITHYLAAGGPTVRRVIADLEARFPNAEVSAPRLAMVALIGSDLSA
EGCVGRALDALGAAGIGVKAMQHQMRNVDIQFILDTDRFDDAIRALHAALVECRATQDGK
GGTLRTAA
>Sala_Ab_|_CG-02
MSGQHSVEKIGGTSMAATATLFDNVLIAGRSGADLYNRIFVVSAYAGMTDLLLENKKTGA
PGVYGHFVDDDDADAWRRAMAAVRAAMHARNADMFARGDSRAEADRFVDARIDAVTACLD
DLARLRSHGRFGLKDQLATVRELLAGIGEAHSAHSTALLLRDRDVNALFVDLTLWDQDDL
RSLDERIGEAFAAIDLRDTLPIVTGYAGCEGGMVRRYARGYTEMTFSRLAVLTGAREAII
HKEFHLSSADPKLVGEDKARKIGRTNYDVADQLANLGMEAIHPGAGRGLRQSGIPLRVRN
TFDREDEGTLVTGDYVSDVPRVEIVTGLRQVQALQFFEQDMVGVKGYDAAILDALARHKL
WIVSKSSNANTITHYLSASAAAVNKAIADLQGHYPDAAISAQPVAMVSVIGSDISRPGLV
PDALRALDAAGVTMIAMQHQIRNVDVQFLVDPRDFEAAVRALHKALVERDARTEEKRRAA
>Dole_Ab_|_CG-02
MGNHTVEKIGGTAMSQFDKVLDNIIVGDRKEKDLYNRIIVVSAYGGITNELLEHKKTSDS
GVYSLFSKDDDSWAWGEAITRVGQRMCTINKGFEHLGLDVQLADRFVKERIEGVRSCLID
LTRLCSFGHFKLDEHLMTVREMLSAIGEAHSAHNSYLILKSMGINARLMDLSGWMDTDQL
SLDETIKKAFESVDVAEELPIVTGYTQCKEGIMGSYDRGYTEITFSRIAVLTGAREGIIH
KEYHLSSGDPKIIGEDRVETIGSTNYDVADQLSDLGMEAIHPGAARGLRKTDIPLRVKNV
FEPDHPGTLITNDYRSTDARVEIIAGRKGVTGIEVWDQDMVGRWDHDLEMLKHLAAAKIR
YLAKDTNANTLTHYIAAPLAKIKRLTDNIKQDFPSADILVKKVALVSAIGTNMADTWVLP
TAVHSLTNAGVEILGLHKCMRQVDIQFVVDEKDFQNAICALHRDLVETGR
>Dpsy_Aa_|_CG-02
MMVRIMKPLRIEKIGGTTMSRFGEVLDNVIFYDSEDIFNRIYVVSAYSGVTNALLEHKKT
HQPGIYQTFVQNEACDMAMERLKTTLCEINRGFADIGLDLEVANNFICKRIQDAVEVLHS
MANVLSSGYVNRSEMLLAARELLASIGEMHSAFNSANILQNRGYKASYVDLSGWQDSRDM
TIDQRILETFTKFDPSDTICIATGYAKGREGIMREFDRGYSEVTFSKIAVLLKASEAIIH
KEYHLCSGDPLIIGEDKVHPICNTNYDVADQLADVGMEAIHPKASKQIEIAGISIRIKNS
FDPSHSGTLFTKEYICPQSKTEVITGSDKVTCLEVHDTRMVGEVGFDMKIMEVLSAHQVS
YINKATNANTIGVIVYDNDCTEELLRDLRAEFELVTDMHTAIVCAIGSNIAKPGILAKAT
NALATSHINILAVSQTSRQTNMQFIINREHFKEAQRVLHAALCEEGES
>Adeh_Ab_|_CG-02
MWRTFGYHRGPSSPGPESRTATQSPGTFRMISVEKIGGTSMSRFDEVLRNIMLRDPSRVY
GRVYVVSAYAGVTNQLLEHKKTGEPGVYARFANGGDFTTAIEALTGKLKAINAGLAPLGL
DLARADGFIEKRMKELRALLDSMRHVLASGYVRRDSVLLAAREMLAAVGEAHSAFNSVEL
LRAKGVEASLMDLSGFDDDDPLTIDERIHKCFTGVDVTRQVVVVTGYTKGVEGIMREFDR
GYSEVTFSKVAVELRADEAVIHKEYHLSSADPELVGAQNTVVVGMTNYDVADQLADVGME
AIHPKAAKPMELAGIAIRLKNTFEPEHPGTLITKDYVGSQARIEVIAGSPKVSAVEIHDP
SMVGTVGFDLGVMEIFQRHGISYILKATNANSITHVVWEKSVSSAFVEELENQYQKVTVV
PSAIVCVIGSNIAFPGVLARATQALADNGINVNAFSQSLRQTNMQFVIDRKDYKQAVIAL
NRALCLNPPTQAVA
>Mhyd_Ab_|_CG-02
MTTAQHTVEKIGGTSMSNYEAVRDNIIIGKRKKSDLYQRIFVVSAYGGVTNELLEHKKTG
EPGVYALFADAESDWAWGDDLTKLIQLLTDINGELFADPMLKQQADQFITDRIEGVRGCL
IDLQRLCSYGQFQLEEHLLTVREMLAGIGEAHSAFNTALKLQQEGINARFVDLTGWRDSE
LLPLDEKLKQAFDAIDLSRELPIVTGYAQCKEGLMRTFDRGYSEMTFSRTAVITNAREAI
IHKEYHLSSADPNIVGEDKVVPLGRTNYDVADQLANLGMEAIHPRAGKGLRQNEIPLRVM
NTFEPEHTGTLITGDYVSEKPQVEIVAGAKGVFAIEVFDQDMQGEPGSDRRILDVLSRFK
VRFMSKDTNANTITHYVDTTLKHVKRVVKALEEEFPNAEISTRKVALVSAIGSDMKVPGI
LARSVKSLADNDISVLAIHQCMRQVDIQFVVDEDKYDQAIVALHGALIEPHNHEYAIVAA
STTAG
>Sdeg_Ab_|_CG-02
MLTVEKIGGTSMSDYLTVRDNVVLGPNGENPTTGRILVVSAYGGMTDQLLEHKKSGKAGV
FAYFSSDEDAGSWREALNNVRQNMFQKNAELFNSADAISKANVFIGERLDTAERCLEDLQ
RLCGHGHFSLEAHLSTVREMLASLGEAHSARNMAELLKEEGVNARFVDLTGWNADKSLGM
DEHILEQFKDVDLGNELPVVTGYAHCESGIMSTFDRGYSEMTFSRIAVLVQADEALIHKE
YHLSSADPKVVGVDAAVPIGRTNYDVADQLANLGMEAIHPKAAKGLRQSNIPLRVKNTFE
PDHNGTLITTDYVSEKPCVEIIAGKQAVYAVECFNQDMVGDLLNFEQKIMQICQRFRCTH
VTKDVNANTVTHYLSSNMKKIKRVQRELEEMFPESEINVKKVSIVSAIGSDMQVPGILAK
TVGALADAGISVLAVHQSMRQVDMQFIVEEAAYEAAVRALHKCLVEVHDHGIAICAA
>Noce_Ab_|_CG-02
MNGHTVEKIGGTSMSRTQEVLDNILMGKRKEQELYNRIFVVSAYGGITDMLLEHKKSGAS
GVYALYAGAESDWAWGDLLNKVGERMCEINMEIFEDDLSCQKADQFVRERIEGVRSCLID
LHRLCSYGHFQLDEHLITVREMLAAIGEAHSAFNTALLLQQHGVNAHFIDLTGWRELDNL
TLEERIQQAFNSLDLARELPIVTGYPRCKEGTMMIYDRGYSEITFSKIAVLTEAREAIIH
KEYHLSSADPKVVDKDRVEPIGRTNYDVADQLSNLGMEAIHPKAAKGLRQCHIPLRVKNA
FDPDHAGTLIDGDYKSDTPCVEIIAGRKGVFAIEFFEQDMVGSSGYDTQLLALLERFKLK
IVAKDTNANTITHFVASSLKAIKRVTHAMEDAFPSAAVAVRKVALVSAIGSNMQVPGLLS
NAVSALAKADINILALHQSMRQVDMQFVVDEKDYEEAIIHLHEHLIESYSLPAPRSVGAA
>MARI_Ab_|_CG-02
MMGQHTVEKIGGTSMSDYRSVRDNIIFKPTLVNNMYQRVFVVSAYAGMTDKLLEHKKTGD
AGVFALFAQERKQNNWFPALQDVRAAMLEINHSLFEAGELRHKADAFLNSRLQEAQECLE
DLHRLCQHGHFSISEHLATVREMLASLGEAHSAWNTAHLLQRDGVNAVFVDLTGWNSPSH
MSLDERILDAFKDVDLSKELPIATGYAHSETGLMSTFDRGYSEMTFSRIAVLTQAHEAVI
HKEFHLSSADPRLVGESKAVPIGRTNYDVADQLANLGMEAIHPKAAKGLRQSGISLRVKN
TFEPEHTGTLITGDYVSDAPCVEIIAGCRGVFAVELFDQDMAGDIDKFDVDILKVLRQFH
AHIIAKDINANTITHYLAINLKTLKRVMRVLHERFADAEITQRKVAIVSAIGSDMKTTGM
LAKAVKAIAEQEVNVLAMHQSMRQVDMQFVVDEEDYEKAICSLHKELVEVHNHGRAICLA
>Pstu_Ab_|_CG-02
MHTVEKIGGTSMSRFEEVLDNIFIGRREGAALYQRIFVVSAYSGMTNLLLEHKKTGEPGV
YQRFADAQSEGAWREALEGVRQRMLAKNAELFSSEYELHAANQFINSRIDDASECMHSLQ
KLCAYGHFQLSEHLMKVREMLASLGEAHSAFNSVLALKQRGVNARLADLTGWQQEAPLPF
EEMISSHFAGFDFSRELVVATGYTHCAEGLMNTFDRGYSEITFAQIAAATGAREAIIHKE
FHLSSADPNLVGADKVVTIGRTNYDVADQLSNLGMEAIHPRAAKTLRRAGVELRIKNAFE
PEHGGTLISQDYKSEKPCVEIIAGRKDVFGIEVFDQDMLGDIGYDMEISKLLKQLKLYVV
NKDSDANSITYYASGSRKLINRAARLIEEQYPAAEVTVHNLAIVSAIGSDLKVKGILAKT
VAALAEAGISIQAIHQSIRQVEMQCVVNEEDYDAAIAALHRALIEPENHGDVIAAA
>Tcru_Ab_|_CG-02
MSNTQKTTLSVEKIGGTSMSDYQAVRDNIILYPENFYNRIFVVSAYGGITDDLLEHKKTD
QPGVYGLFANDDVDDDWRIALDQLSLKLNKINANLFSDDELRLKANDFIDERIAETKQLL
NHLQDLCRHGHFSLESHLLTVRELLASLGEAHSAWNLAHLLQTEGVNARFVDLTGWQADE
ALPLDAMIETHLGDIDFTKELPIVTGYTHCRENLMYTFDRGYSEMTFSRIAVLCQATEAV
IHKEYHLSSADPRLVGEDNVVPIGKTNYDIADQLANLGMEAVHPRAAQGLRQAQIPLRIK
NTFDPGHHGTIFTEDYVSEYPQVEIIAGMQHLIALEVFDQEMMGQQGSYEKVIIDATNRL
KCQVITKDFNANTITIYLKASLKKVKRLAEQLKQGLPTATINTSKVALASAMGSDMRIKG
LLAKAVQTLFDQGINVEAIHQNTRQVEMQFFVNETDYEKAVKALHTNLIEVHNHGKAICE
>Ppro_Ba_|_CG-02
MSYTVEKIGGTSMSAFDAILDNIMLRPKSPYNRVFVVSAYGGITDALLECKRSGKPGIYQ
YIAKRDETWLKAVADLEMRMLLVNENMFADPLNRRRADQFIKSRITDAVSCITNIIETCQ
YGQFSLRHYLPQIREFLSSLGEAHSAYNTALKLKTLGINATFVDLSGWDNKSYGSLDDVI
KRAFTNIDVTKELPIPTLLQNADFADSNFMILCPKNSSIFNDHGYITYYLSGGMEILNKL
LYKAEKRYSNSTITGCMVTFISIIGASINTNTALSKGILALTDKQISPIAAHSSMRNVNV
QFVVEDKYYKAAICALHSEFINQSENTTRKIA
>Vcho_Fa_|_CG-02
MMSYTVEKIGGTSMTAFDAVLENILLRPEQLYGRVFVVSAYSGMTDALLECKRTGAPGIY
QKIAKHDESWRDAVYALEQRMLLINENMFADAMTRLRADKFIRARLAEAIACIQNILQTC
QYGQFSLRQYLPQIREFLASLGESHSAYNTALKLNTLGVNARFVDLSGWCEAMQGNLDQV
IEEAFRDIDVTSELPIVTGYASCQEGLMRTYDRGYSEMTFSRIAVVTGAQQAIIHKEYHL
SSADPRLVGAEKVRPIGLTNFDVADQLANLGMEAIHPNAAAGLRQSNIDLRIKNTFEPDH
SGTLITASHQPQQDRVEIIAGRDKVFALHLFDQSMVGMMDKVSHELIEWIHAAKVQLIGK
EMNANSVTYYLSGSSEPLNHIRYQAEKRYPQAKVSGRMVALISAIGAHMETNKVLAQGLQ
ALLEHQLQPMAAHSSMRNVNVQFVVDDADYANGVCVLHQALMPFAQPSSARKVA
>Vfis_Ac_|_CG-02
MTYTVEKIGGTSMTAFDAVLDNIFLRPKDPYNRVFVVSAYGGITDSLLECKKTSKPGVYQ
LIAKRDDKWEEALEYVEKRMLLTNEHIFIDPMNRIRADKFICSRIKQAKNCIANILETCQ
YGQFSLRRYLPQVREFLSSIGEAHSAFNTALKLKTMGINAKFVDLSGWDNQPPRSLDDTI
INVFKDIDVTKELPIVTGYAYCQEGLMGTYDRGYSEMTFSRIASLTQADLAIIHKEYHLS
SADPRVVGTDKVFPIGRTNYDVADQLANLGMEAIHPNAAAGLRESNIEIQIKNTFEPKHK
GTLISSDYQPETDKVEIIAGKEKVFALHLFDQTMVGQVDNVSYELMEIISDAHVNLIGKE
MNANSITYYLGGNTESLNKVLYKTEKRYPNASIKGRMVALIAVIGSQIDTNKALAKGVLS
LMNSDVTPVALHSSMRNVNVQFVVSDKDYQNAIKALHHEFCEEVPAKQVKTSQVA
>Vpar_Ac_|_CG-02
MTFTVEKIGGTSMTAFDAVLDNIILRPKTPYNRIFVVSAYSGMTDALLECKKTSKAGVYQ
LIAKRDDQWQDALAYVESRMLLTNENIFADPMNRIRADKFIRSRIAEAKNCIANILETCQ
YGQFSLRHYLPQIREFLSSIGEAHSAYNTALKLKNMGINARFVDLSGWDNQEPRSLDDSI
RDAFADIDVTKELPIVTGYAYCKEGLMHTYDRGYSEMTFSRIAAITKADLAIIHKEYHLS
SADPRVVGPEKVLPIGSTNYDVADQLANLGMEAIHPNAAAGLRESGIELQIKNTFEPEHE
GTLISSGYRPEEDKVEIIAGKEKVFALHLFDQAMVGKVDNVSYELMEIISDARVSLIGKE
MNANSITYYLGGSSDSLNKVLYKAEKRYPNASIKGRMVALISAIGSHIDTNKTLAKGVLS
LMNSGVTPVALHSSLRNVNVQFVVSDKEYQRAICALHDEFFTPVEGSNAMEHVA
>Bcla_Ab_|_CG-03
MKVAKFGGSSVANAEQIKKVAAIIKADNKRKIVVVSAPGKRYADDAKMTDLLIALAEAKV
ADQPVEAAFNAVMNRYESIANDLELNRDVIAEIEADLKNRLEQTVTGKGRFLDIMKASGE
DNNAKLIAAYLSKIGLKATYINPKDAGLLVSDEPGNAQVLPEAYEALAKLAEIDGIVVFP
GFFGFSKLGNLVTFPRGGSDITGAILAAAVQAELYENFTDVDSVYAANPFIVEDPVEIKR
MTYREMRELSYAGFSVFHDEALIPAFRNDIPVCVKNTNNPKCSGTLILAERERSLNPIIG
IASDEGFATIYVRKYLMNREVGFGRHLLQILEDAGISYEHIPSGIDDTSVIIRQTQLSDQ
LENAIIERIKEELNVDDVHIEHDFAMVMLVGEGMHNTVGVTARASSALAKAGVNIEMINQ
GSSEVSLVFGIHSKDTKQAVRVLYEEFFGQKQ
>Bhal-1_Ac_|_CG-03
MKVTKFGGTSVASAEQIRKVATIVADDVERKIVVVSAPGKRHSSDTKVTDLLIRLGETYL
EKGYANEELEAVLRRYEEIAKGLELGQEIIDQIANDLHTRLTFNQSNPGAFMDQLKASGE
DNNAKLIAAYLQTKGMNAVYVSPKEAGLLVSDEPGNAQVLPEAYDHLKKLRERDEMIVFP
GFFGFSPDGALVTFPRGGSDITGAILAAGVKAELYENFTDVDSVFAANPNVVESPAQIRR
MTYREMRELSYAGFSVFHDEALIPAFRQKIPVCVKNTNNPSSPGTMILAEREYFLNPVIG
IAADKGFATIYVRKYLMNREIGFGRRLLQIIEDEGLSYEHIPSGIDDASVILRQEQLTDE
IEHRILARIKEELCVDDVFVEKDFAMVMIVGEGMHNTVGISARATAALARAHVNIEMINQ
GSSEVSLVLGIHEKDADAAVRELYEEFFGGAEETVQ
>Blic_Ac_|_CG-03
MKVVKFGGSSLASGAQLEKVFQIVTSDPERRAVVVSAPGKRHPEDTKVTDLLIECAQQYL
LSKEATGLVEAIVGRYADIALELGLADDVINRIRADLLQLLEGDKTNPERFIDAIKASGE
DNNAKLVAAYFRHRGVEAHYVSPKDAGLFVTSEPGNAQVLPESYDNLFQLRQQKGIIIFP
GFFGFSQEGEVMTFSRSGSDITGSILANGLKAELYENFTDVDAVYSVNPAIVSNPKEIRE
LTYREMRELSYAGFSVFHDEALIPAFRARIPVQIKNTNNPDAEGTRVVATRDNTNGPVVG
IAGDSGFCSIYISKYLMNREIGFGRRVLQILEDEGLTYEHIPSGIDDITIILRQNQMDQA
AEKRMIKRIKEELDADEVAIEHNIALIMVVGEAMRHNVGTTARASKALSEAGVNIEMINQ
GSSEVSMMFGVKEAQEKQAVRALYQEFFAKVLV
>Bsub_Ac_|_CG-03
MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAEDTKVTDLLIACAEQYL
ATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVENPKEISE
LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
IASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEHVPSGIDDMTIILRQGQMDAA
TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
>Gkau_Ab_|_CG-03
MKVAKFGGSSVASAAQFRKVADIVSSDIERRIVVVSAPGKRYKDDVKVTDMLIQLAEQVV
AGEPHEETMEAIVKRYADIANELGLEADGFLAELVDDLQSKISAYRSEPPRLFDAIKASG
EDHNARLMALYLQDCGLEASYVSPLEAGIIVTDEPGNAQVLPESYDKLKQLRERRGVLVI
PGFFGYSRSGHIVTFPRGGSDITGSIVAAGVKADVYENFTDVDSIYCVNPSIVADARKLK
EITYREMRELSYSGFSVFHDEALEPVYRAGIPVCVKNTNNPAAPGTWIVAKRNHIDEPVA
GIASDTGFCSINISKYLMNREIGFGRRVLQILEDEGISYEHTPSGIDNMSVILRADQLAD
GKDERILARIREELAVDEVTIEYGLALIMVVGEGMEKTIGMAAKATTALANANINLEMIN
QGSSEVSMMFGVKEEVVNEAVRALYNAYFQQATVNHLS
>Oihe_Ab_|_CG-03
MKVAKFGGSSVANAEQIQKVANIIKADPSRKVVVVSAPGKRFKDDVKITDLLIEFAGSHQ
RKQFEQSEKTLTIIMDRFKEIVDNLNLHTSIIDDIKQTIEEDLNKDLSPNQLLDAIKAIG
EDSSAKIVSAYLQHIGIDATYMNPKDAGIYVSNEPGHAQLLPESFPIIKKLRDIDKVVVI
PGFFGYAENGELVTFSRGGSDITGSILAAGTKAELYENFTDVDSVYAVNPTIVNNPKEIN
VLTYKEMRELSYAGFSVFHDEALIPAFREQIPVCIKNTNNPDSPGTMIVSERDARDNCVV
GIASDVGFCSLYVSKFLMNREVGFGRKLLNIFEDEDISFEHAPSGIDDMSVIFRDHKFTP
EKERIVIDRIKNELHVDTVSIHRDLAVIMVVGEGLVNTIGVAARATSSFSKARVNIEMIN
QGSSEVSMMFGIHAEDIDKAIQSLYHEFFEVSQKVEEAETKILT
>Linn_Ac_|_CG-03
MKVIKFGGSSLASGIQLNKVFQLVAEDSERKIVVVSAPGKRFKDDTKVTDLLIDCAAKAL
LGEDTSELFEAVIARYAGIALDTGMDDAIITQIRADLQKTISSDKSDPDKFLDRMKASGE
DNNAKLIAAYFKFKGLNANYVNPKDAGLFVTDEHASAQVLPESYDRLFALREREGIIVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
TERTIMTRLKEELNADQVIMQHGISLIMVVGEAMRHNVGITSRASKALSDAKVNIEMINQ
GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
>Lmon_Ac_|_CG-03
MKVIKFGGSSLASGIQLNKVFQLVAEDPDRKIVVVSAPGKRFKEDTKVTDLLIDCAAKAL
LGEDTSELFESVIARYAGIALDTGMSDEIINQIRADLQATISSDKSDPDKFLDRMKASGE
DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
>Lwel_Ac_|_CG-03
MKVIKFGGSSLASGIQLNKVFQLVAEDSDRKIVVVSAPGKRFKADTKVTDLLIDCATKAL
LGEDTSELFEAVIARYAGIALDTGMDDTIIKQIRSDLQATISSDKSDPDKFLDRMKASGE
DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFSEH
TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
GSSEVSIMFGVKEEQENTAVRALYDEFFSEVFV
>Saur_Ab_|_CG-03
MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLYEKVI
NHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALLSCGE
DFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEKLIIP
GFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPELIEE
ITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAKNVIS
GISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSKQIQN
KETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLKMINQ
GASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
>Sepi_Ab_|_CG-03
MKVAKFGGSSVSTAEQIKKVLTIVNEDPERKIIIVSAPGKRHNDDIKTTDLLIRLYEKVL
NKLNYESKKQEIIQRYADIVEELGIGNDILITINDTLEEYIKNLSDKPNRLYDALLSCGE
NFNAQLIAQYNNSQGIPTRYISPKEAGLTVTDLPQQAQILDSAYNDIYKLRDYDEKLIIP
GFFGVSKQNYIVTFPRGGSDITGAIIARGVRASLYENFTDVSGIYKANPNIINNPELIEE
ITYREMRELSYAGFGVFHDEALQPLYKDRIPVVIKNTNRPNDKGTYILHDREIDSKNVIS
GISCDKGFTVINIKKYLMNRLVGFTRKILGVLEDYNISFDHMPSGIDNISIIMRTNQIQG
KESQVLNAIRKRCEVDELSIDHDLAVLMIVGEGMNQVVGTASKITHALSESNINLIMINQ
GASEISMMFGIHEADAEKAVLSTYEFCYNGVCLKNLCK
>Shae_Ab_|_CG-03
MKVAKFGGSSVSNATQIKKVLDIVNSDSDRKIIIVSAPGKRHKDDVKTTDLLVRLYEKVM
NNLNYQDKKKEIIQRYADILHDLDMDDSLLKVIDDTLEEIISTLKDKPLRLYDAILSCGE
NFNAQLIASYNDSQGFKTTYLSPKDAGILVTDLPQQAQILEEAYEKISKLKDIEGKIIIP
GFFGVSKNDYVVTFPRGGSDITGAIIARGIRASLYENFTDVSGIYKANPNIINNPDLIEE
ITYREMRELSYAGFSVFHDEALQPLYKHRIPVVIKNTNRPQDKGTFIRHDRDVSDKNVII
GISCDKGFSVINIKKYLMNRQVGFTRKILEILEDYNISFDHMPSGIDSISIILRTYQLKG
KEKDVLNAIRKRCDVDELSIEHDLAILMIVGEGMNKAIGTANTITHALAESNINLKMINQ
GSSEISMMFGISIEDADKAVLSTYEYCYHGICLKNLNKQA
>Ssap_Ab_|_CG-03
MKVAKFGGSSVSNAEQIKKVLNIVNSDVDRKIIIVSAPGKRHSEDVKTTDLLIRLYEKVI
DRLDYTSKKKEIIQRYADIIDELNMDYHLLTSIDETLESYIAILKDKPSRLLDALLSCGE
DFNAQLIAEYNNSQGIPTRYVSPGEAGIQVTDLPQNAQILEQSYNTLYKLREYNEKLIIP
GFFGVSRQNYIVTFPRGGSDITGAIVARGVRADLYENFTDVSGIFRANPTIVKNPEVIDE
ITYREMRELSYAGFGVFHDEALQPLHKDRIPVVIKNTNRPDDIGTYIRHDREINSNNIVS
GISCDKGFTVLNIKKYLMNRQVGFTRKILAVLEDYGISFDHMPSGIDNISIIMRSKEIQN
REEQVLNDIRKNCDVDELSVEHDLAILMIVGEGMHRIVGTANTITHALAESNINLKMMNQ
GASEISIMFGIHVSDADKAVKSTYEYCYNGICLKS
>Efae_Aa_|_CG-03
MNVVKFGGSSLASAPQLQKVLQIVKEEPRRTFVVVSAPGKRTPQDIKVTDLLIQYYQRYL
NNEEIESTISAIIRRYEDLFDELHLDKAVLADIAISIRQLATLPKENNAFLFDYFLASGE
DNNAKVVASFFKQNGLDARYISPKELGLLVTPEPGNARILPKALEKISVYRETQQILVIP
GFFGYTEAGEICTFSRGGSDITGSIVAAGVQADLYENFTDVDGIYVAHPGIIEQPQTIQE
LTYREMRELAYAGFAVLHDEALMPAYRANIPVVIKNTNNPHHPGTLITTSRKVKHAPVVG
IASDQGFASIYISKYLMNRELGFGRRLLEVLEKLALSYEHMPSGIDDITIVLREDQLTTE
IENRLMAQLQEVLAPDELRITHHLSMIMIVGEGMRQRIGVTAESTMALAKEKINLEMINQ
GSSEVSIMFGIKKEQEEKAIKALYRTFFHD
>Laci_Aa_|_CG-03
MKVVKFGGSSLATGNNVNKALNIIKNDSSRQVIVVSAPGKRTDDDIKVTDLLITYAYTSL
RSNNYDDTVEKIFRRYELIAQYFDLPESDLTKIKRLLLTLPTYDYPNADYRMATFKAHGE
RLNAILIAKILNHQGIKTRYLEPKDVGLIVTGTPNNAEVNPETYVNLKRINLKNNEKIIF
PGFYGITPSGHIATFSRGGSDITGAILARGFDAELYENFTDVDAIFSANPNIVTNPAPIK
KMTYQEMRELSYAGFSVFHDEALIPAIQGEIPVNVKNTNDPEKPGTLIVPEDGFIPKHTI
TGIAGGKNFAALYLRKYMLNKGAGFTLKLMEIFDRHHVSYEHMPSGIDDLTIIFKKDALS
DQLIDVICNEIQTSLNPDQMQWIDDYAITMVVGEGMKDKLTLCASILYPLGEKNISIQMI
NQGASQISIMIGTRRQDEEEVIKTIYQNFIENR
>Laci_Ab_|_CG-03
MKVVKFGGSSLASGQSVEQALNIILNDPERQVIVVSAPGKRNNADTKVTDLLIKYAEQVL
KHEETDAIVKQIFARYQEIGYFFGLNDEKLQIIQNILLALPNQNYPDNNYLMAAFKAHGE
RLNARLIALILQHENIKSRFLDPVDAGLIVTGEPNDALVNPESYLNLDQIKIDPNEKIIF
PGFFGITPSGNIATFSRGGSDITGAILARGFHANIYENFTDVNGIFAANPNIVMHPISIK
KMTYREMRELSYAGFSVFHDEALIPAIQGQIPINVKNTQEPDNPGTMIVPEKNFSPDNTI
TGVTSQKHFSALYLHKYLLNKEAGFTLRILQILYKHNIPYEHMPSGIDDITIIFNNDFLN
DQLIDQICNEIQATINPDQLEWIDDYAIIMVVGEGMKKTPGVSRQILDSLASQGITPRMI
NQGASQISIMIGTKKEKADKAVKIIYQDFFN
>Lcas_Ab_|_CG-03
MRVVKFGGSSLANGSQFAKVVAIMKANPARQVIVTSAPGKRHPGDTKVTDLLIQYAQAVM
RHEAVAAIVAEIVARYQAIADDFELEASIMAAIEEELDQLPKLTFKNNDYLMAGFKARGE
KLNAFLMTAVLNHEGIEATYGEPKSLGIVVTDHPNDAEVSRETYRNLATFRRPIGVLVVP
GFYGYTSDDDIATFSRGGSDITGAILANGFHADLYENFTDVDGVAAADPRVVANPQMIRE
MTYREMRELSYGGFGVFHDEAILPAIAGQVPINLKNTNHPAAPGTMIVPEQHFVPKHAIT
GIVSSQHFGAIYLHRYLLNKEVGFTLKILQVLAHNGISYEHMPSGIDDLTIILDDRQLTE
AKRKTICAEIQAAVHPDVLKWIDDYAIIMVVGEGMAQRTGLIQTILQPLATAGVHVSMIN
EGASQISLMLGTSRESANRAVKTIYNAFFIPINQRLEVH
>Lcas_Aa_|_CG-03
MKVVKFGGSSVADAGQFQKVKAIIDQDVNRQIVVISAAGKYGNATRKLTDTLYLIADGME
AGRDVEPLFNQVLARLEAINIALQLNVPLIKLLHTIRHHLAIRYSRDYLVSRGEFLTAHL
MAAYLGYTFVDAANLLFFNKAGAIDEAKTQTAYQQLASQHGIVVPGFYGRDADGHVKLMP
RGGSDISGAWLARLAHADLYENWTDVSGIKMADPRIIKDADSIDVMSYDELRELTYMGFS
VFQEEAVQPVRECGIPTRILNTNAPEVPGTLIIHDDDPANDLKTITGIAGRKHYLVITVR
KYQLALHLEVIQHALGVVAAHHLVVDYLPTGIDSFSLLIREPRRQVSVQELTAEIAAACQ
PDKMEVTENVALIAMVSRKLRQRPAIAGKVLAYLDDNLLNVQLVSQTNDDINLLIGVHDL
DYDKAVRVIYSSIHQNFQRPAPYIEGIA
>Ldel_Ba_|_CG-03
MSKVVKFGGSSVANSEQFKKVKQIILADPDRKYVVTSACGKSGQEDHKVTDLLYLCAAHI
TYDVSYESIFQSIVDKYMEIKRSLGLKIDLAGEFAKIRQNMAQNLNLDYLVSRGEYLTGL
CLAEYLDADFRDASQVIRFHYDGSIDLDKSQELLKAQVDPGRRVVIPGFYGSLPNGVIKV
MSRGGSDITGSIVANAFDVDVYENWTDVSGFYVADPRIIKDPVQIPRVTYSELRQMSYMG
ANVLHDDAVFPVRQKNIPINVRNTNHPENPGTMIMNDCSELDAQEPPHVITGITGKQDFT
VITMVKSHVSAEAGFLRKVLAVFEKFQISIESVPVTVDTFSIVVQTKKIERYLYEIVAEL
QQDLHLDDIQVESQQAMLAVVGRVMRQMPGMSGKILSTLGDQQINIRTINQACDEQSIVI
GVNNQDLVPAIKAIYQQFISEERVER
>Lgas_Aa_|_CG-03
MKVAKFGGSSVASGAKIAQVINILNNDNKRQVVVVSAPGKRSKSDTKVTDLLIKYANLTL
RKQNCEKIQAQIYARYAEIGKYFDLSMQGLNEIKALINDLPTHTFPNRDYLMAAFKAHGE
FLNAKLLTMIMKKQGFKVRLLTPRQAGLVVTGSPNDASVNPETYVNLRNLELDPTEKIIF
PGFYGISPSGNIATFSRGGSDITGAILARGFTAELYENFTDVDAIFSANPAIVSHPQPIS
KMTYREMRELSYAGFSVFHDEALIPAIQAQIPVNVKNTQHPERPGTMIVPETNFKAQHTI
TGIAGGKNFAALYLHKYLLNKGAGFTLKILQILDQHKVAYEHMPSGIDDITIIFKKEDLN
AELIDQICNEIQVSLNPDQMQWIDDYAITMVVGEGMRDKLSLCASILYPLGQKNISIQMI
NQGASQISIMIGTRRGDAEEVIRTIYQTFFN
>Lpla_Ab_|_CG-03
MKVIKFGGSSLASSQQLQKVLAIVEADQKRKYVIVSAPGKRFDGDTKVTDLLIQYARQTI
HHQDTQAVTAAIIDRYAEIGHGFNVPEAQLTPIFETIRNLPKQSYADNTYLMAAFKAHGE
RLNAQLVAAVFQQSGLNARYLDPKDAGMVVTDVPDDAQIIKSSYDQLAKWANSEQILVIP
GFFAYNRNGQICTFSRGGSDITGAIIARGVHAERYENFTDVDAIYAVNPSLVAKPAAISE
MTFTEMRELSYAGFSVFHDEALIPAIEDNITVNVKNTNHPEAPGTLIQSTREPNPHYPVT
GIASSSSFCSLYLRKYLLNKEVGLGRKILTILENHHISYEHMPSGIDDLTIIFDEHQLTP
ELEKTLVAEISTAINPDEIYFTHDYSILMLVGENMRNRVGIMSRAATALANDNIKLIMVN
QGASEISIMFGVHDNDADQAVIALYKEFFD
>Lreu_Aa_|_CG-03
MKVVKFGGSSLANGEAFQNAINIITSDPQRRVIVTSAPGKRFADDIKVTDLLIKYAQTVI
AGQNPQEIVEQILNRYQEIAAYFGLPADKLIPLAERLEGLPNHTYPNDNYLLAAFKAHGE
RLNAQLMAILLQHLGYEARFVTPSEAGIIVTGTPNNANVIPETYANLSHFTFNENELLIF
PGFYGLTLAGHIATFSRGGSDITGAILARGLHASTYENFTDVDAIYSANPQIVDHPQPIT
TMTYREMRELSYAGFSVFHDEALIPAIQGNIPINVRNTNDPEKPGTMIVPDKDFQPSDIV
TGVVSGKHFAALYLHKYLLNKQAGFTLRILEILAKHNVSYEHMPSGIDDITIILDRNAIN
DQLIDTICNEIQEEINPDRLEWIDNYAITMVVGEGMRNRTGVIDDILMPLAEKHIAVPMI
NQGASRIAIMIGTYNEDADEAVRAIYHRFFAN
>Ppen_Aa_|_CG-03
MVKVVKFGGSSLANAAQYQKVIEILRADPERRIVVVSAPGKRFKDDVKVTDLLIKYANAS
GENVKVARQAVLDRYQEIADAYHVSDSDFEQINVHLIDLANLHHANKACRLAHFKAAGER
LNAILMALVLKKFNVTARFVDPKQLGIKAHGDYNNAILDQHSYAQIEAVCSNLLDEAEYL
VVPGFYAYNQNGEVCTFSRGGSDITGAILARGFQAQLYENFTDVDSIYSADPKIIAQPHP
IREMTYREMRELAYAGFSVFHDEAIIPAIEAQVPIVIKNTDHPNLPGTVIEPEQNYASDL
EITGVASSSRFAALYIHKYLLNREVGFTLKLLKILYRYDISYEHMPSGIDDLTIIFNQNQ
ITDEILPSLLSDIREELHTDQLEWIDDYAILMVVGEGMRDKVGVVDRIVNALARKQIGIQ
MINQGASRISTMLGVHQNQVNQAVREIYREFFKNKGRAD
>Lmes_Ba_|_CG-03
MKVTKFGGSSLANGQQLQRVYDIIRADDDRKVVVVSAPGKRFKDDRKVTDLLISYAQATL
ADEDTTEIIETIKHRYHSIGEYFELPDYELADLDEQIEHLARKHYRSFDYLYAAFAAHGE
YLNAQLIAKVFNHLGMPARFVDPKEIGLVVDDNARSATFDAASYTTIGELDLSTSERLIV
PGFFGYTKNGDMATFSRGGSDITGAIMARGLRADLYENFTDVSAIYAVNPSIVEHPAAIQ
QMTYDEMRELSYAGFAVFHDEAIIPAIQGGIRINIKNTNDPDAPGTFIVPPTEVQQTRPV
TGIANSNRFAALYLHRYLLNKQVGFTLRILEILKRHNISYEHMPSGIDDLTIIFDKTMLT
QEQVDNMLSDIAAEIKPDTLKWIPSYGIIMVVGEGMRNRVGALTEIVAPLKERNISLQMV
NQGASEISIMLGIQPDLSDSAVEAIYTNIFK
>Ooen_Aa_|_CG-03
MKIVKFGGSSLSSGVQIRKVFQIVKSDPERRIVVVSAPGKRFKGDVKITDLLLKLAEAIL
NEEKTAQIYEQIFLRYQAIGDFFKIPRSGIEQLKEHLYSVAQADYPSNDFFRAALSAQGE
NMSAHLITLIFKQLGLKARLLTPKEVGLTVSGEARKAQILPGSYAKIAKTKFTDNEVLIF
PGFFGITKNGLINTFSRGGSDITGAILARGFGADLYENFTDVDSIYAVNPGLVADPAPIK
EMTYNEMRELSYAGFAVFHDEAILPAIQGKIPICVKNTNRPEMPGTKIVPRDKVSHKNKI
TGIASSHHFQAIYLHRYLINREVGFTAKILKIMADLNISYEHMPSGIDDLTIILDKNQLT
NGRKEKLTQRIKDEIQPDDLQWRNDYAIIMVVGEGLVNRVGAMADIVDPIRDAGISLTMV
NQGSSEISIMLGVRPEDEQKAVKAIYNDHFENGHPKKELQIPRASFKSVSKSLIANFFV
>Llac_Ca_|_CG-03
MKVAKFGGSSLASATQIKRVFDIVQADKLRKFIVVSAPGKRSGADTKVTDALISYYKAYK
TADDKGIQYYQNWIIARFREIYDELELKSSVIDEIADNIHNLAHLDLENVFTYDTFLAAG
ENNNAKLIADFFTHSGLPSRYVHPSDAGITVSSDPGNARLLVGAYEHIKYLNDLEETLII
PGFFGVTKEGEVCTFSRGGSDITGSIIAAGVSAELYENFTDVNGIFAAHPGIVKNPAYIA
ELTYREMRELAYSGFSVLHDEALVPAYRARVPLVIKNTNNPDHPGTKIVVQRETKGSPVV
GIASSSAFSSLYVSKYLMNREVGFGRKVLSVLENLGVRFEHMPTGIDDMSIIIRSRYLTQ
PISKALISNLTESLHPDEVYIDRDFSIITIVGEDMKEHVGVTARATAALSKQGISIAMLS
QGSSEVSVMFIVKEKYEQEALKAIYSAFFD
>Saga_Ba_|_CG-03
MKVVKFGGSSLASSQQLYKVLNIIKSDYTRRFVVVSAPGKRYEEDLKMTDALIQYYQNYI
NGKDIVKDQTWIINRYQEIISDLSLGSTIAEEITRSIEQLASLPIENNQFLYDCFLAAGE
DNNAKLVATFFNQNDIPARYVHPNEAGIIVTKEPCNARIIPGSYDKIENLCLYNEVLVIP
GFFGVTEDNQICTFSRGGSDITGSLIAAGIKADLYENFTDVDGIFAAHPGVVKNPHAIPE
LTYKEMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPQQPGTKIVLKHTRSNIAVTG
IASDSRFASINVSKYLMNREVGFGRKVLQILEDLNISFEHMPTGIDDLSIVLREKELTPI
KEQEILNYLTRKLEVDYVDIQHNLSTIVIVGENMKSQIGVTATATQALSREKINITMISQ
GSSEVSIMFVINSKDEKRAIKALYETFFQK
>Smut_Aa_|_CG-03
MKVVKFGGSSLASATQLEKVLNIIKSDEERRFVVVSAPGKRDAQDTKVTDALIRYYRSYT
SDKDVTADQSWIINRYRAIIDELGLGQNILEKITKAIVDLANLPIEDNDFLYDTFLAAGE
DNNAKLIAEYFRKNGLSARYIHPKKAGIIVTSEPGNARIIPSSYDKLEELRDSDEVLVIP
GFFGVTIDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHKPHSISE
LTYREMRELAYAGFSVLHDEALIPAYRGKIPLVIKNTNNPEHPGTKIVLAHTGATIPVVG
IAGDDDFVSINLSKYLMNREIGFGRKILQVLEELNIRWEHIPTGIDDMSIILRGRELTPI
KEQEIISQLTRKLEVDEVEIERNLSIIMIVGENMKNHIGVTAKAAEAFSKKHINLEMISQ
GSSEVSVMFVIKTEQEKQAVRALYQTFFMKDE
>Spne_Aa_|_CG-03
MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAEDTKVTDALIKYYRDYV
AGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLPIEENEFLYDTFLAAGE
NNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSSYDKIEELTNTNEVLVIP
GFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIHQPHSIPE
LTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIVLKHSNDEFPVVG
IAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEHMPTGIDDLSIILRSRQLTPI
KEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIGVTATATRALSENKINIQMMSQ
GSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED
>Ssan_Aa_|_CG-03
MKVVKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRHDDDIKVTDALIKYYREYI
AGNDVTPNQQWIINRYADMVAELGLKPKVLEKISKSITSLATLPIEDNAFLYDTFLAAGE
NNNAKLIAAYFSQNGVPASYVHPREAGLVVSSGLVVSSEPGNARILPSSYDKIEELNNSD
EVLVIPGFFGVTQDGQICTFSRGGSDITGSIIAAGVKADVYENFTDVDGIFAAHPGIVHK
PHSIPELTYREMRELAYAGFTVLHDEALLPAYRGKIPLVIKNTNNPEHPGTQIVHKHSKD
HLPVVGIAGDAGFVSINMSKYLMNREIGFGRRVLQILEDLNIGWEHMPTGIDDLSIILRE
RELTPIKEEEILRQLVQKAEVDHAEIEHDLSIIMIVGEKMKSHIGVTSTATKALSENNIN
IQMMSQGSSEVSIMFVVEKNQEKAAIRALYRAFFEPQTQE
>Ssui_Aa_|_CG-03
MRMKVIKFGGSSLASAGQLEKVFNIVQSDSERRFVVVSAPGKRNAEDTKVTDALIKYYKE
YVNGKDVTASQEWIINRYQAMVDELGFTANSMKKIADSIISLASLPIDDNEFLYDAFLAA
GEDNNAKLIAEYFTHRGLPARYVHPKKAGIIVSSEPGNARILPSSYDKIEELRDTDEVLI
IPGFFGVTVDNQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIKNPHSI
KELTYREMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPTHPGTRIVHKHTEQTVPV
VGIAADDGFVSINLSKYLMNREVGFGRKVLQILEDLNIRWEHMPTGIDDLSIVVRERELT
PIKEEEILRQLNTKMEVDKAEIEHGLSIIMIVGENMKSHVGVTATATTALSKQNVNLAMI
SQGASEVSVMFVVKTEEKKRALHALYEAFFNEQ
>Sthe_Aa_|_CG-03
MKVIKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRNDEDTKVTDALIKYYKHYI
KGADVKADQEWIINRYQAMVDELGFKSKEMVKIAKAITDLATLPIEDNDFLHDTFLAAGE
DNNAKLIAEYFRNNDIEARYVHPREAGILVSSEPGNARILPGSYDKLEELRESDEVLIIP
GFFGVTSDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHEPHSIPE
LTYKEMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIILEHQGATVPVVG
IASDDKFVSINMSKYLMNREVGFGRKVLQILEDLNIRWEHMPSGIDDLSIIIRERELTPI
KEQEILSYLTRELGVDEVEIEHGLSILVIVGENMRDHIGVTATAAKALSEKNINLEMISQ
GSSEVSVMFVIETEQEKEAVRALYDAFFRSNN
>Cace_Ab_|_CG-03
MKIVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAH
VKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNG
VILAKYLNAEFIDAAEVIFFDKSGCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVK
TFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYM
GATVLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVI
AIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKK
QCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGV
ETVDFEKAVKSIYNAFN
>Cbot_Bc_|_CG-03
MGKVIVAKFGGSSLSDSEQFRKVKSIIYDNENRRYIVPSAPGKRFKKDYKITDLLYLCHA
HRESAISFDDVFKHIEERYLNLAKELRVKVDIKNKLEEIKREIEAGASRDFAASRGEYLN
GLILADYLNYEFIDAAEIIHFKKYGSLDLRKTEKAIKEKIKNVKKAVIPGFYGALPDGTI
KTFSRGGSDVTGAIVARAVEASLYENWTDVSGFLMADPNIINDPKPIEVISYKELRELSY
MGAKVLHEESIFPVRDVKIPINIKNTNRAEDKGTLIVDDDKALNYTGSITGIAGKKGFTV
IAIHKMLMNSELGFCRKLLSILEENGVAFENIPSGIDSVSLVIEDSQLGNKLDIILEEIK
RQCNPDSLEVHVNMALIATVGNGMNRTKGISAKIFKGLLEEDVNIRMINQGSSEINIIVG
VENDDFERAIRGIYNTFIK
>Cnov_Ab_|_CG-03
MNDIIVAKFGGSSLASAEQFRKVKKIVMEDSNRKYVVPSAPGKRDDNDYKITDLLYLCHA
HVENRISFDDVFKIIEERYKEIVKELGLSIDINFHLVNMKKIISQGVSVDYTVSRGEYLN
GIILANFLGYEFVDAAEIIAFDKYGCFDSDKTKELISNNLKNIERAVIPGFYGAMPNGDI
KTFSRGGSDITGAIVAKDVKAKLYENWTDVSGFLMADPRVVDNPKPIEKITYKELRELAY
MGASVLHEEAIFPAKEGNIPINIKNTNRPQDKGTLIVNEVNYKNGGGRITGIAGRKDFTT
IVIQKTYMNAEIGFGRRLLSALETYGISFEHMPSGIDTISIVIDDAQLDNKLDKLLEEIK
RQCNPDSIHVIPNMALIATVGMGMAKAVGTSEKIFSALAKSHVNIGMIDQGSSEINIIIG
VDAKDFETAIKSIYEAFE
>Ctet_Ab_|_CG-03
MNNIIVTKFGGSSLADVNQFKKVKNIVLGDQRRKYVVPSAPGKRHKEDQKITDLLYLCHA
NVEQNVEIDYIFTIIEKRFKDLAKELGVNIDIDTELENIKKNIKNGATADYTASRGEYLN
GLILSNYLGYEFVDPAEIIFFRRNGVFDSDKTQEAVSKRLCNIQKAVIPGFYGSLPNGDI
KTFSRGGSDVTGAIIARGVAADLYENWTDVSGFLMVDPNIVENPKNIEKITYRELRELAY
MGATVLHEEAVFPVRSAGIPINIKNTNRPEDKGTLIIDDLKPASYAGSITGIAGKKDFVV
IAIEKNMMNIEQGYCRKVLSVLEENYVSFEHMPSGVDAVSLVISKNQLNGKLDGILEEIE
MKCKPDSIEVYPNMALVAIVGRGMLRTVGMSAKIFDALAREKVNIRMIIQGSSEINIIVG
VENEDFEKALKSIYDEFAK
>Cthe_Aa_|_CG-03
MKVAKFGGSSLADANQIRKVCDIILSDKDRKLIVVSAPGKRCKEDTKVTDLLIALGEKYY
KEGKADAELQAVIDRFDDIVKGLELSPDITQMVADDLKKRLECNNGNKDKFMDTIKAAGE
DNNAKVVAAYLVSRGIDAEYVNPKDAGLLLSEEYGNARVLPESYENLKRLRERDKIMIFP
GFFGYSKKGDVVTFPRGGSDITGAILAAAVKADVYENFTDVDSVFAANPNIIENPKPIAT
FTYREMRELSYSGFSVLHEETLEPVYRMEIPVCIKNTNNPSAPGTTIVPKRKLDNGPVIG
IASGTGFCCIYISKYMMNREIGFGRKVLSILEDEGLSYEHIPSGIDNMSIIIEQKQLDKA
KEERVVRRIKDELNVDDIKIEYDRALVMIVGEGMMSTVGIAARACTALAKANVNIEMINQ
GSSEVSMMFGVKAEDNVKAVKALYDEFFS
>Ahyd_Ac_|_CG-04
MRVLKFGGSSLADAERFLRVADIAVNTHGQSQVALVLSAPAKVTNHLVALVEQTSRGMDA
SSTLFEINGIFSRLLAGLKAAYPALDDKALQARLTSELDQVERLMQGIRLLGLCPDNVQA
RILSRGENLSIAFMHELLRVRGLELDIIVPEQLLVTDGGYLEAHVDIEASRLRFAAKGLR
SDCLYLMPGFTGGSDKGETVLLGRNGSDYSAAVLAACVDAECCEIWTDVEGCYNCDPRLV
PDAYLLKTLSYKEAMELSYFGAKVLHPKTIAPVAQFHIPCLIKNSFNPQGPGTLIGVEQG
DDDLKVKAISDLSGMCMFNVSGPGMKGMVGMAGRIFSAVSRAGVSIVLITQSSSEYSVSF
CIHSYDCDKTRKVLEREFELEFKNQLLDPLEIMQDLAIISLIGDGMRTSKGMAARFFTSL
AQASINIVAIAQGSSERSISAVVRDRKVAEAIKACHQNFFGSQQFIDLFVV
>Asal_Ad_|_CG-04
MRVLKFGGSSLADAERFLRVADIAVNTHGQSQVALVLSAPAKVTNHLVALVEQTSRGMDA
SSTLFEINGIFSRLLAGLKAAYPALDDKALQARLTAELDQVERLMQGIRLLGLCPDNVQA
RILSRGENLSIAFMHELLRVRGLELGIIVPEQLLVTDGGYLEAHVDIEASRLRFAAKGLR
PAVEGQSPAGKASCLYLMPGFTGGSDKGETVLLGRNGSDYSAAVLAACVDAECCEIWTDV
EGCYNCDPRLVPDAYLLKTLSYKEAMELSYFGAKVLHPKTIAPVAQFHIPCLIKNSFNPQ
GPGTLIGVEQGDDDLKVKAISDLSGMCMFNVSGPGMKGMVGMAGRIFSAVSRAGVSIVLI
TQSSSEYSVSFCIHSYDQEKTRKVLEREFELEFKNQLLEPLDIISDLAIISLIGDGMRTS
KGMAARFFTSLAQASINIVAIAQGSSERSISAVVRDRKVAEAIKACHQNFFGSQQFIDLF
VV
>Cpsy_Ab_|_CG-04
MRVLKFGGSSLASAERFRQVADIIHDKSKSSKLAVVVSAPQGVTNHLVAMTENISDEEKV
VADLGHFKRAITTIIDDLSASISNFNNQHCEQALANYEHQISRYMQGAMLLTYCPDHIRA
RIISTGERLSVAILDAVLQAYSVQVSLLAPEKFLYTNKSSLNAVADLVLSKEKFEHEYTE
LNQVSLMPGFIGVNADNNDGTPEVTTLGRNGSDYSAAVLAVCAVAECCEIWTDVDGVYNA
DPRYIKEAKLLDYLSYQEAMELSYFGASVLHPKTIGPIAQYHIPCLIKNTSNPSAPGTLI
SNENDQQKRVKAISNLDDLTMVNVSGPGMKGMVGMASRVFATMSRENISLVLISQSSSEY
CISFCIYSSDSARAKQSLHEEFELELLNGLLEPLALKGELSIVSLVGDGMHHQRGVAAKF
FSSLAQARVNVVAIAQDSSERSISVVVEQRKCMDAMKVSHQNFFSHKPTIDVFLV
>Patl_Ab_|_CG-04
MKVLKFGGSSLADAERYLRVKDICLDTHASNGAAVVLSAPKGVTNALSLLCEEAGSGKDY
GELFAKLNMVLFGILDDLKDTLPEFDDSELAPYIQRILNELNQHLEGFALLRCAPESVVA
KILSIGEYMSVNIFSQILTTLGTKNQIIDPAELILAEGDYLDSIADVAVSKARFSDVDSS
GDVVLIMPGFVAVNAEGEKVTLGRNGSDYSAAILAACIDAECCEIWTDVDGVYNADPNQV
DGAVLLDKLTYQEAMELSYFGAKVLHPKTIGPIAQHHIPCLIRNTLNPAAPGTLISNEKS
TKWTSVKGISHLDDMTMFNVAGPGMKGMVGMASRVFEVMSNANISISLITQSSSEYSISF
CIHSKDATRAQDLLEDSFALELANNLLDPIEVRHDLAIVTLVGDGMRHSQGLAAKFFSSL
AQARVNNVAIAQGSSERSISTVIESSKARKAVKVVHQNFFSNLHAIDVFLV
>Phal_Ad_|_CG-04
MRVLKFGGSSLADFACLEMVAVLAKAQLKDEMLLVLSAPGGMTDSLVALASAAEQGEDFS
HLWQALVNRCDELKKAVEQGYGEIENWPNFTELKNKLDGVSLIKCCPEQVRAFIISFGER
VSVSLMQCLLGDLNAQYLEATNCIVSTGGYIDAEADLVASKVRFQAVLKEQPATIYIMPG
FTASNEQGELTTLGRNGSDYSAAIAAACLEADVCQIWTDVDGVYSADPRYIKTATKVDFL
SYKEAMELSYFGAKVLHPKTILPCAKAGVPCEIKNTRNPNAQGSLISNESVSSEPVKALS
SLQDLAMLTVSGPGMKGKVGMASKVFNALALDNVSIVLITQSSCEFSISFCVHEVDLALA
LEALQTAFKLESQAGLIEPIQVKRNLAIVTLVGDNMRAHKGLAAKFFASLAQAQVNIVAI
AQDSTESSISAVIDGERCNGAVKVCHENFFTHIPSIDVFLL
>Ping_Ab_|_CG-04
MRVLKFGGSSLANAERFNQVADIVINNQQQSQIALVLSAPAGVTNNLVAVVEKTSMGISS
ESHLIDIQNIFADLIKTLKGTYAEFADELLETIFERELSHLSDLLEGVRLLAQCPASIEA
QILSKGELLSVACMKQLLIAKGHQVEIIKPQEKLISYKGGYLEAQIDIDVSRALFEKETI
VKDAIYLMPGFTAGNEQGETLVLGRNGSDYSAAVLAACLKAECCEIWTDVDGVYSCDPRL
VKDAKLLSSLSYAEAMELSYFGAKVLHPKTITPIAQHHIPCLIKNTYNPQANGTLIGVEH
GDEALQVKGISDLKGLSMLSISGPGMKGIVGMAGRIFTTVSRSGVSIILITQSSSEYSLS
FCIHSSETQKALYALNEEFSLEFKNHLLEPIDVVEKQAIISLVGDGMKKARGVAARFLTA
LTEASINITAIAQGSSERSISAVVSEEKAKEAVIACHQNFFGSVQYIDMFLI
>Sama_Ad_|_CG-04
MKVMKFGGTSLANWQRFDMAAAIVAEAAKASQVAAVLSAPATVTNGLLDMVDVAVTGGDY
QAVLGRVVGVFEALFDDACQHQVPQCREHLFAALSAQKHAWQTRLEGVALLGECPDGVRA
EIVVAGERLSTELMVALMNAHWLSADKLDPRALFLAHGTPLESVVDIGVSKPRFKQLPLD
SKRVWVMPGFTAADDKGRTVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
ADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPEAPGTLVSNAVD
ETGLQVKAISSLDNQTMFDVSGPGMKGMVGMASRTLGAIARAGVSVSLITQSSCEYSISF
CVAGKDAAKVQSALEQEFELELKSELLEPLEMQSGLAIVSLIGDGMRTHKGVAAKFFSAL
AQASVNIRAIAQGSSERSISAVVEQRKVQNAIGACHQRFFDVQQYLDVFLV
>Sbal_Ad_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAQSSKLEPIATVLSAPATVTNALLEMVDVAVKGEDY
LPVLQHVEWVFTSLYQDAVNSVLSSEQSEQLFSGLNAQLVIWQDRLRGIGLLQECPDGIR
AEIVVAGERLSAALMEQVMISKGITSAQLDPRALFLGRGRPLESVVDIAVSKPRFRALAL
GEKRVWVMPGFTAADEQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
DETGLQVKAISNLDNQTMFDISGPGMKGMVGMASRTLAAISRSGVSVSLITQSSSEYSIS
FCVATSDSAKVKWALEQEFELEIKSDLLEPIAMRHELAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>Sden_Ab_|_CG-04
MKVMKFGGTSLANWSRFSMAADIIIEAAAVEAVSTVLSAPATVTNSLLEIADLAVNKEDF
EPVLKHISNVFNELYQGAASELTSVQQALLMQQFQTQFDEWQDRLKGIGLLSECPDSVRA
QIVVSGERLSAGLMQQVLLARKVSAGLLDPLALFMAHGEVLESVVDIAISKPRFSALTLE
SNKVWVMPGFTAADAKGRVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
HDAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIKNSFNPSAPGSLVSNDLD
TTGLQVKAISNLDHQTMFNVSGPGMKGMVGMASRTLAAISRSGISVSLITQSSSEYSISF
CVATSEAQKAKWALEQEFELEIKSELLEPIELRQGLAIVSLIGDGMKTHKGVAAKFFSAL
AKASVNIIAIAQGSSERSISTVIEQSKTKHAVCACHQAFFDVQQYLDVFLV
>Sfri_Ac_|_CG-04
MKVMKFGGTSLANWSRFSMAADIIADTASTESVATVLSAPATVTNALLEMVDIAVNQQDY
QPVLDHINGVFSGLFSDATSLITAVQHKLLVEKLAAQMQVWKDKLYGIRLLGECPDSVRA
ELVVTGERLSAALMEQVMLAKDITSAQLDPVALFLAHGQPLESVVDIAVSKPRFTLLPLD
QYRVWVMPGFTAADAQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
ADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQYQIPCYIKNSFNPSAPGTLVSNDDD
KTGLQVKAISNLDNQTMFNVSGPGMKGMVGMASRTLAVISRSGISVSLITQSSSEYSISF
CVSTSQANKAKWALEQEFELELKSELLEPIELRQDLAIVSLIGDGMKTHKGVAAKFFTAL
AKASVNIIAIAQGSSERSISTVIQQKKTKHAIGACHQAFFDVQQYLDVFLV
>Sloi_Ac_|_CG-04
MKVMKFGGTSLANWQRFNSAAQIVLASAAEQPTAVVLSAPATVTNGLLEMVDLAVAGDDF
FPVLSQVHEVFKTLYGQAASEVLSGEQSDSLEAVLAAQLKHWQDKLQGVVLLGECPDAVR
AEIVVGGERLSAALMEQLMLAAGVSANQLVPQQLFVAHGPALESVVDIAASKQRFAELSL
DAHQVWVMPGFTAGDKDGRVVTLGRNGSDYSAAVLSACIDASCCEIWTDVDGVYNTDPRV
VADAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIRNSFNPQAPGTLVSNQV
DETGLNVKAISNLDEQTMFDIAGPGMKGMVGMASRTLGAISRSGVSVSLITQSSSEYSIS
FCVATQDAERVRVALEQEFELELKSEILEQIAMRHNLAIVSLIGDGMRTHKGVAGKFFQA
LAQANVNIVAIAQGSSERSISAVIELRKTKHAIAACHQSLFDVQHYLDVFLV
>Sone_Ad_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAKAATMEPVATVLSAPATVTNALLEMVNLAVKGEDY
SPVIQHVERVFTSLYQDAVSSGLSSTQSELLFAGLGAQLARWQDRLHGITLLQECPDGIC
AEIVVAGERLSAALMEQVMLAKGITSAQLDPRKLFLGRGRPLESVVDIAVSKPRFKNLLL
DEKRVWVMPGFTAADEDGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNLA
DASGLQVKAISNLDNQTMFDVSGPGMKGMVGMASRTLAAISRSGVSVSLITQSSCEYSIS
FCVATSESAKVKLALEQEFELEIKSDLLEPIEMRHDLAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>Sput_Ad_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAKSSKLEPIATVLSAPATVTNALLEMVDVAVKGEDY
SSVLQHVERVFTSLYQDAVTSMLSSEQSEQLFSGLNAQLVIWQDRLRGISLLQECPDGIR
AEIVVAGERLSAALMEQVMLSKGITSAQLDPRALFLGRGRPLESVVDIAISKPRFRALAL
GEKRVWVMPGFTAADEQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
DETGLQVKAISNLDNQTMFDISGPGMKGMVGMASRTLAAISRSGVSVSLITQSSSEYSIS
FCVATSDSAKVKWALEQEFELEIKSDLLEPIAMRHELAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>SHEW-3d_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAKAAKAEPVATVLSAPATVTNALLEMVDVAVKGEDY
SPVIQHVERVFTSLYQDAVSSGLSSSQSEVLFAGLSVQLARWQDRLRGITLLQECPDGVR
AEIVVAGERLSAALMEQVMLAKGITSAQLDPRELFLGRGRPLESVVDIAVSKPRFKNLAL
DEKRVWVMPGFTAADEDGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VTDAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
DESGLQVKAISNLDNQTMFDVSGPGMKGMVGMASRTLAAISRSGVSVSLITQSSCEYSIS
FCVATSDAAKVKSALEQEFELEIKSDLLEPIEMRHDLAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>Bflo_a_|_CG-04
MRVLKFGGTSLSNASQFIHVANILEKNAQKEQIAVVLSAPARVTNYLVEAINNTLRGNNI
LESVLNIENIFNTLLKDIAQFQSKFNYVVFHNTLKQEFNSLKQLLQGISLLNFCPDSVNA
HIICLGEKWSVILMQGILIAKDLKIINLDPVKSILTQGDGYSTSVVNIEESTCRIHNVLL
SHYADIILMAGFMAGNKKGELVTLGRNGSDYSAAILAACLQARRCEIWTDVDGIYTCDPR
QVPDARLLHELSYQEAMELSYFGAKILHPRTIVPIAQFHIPCLIKNTSKPDFSGTLISAK
NKDINIIAKGITYLKDMVMINVSGPGMKGMIGMAARVFAAMSRATCSVVLITQSSSEYSI
SFCVPYQEYAKACDALDEEFNLELKNGLLEPIGVICDLAIISVVGDGMRTQLGLSGKLFG
ALARASINIIAISQGSSERSISVVVKNNVTTIGVKAVHQTLFNTDQIIEVFII
>Baph_Aa_|_CG-04
MKLLKFGGTSLANAEKFLSVSSIIEENTQTDQIAVVLSAPAKITNYLVKIIENTIKNNQI
LETVHLAENIFMQLINNFLNIQSNFPHKEIEKIIKKEFNELKNIIQGILLLKQCPDNIRA
IIISRGEILSVFIMKSILQSKNYNVTIINPVKNLVAIGDNYLDSTVDISESKKNIQNMNI
NQSNIILMAGFIAGNKDKKLVVLGRNGSDYSAAVLAACLDANCCEIWTDVDGVFTSDPRK
VPNARLLKSISYQEAMELSYFGAKVLHPRTIEPIAQFKIPCLIKNTNNVKSIGTLICEQN
CSEKDFLKGVTHLDEIAMFNISGPHIKDVGSVISRIFTMMSRGNIKILLITQSSSENKIN
FCVYEHDIYKILYLFNKEFQLELKDGLLNPFKIKKNLSILSIVGSNIYKKHNIASKIFSV
LGALKINVIAISQGSSKHSISLVIKKENILKAVQHVHNTLFFNKKTIHMFLI
>ENTE-2c_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
LPNISDAERIFTELLQGLADLQPGFPLAPLKAFVEQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKLSIAIMAGLLEARGHKVAVIDPVEKLLAVGHYLESTVDIAESTRRIAASKIP
ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTISPIAQFQIPCLIKNTGNPQAPGTLIGASHD
EDDLPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRNGISVVLITQSSSEYSISF
CVPQADCMRARRALEEEFYLELKEELLEPLSIQERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVSNDDATTGVRVTHQMLFNTDQVIEVFVI
>Patr_Ac_|_CG-04
MRVLKFGGTSVANAERFARVADIIENNARQGQVATVLSAPAKITNHLVAMIEKTVAGQDI
LPHLNDAETIFSSLLQGLAASQPGFEHARLKAFVEQEFAQLKHVLHGIALLGQCPDSVNA
AIICRGEKLSIAIMEAVFQARGYGVSVINPVEKLLAQGHYLESTVDITESTRRIAESAIP
KDHVILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTENPQAPGTLIGMDST
DTQYPVKGITNLNNMAMVNVSGPGMKGMVGMAARVFAAMSRAGISVVLITQSSSEYSISF
CVSQNELARARKTLEDEFYLELKEGVLEPLDVMERLAIISVVGDGMRTLRGLSARLFSAL
ATANINIVAIAQGSSERSISVVVNNDVATTGVRVAHQMLFNTDQVIDVFVI
>Ecol_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Plum_Ac_|_CG-04
MRVLKFGGTSVANYQRVLSVADIAEKKFSQGGVALVLSAPAKITNHLVAMIEKTVAGQEI
ITHMHDAEQIFVDLLQGMARAQPGFAYERLKMMVEQEFAQLKQVLHGISLLGQCPDSINA
SLICRGEKLSIAIMESVLQARGHKVTVIDPVENLLAQGHYLESTVDINESTKRIASLNIP
DDHIVLMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRATCCEIWTDVDGVYTCDPRVV
PDARLLKGMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTANPDAPGTLIGDGQK
DESTPVKGITNLSNMAMINVSGPGMKGMVGMAARVFAVMSRKGISVVLITQSSSEYSISF
CVPQRELERARQALSEEFYLELKEGVLDPLDVMENLSIISVVGDGMRTLRGISARFFSAL
ARGNINIVAIAQGSSERSISAVIDNEVATTAVRLCHQMLFNTDQVIEVFVV
>Sent_Nc_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNSRQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
LPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASQIP
ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASSD
DDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMSRAGISVVLITQSSSEYSISF
CVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Styp_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
LPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASQIP
ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASSD
DDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMSRAGISVVLITQSSSEYSISF
CVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sboy_Ab_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTSGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sdys_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRMP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRVDCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sfle_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sson_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EGELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVMERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sglo_Ab_|_CG-04
MRVLKFGGTSVANAERFIRVADILESNSRQGQVAAVLSAPAKITNHLVAMIDRTLNGSDI
QPNILDAEQIFSRLLDGLAAAQPEFDHAALRSVVEQEFAQLKQLLHGISLLKYCPDNVNA
AIICRGEKLSIALMEALLRARGFGVTVIDPVAKLLAQGGYLESTVDIAESTRHINDAAIP
ADHIILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPHQV
PDVRLLSQLSYQEAMELSYFGAKVLHPRTIVPIAQFQIPCLIKNTTNPQAPGTLIGPTSG
EEGNPVKGITHLNNMAMINVFGPGMKEMIGMAARVFAAMSRAGSSVVLITQSSSEYSISF
CVPQHELAGARRALEEEFYLELKDGLLEPLDVISRLAIISVVGDGMRAQRGLSAKLFVAL
ACANINIIAIAQGSSERSISVVVDNDSTTTGVRVAHQMLFNTDQVIEVFVI
>Wglo_Aa_|_CG-04
MRVLKFGGTSISSLKCFSKVVNIIKKNYKKDQIAVVLSAPKKVTDNLFYMIEKSCQTKDI
KEIFNNTKDIFFYLIKSLFDSNENYYYLNIYNFIELKFNRLLYLLNIVFNLKFCPNSINA
EIVCMGEIISVKLMELYLKNKNIDVFVIDPKKIFLSKGQYLESFIDIKESERRIKKINFP
KNKVILMAGFIAKNKYGELVALGRNGSDYSATALAACLKANVCEIWTDVDGIYTGDPNKI
KNTKLINKLSCKEAISLSYLGAEILHKRSIFPILEFNIPCIIKNTNNSNSYGTSILNIVN
DEKEIIKGITFLKDIAMISIFICYNIKTINIYNRILVAFKKSNIKIIFMMQSSSESNINI
FIFQNNLSESKCIIEYEFCFEINNKLFESIHYKSDLFILSMIGSNIFKNKNIFINIVKFF
NFIHKKMISILYGGYLSNAFSVVLESCNIVNDLNNMHKIFFEKKNFIEIFIIGNKNIKNC
LFNLFYKKKFFF
>Yent_Aa_|_CG-04
MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
SPNISDAERIFSELLRGLADAQPGFEYERLKALVAHEFAQLKHVLHGISLLGQCPDSINA
AIICRGEKLSIAIMEALFQAKGYKVSVINPVEKLLAQGHYLESTVDITESTRRIGSSSIP
TDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRVV
PDARLLKSMSYQEAMELSYFGASVLHPRTIAPIAQFQIPCLIKNTSNPQAPGTLIGGESS
DDGFPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
CVPQGELIRARQALEEEFYLELKDGLLEPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
ARANINIIAIAQGSSERSISVVVSNDAVTTGVRVCHQMLFNTDQVIEVFVI
>Ypes_Ab_|_CG-04
MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
SPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHLLHGISLLGQCPDSINA
SIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLESTVDITESTRRIGASGIP
SDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRTV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCLIKNTSNPQAPGTLIGGESI
DEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
CVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
ARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQMLFNTDQVIEVFVI
>Ypse_Ab_|_CG-04
MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
SPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHLLHGISLLGQCPDSINA
SIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLESTVDITESTRRIGASGIP
SDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRTV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCLIKNTSNPQAPGTLIGGESI
DEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
CVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
ARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQMLFNTDQVIEVFVI
>Hinf_Aa_|_CG-04
MRVLKFGGTSLANPERFSQAAKLIEQAHLEEQAAGVLSAPAKITNHLVALSEKAALNQST
DTHFNEAIEIFYNIINGLHAENNQFDLNGTKALIDAEFAQIKGLLEEIRQAGKVEDAVKA
TIDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAKGGYLESSVEIEESTKRVDAANIA
KDKVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASVCEIWTDVDGVYTCDPRLV
PDARLLPTLSYREAMELSYFGAKVIHPRTIGPLLPQNIPCVIKNTGNPSAPGSIIDGNVK
SESLQVKGITNLDNLAMFNVSGPGMQGMVGMASRVFSAMSGAGISVILITQSSSEYSISF
CVPVKSAEVAKTVLETEFANELNEHQLESIEVIKDLSIISVVGDGMKQAKGIAARFFSAL
AQANISIVAIAQGSSERSISAVVPQNKAIEAVKATHQALFNNKKVVDMFLV
>Hsom_Aa_|_CG-04
MRVLKFGGTSLANPQRFLQAAALIEKAHLEEQAAGVLSAPAKITNHLVALSEKAALNQPT
DGHFDEALEIFYNIINGLYAENTHFDLVGTKALIESEFAQIKGLLENIRQAGKVDDAVKA
TIDCRGEKLSIAMMNAWFEAKGYTVTVINPVEKLLAYGSYLESSVDIAESTKRVDAKSIP
AKNIVLMAGFTAGNDKGELVLLGRNGSDYSAACLAACLGASVCEIWTDVDGVYTCDPRLV
PDARLLSSLSYREAMELSYFGAKVIHPRTIGPLVEPQIPCLIKNTGNPEGAGSIIDNREN
ISEGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAMSKASVSVILITQSSSEYSIS
FCVPTKAIEKAKAALNAEFEQELVAKDLDPVEVIHDLSIISVVGDGMAQSKGIAASFFSA
LASANISIVAIAQGSSERSISAVVPLNKAIEAVKATHQALFNNRKVVDMFLV
>Msuc_Ab_|_CG-04
MRVLKFGGTSLANPERFLQAARLIEKAHLEEQAAAVLSAPAKITNHLVALSEKASLNQPT
ETNFNEALDIFYNIINGLHEKNNNFDLKGTSQLIESEFNQLAELLEQIRQAGKVEDAVKA
TIDCRGEKLSIAMMKAWFEACGYEVTVINPVEKLLAYGNYLESSVDIEESAKRVDVASIP
KNNVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLNASACEIWTDVDGVFTCDPRLV
PDARLLPSLSYREAMELSYFGAKVIHPRTIGPLVRSNIPCLIKNTGNPTAPGSIIDGNEP
QSGELQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSTMSKAGVSVILITQSSSEYSIS
FCVPSKLAAKAKDALNTEFAKELLDKDLEPVEVIEDLSIISVVGDGMKQAKGIAARFFSA
LSQANISIVAIAQGSSERSISAVVAQNKAIEAVKSTHQALFNNKKSVDMFLV
>Pmul_Ab_|_CG-04
MRVLKFGGTSLANPERFSQAAQLIEKAHFEEQAAGVLSAPAKITNHLVALSEKASLNQPT
DANFNEAIEIFYHIIHGLHAENNRFDLEGTKALIDTEFAQISQLLEEIRQQGFVSDAVKA
TIDCRGEKLSIAMMKAWFEARGYDVTVIDPVEKLLAHGSYLESSVDIEESTKRVDAKSIP
TKNVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASACEIWTDVDGVFTCDPRLV
PDARLLPSLSYREAMELSYFGAKVIHPRTIGPLVQTNIPCLIKNTGNPSAPGSIIDGNIQ
SEQLQVKGITNLDNVAMFNVSGPGMQGMVGMASRVFSAMSNAGVSVILITQSSSEYSISF
CVPAKSVEVAKQALEKEFEQELKANDLEPIDVIRDLSIISVVGDGMKQAKGIAARFFSAL
AQANISIVAIAQGSSERSISAVVALNKAIEAVKATHQALFNNKKVVDVFLV
>Aple_Ab_|_CG-04
MRVLKFGGTSLANPERFIQAADIIEKAHLKDQAAGVLSAPAKITNHLVAIVDKAIAGESF
ESNLKEATEIFHNIINGLYAINNKVDREGLLALVEAELAQIQSVASEAAKSKSLPDSVAA
TIHCRGEKLSIAMMQAWFEAKGYEVTRIDPVEKLLAHGSYLESSVDIAESTKRVDANSIP
KKNVVLMAGFTAGNENGELVLLGRNGSDYSAACLAACLKADCCEIWTDVDGVYTCDPRLV
PEAICLESMSYQEAMELSYFGAKVIHPRTIGPLVPLNIPCLIKNTANPDAKGTLIDGNVA
TDGLKVKGITNLDNVAMFNVSGAGMQGMVGMAARVFSTMSKAGISVILITQSSSEYSISF
CVPAKFEEKATACLNAEFAQELSKGDLDPIDMIRELSIISVVGDGMRTAKGIAARFFSSL
AQANISIVAIAQGSSERSISAVVPMNKAIEAVKATHQGLFSNKKSIEVFLV
>Ppro_Bd_|_CG-04
MRVFKFGGSSLSDAERFLRAADIIANNAQQGDVSVVLSAPGKVTNKLVSVIDSTVKTGEA
DLQVADLETVFNELFSGLKALVPSFDKDLVDAKLASSLGQLKQYVHGMKLLGLCPDNVYA
KIISKGERLSIVTMKALLEAKGQPASLIDPVAYLFAQGDYLEAHVDIEVSTQNFKRNPLP
EGHVNIMPGFTAGNSDGELVTLGRNGSDYSAAVLAACLRAECCEIWTDVDGVYSCDPRIV
PDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFSPQGAGTLIGLDTG
EDNLAIKGITTLKNLTMVNVSGPGMKGMVGMAARVFGAMSISGVSIVLITQSSSEYSISF
CIESDDKVAVQQALQNNFELELKEGLLEPIEFVDDSAIVTLVGDGMRTSQGVASRFFTSL
AEVNVNIIAIAQGSSERAISAVIPAMKVAEAVKACHENLFNSKHFLDVFVI
>Vcho_Fd_|_CG-04
MHLEEGMRVLKFGGSSLADPERFLRAADIIANNAQQEEVAVVLSAPGKTTNKLVAVIESA
LRQGEVEAQIVELESSFYALLDGIKAQLPNLDDSAYQQQVHSSMTQLRQFVHGITLLGMC
PDNVNARIISKGERVSIQLMKAVMEAKGLPANLVDPVKYLLAKGDHLEAMVDVEISTQRF
RQAPLPQQHVNIMPGFTAGNAQGELVCLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYN
CDPRLVDDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFQIPCLIKNSFNPQGAGTL
IGQDTGEDKLAIKGITTLSNLTMVNVSGPGMKGMVGMASRVFGAMSAADVSIVLITQSSS
EYSISFCIEAQHKALAQQALADAFELELKDGLLEPVEFVDNVAIITLVGDGMRTSRGVAS
QFFSSLAEVHVNVIAIAQGSSERAISAVIPDDKISEAIKACHENLFNSKHFLDVFVV
>Vfis_Ae_|_CG-04
MRVLKFGGSSLADSDRFLRAADIIANNAQQQEVSVVLSAPGKVTNKLVSVVDNLLTNGEA
ELQISELESVFTQLFSGISNTLPQVDLKLLENKLKDSISQLRQYAHGITLLGMCPDNVYA
KIISKGERISIVMMKAVLEAKGQPASLIDPVKYLYAKGDYLEGAVDVDVSTLNFKNEPLP
QGHVNIMPGFTAGNAKGELVTLGRNGSDYSAAVLAACLRAECCEIWTDVDGVYNCDPRLV
DDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
EDNLAIKGITTLNNLTMVNVSGPGMKGMVGMASRVFGAMSATGISIVLITQSSSEYSISF
CIEAEDKCKAEQVLREAFELELKDGLLEPVEFTDNVAIVTLVGDGMRTSKGVASQFFTSL
TEVNVNIIAIAQGSSERAISAVIPEDKVSESIKACHENLFNSKHFLDVFVV
>Vpar_Ae_|_CG-04
MRVLKFGGSSLADADRFLRAADIIANNAQQEEVAVVLSAPGKTTNKLVAVIEGALRNGEA
ELQINELEESFKTLFADIQAVLPNLEGAAFDNQVKTSLSQLRQFVHGINLLGMCPNNVNA
RIISKGERVSIQLMKAVLEAKGQKANLIDPVEYLYAKGDHLEAMVDVDVSTQNFRQNPLP
KDHVNIMPGFTAGNEKGELVTLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYNCDPRLV
EDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
EDNLAIKGITTLNDLTMVNVSGPGMKGMVGMASRVFGAMSSAGVSIVLITQSSSEYSISF
CIEADDKLKAQQVLADAFELELKDGLLEPVDFIDDVSIVTLVGDGMRTSRGVASRFFSSL
AEVNVNIVAIAQGSSERAISAVIPEDKISEAIKACHENLFNSKYFLDVFVV
>Vvul_Ab_|_CG-04
MRVLKFGGSSLADADRFLRAADIVANNAKQEEVSVVLSAPGKTTNKLVAVIESALKNGEA
ERQVDELDSAFKQLLSDIKQQLPSLNGDAYLKQVADSLSQLRQFVHGIGLLGMCPDNVNA
RIISKGERVSIQLMKAVLEAKGHLVNLIDPVDYLLAHGDHLEGMVDVDVSTQNFRSNPLP
QGHVHIMPGFTAGNKHGELVTLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYNCDPRLV
EDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
EDNLAIKGITTLNNLTMVNVSGPGMKGMVGMASRVFGAMSASGVSIVLITQSSSEYSISF
CIEAADRPLAEQALSDAFELELKDGLLEPVEFLTNVSIITLVGDGMRTSKGVASQFFASL
AEVSVNVIAIAQGSSERAISAVIPEDKISQAIKACHENLFNSKHYLDVFVV
>Bfra_Ab_|_CG-05
MKVMKFGGTSVGSVNSILSVKKIVESAGEPVIVVVSALGGITDQLISTSRMAAMGDAAYE
GAYREIVRRHEEMVQGVIPAGETQTLLHYQVNELLDELKDIFQGIYLIKDLSPKTSDTIV
SYGERLSSLIASRLIQGAVWFDSRTFIKTEKKHNKHTLDTELTNRLVREAFKEIPRVSLV
PGFISSDKVSGDVTNLGRGGSDYTAAVIAAALDADSLEIWTDVDGFMTADPRVISTAYTI
SELTYVEATELCNFGAKVVYPPTIYPVCHKNIPILIKNTFNPDAQGTVIKQHVDHTKSKA
IKGISSINDTSLITVQGLGMVGVIGVNYRIFKALAKNGISVFLVSQASSENSTSIGVRNA
DADLACEVLNEEFAKEIEMGEISPIQAEKNLATVAIVGENMKHTPGIAGKLFGTLGRNGI
NVIACAQGASETNISFVVDSKSLRKSLNVIHDSFFLSEYQVLNLFIC
>Bthe_Ab_|_CG-05
MKVMKFGGTSVGSVNSILSVKRIVESAGEPVIVVVSALGGITDKLINTSKMAAAGDSAYE
GEFREIVYRHVEMIKEVIPAGAGQVALQRQIGELLNELKDIFQGIYLIRDLSPKTSDTIV
SYGERLSSIIVAELIDEAKWFDSRTFIKTEKKHNKHTIDADLTNQLVKEAFHSIPKVSLV
PGFISSDKVSGDVTNLGRGGSDYTAAIIAAALDASSLEIWTDVDGFMTADPRVISTAYTI
SELSYVEATELCNFGAKVVYPPTIYPVCHKNIPIIIKNTFNPDGVGTVIKQETSNPQSKA
IKGISSINDTSLITVQGLGMVGVIGVNYRIFKALAKNGISVFLVSQASSENSTSIGVRNA
DADLACEVLNEEFAKEIEMGEISPILAERNLATVAIVGENMKHTPGIAGKLFGTLGRNGI
NVIACAQGASETNISFVVDSKSLRKSLNVIHDSFFLSEYQVLNLFIC
>Fjoh_Ac_|_CG-05
MKVLKFGGTSVANAQNIKLVLEIVNKKAANDKLVVVVSALSKVTDLLQSAAAKAAANDES
FREVVAEIEKKHLDTLKELIPVSEQSSLLSHVKRIINHLETLLDGCFLLGELSPRTADTI
LSFGELLSSFIIAQAFQQTEKDAVYKDSRELIKTDNNFGKAAVNFEVSNQLIKEYFAGNK
AKINILPGFIAQTLDGITSTLGRGGSDYTAAIIAGALDAEQLEIWTDVNGMFTANPKIVK
QAQPIANISYQEAMELSHFGAKVLYPPTIQPVLRKNIPILIKNTFEPEAVGTLISDTVVS
KDTVVKGISHIDNISLVTLEGPGMIGVAGSSRRLFEVLSQEKINVIFITQASSEHSICIG
ILNSDADKAEAAINRAFEIEISQNKIDPCYVEKDLCIIALVGENMKNHQGLSGRMFSTLG
KNNVNIRAIAQGASERNISTVINERDVKKALNTLHENFFEENTKQLNLFVM
>Fjoh_Ab_|_CG-05
MKVLKFGGKSLSNGEGLNKVVSIISDKVNQGEQIAVVVSARGNATDELEDILRIAAKNGN
YKPLLESFKAYQTSDYPQVDLSEEFNILDKLFEGVSLIGDYSNKIKDQILSKGELLSAKL
LTSILVEKGIPANFVDTRELLKTDSKFGDAQPLEQLSKKNVINYFKLHNGETVNIVTGFI
GSNNNNDTTTLGRNGSNYTASLIANYLDAEELQNFTHVDGIYTANPDLVADAKKIEFLSF
NEANELANFGATILHAKTIIPLLEKNIPLRILNTFNHENHGTLITSNSAKEGIKTLSVLE
NVSLVNLEGRGLLGKAGVDARIFKVMGDHNISVSIISQGSSERGIGLVVAKDKATLAMVE
LEKEFENDFYSKDVNQITVTDNVSVISIIGQDLSTFHKPYTALIKNKIVPILFNNTVTGK
NVSLVVKKEELNKALNVIHGEIFGVSKKINIAIF
>Gfor_Ac_|_CG-05
MHILKFGGSSLATPERIKLVAKTIQKHLENDTVVSVFSAFGGVTNDLLLMAELAEKEDDS
YKAILAKNEKRHFEAVKELIPVTAQSAILSKVKNQFNRLETLYEGVFLLNELSDKTKHVI
SGFGEILSSLIISEYFKSLKVDSLWVDSRDLIVCKNVNEKVQVNYTKTNFNLTEFFKKNK
SELFIVPGFVAKNDLGVPSTLGRGGSDFTAAIIAGALEVDQVLIYTDVNGMFTANPNLVP
QAYALKNISYEEAMELSHFGAKVLYPPTLQPLLDKNIEIYIKNTFEPDNPGTLISKSSER
NFRWVTGITHIDSIKLLNIEGSGMVGIPGFSKRFFEILFQENINVVLITQASSEHSICIA
VKDDEAEKAKEALDEAFEVEIGYKKIKPVEIEDNVSIIALVGDRMKSHHGLSGKMFSALG
NNNINIRAIAQGSSERNISAVISKKDVVKALNTLHEQFFEVPSKELNLFIT
>Chut_Ab_|_CG-05
MKVLKFGGTSVGSVESIRKVAEILSSYKKKEKFVVVFSAMSGITNLLVEVGQKASTTDIS
YQQVLKTIEQKHVSTAKTLIDVKNQGKVIAQLKLILNELQDLLHGVYLLKELSPRSNDLV
LSFGERLSSYLVSEFLKQEGVDVTFLDARKVIITDSSFGSAKVDFKKTDKAIKDYFKDIK
SSVVTTGFIGSTDKGETTTLGRGGSDYTASVFGAALDSEGIEIWTDVDGIMTADPRKVKR
AFTLPQVSYIEAMEMSHFGAKVIYPPTLQPAFKKRIPIWIKNTFNTAFEGTLINEKTSAT
DHSVKGISSIENISMLNLTGSGMVGVPGVSGRLFGALARNFINVILITQASSEHSICFVI
DSKESAKAKDAVEEEFEHEIKAGKIDKLHEKDNLAIVAVVGDNMRHTPGIAGKLFSSLGK
NGINVVAIAQGSSEINLSVVIGKEDLTKALNVIHESFFLSDVKTINVFVV
>Cchl_Ab_|_CG-05
MKIYKFGGTSLGSAQLMKNAAALIAAALPSEPIIVVVSAIHPVTDLLLEAARQASRGDAA
YCEKLQTVEALHATLASLLLEGENFSTTQQTIELELAELGKLMQGVYLLRELSEKSEALL
VSFGERLSAKLLSAYLSAQQVAASFVDARALIVTDASYSDARVDMAASTERIQHFFKSIA
QAVPVVTGFIAAAPDGSVTTLGRGGTDYTASILGAALGASEIVLWGDVDGFFSADPLRVR
DAQVLPAISYQEAMELSHAGACVLHPLAVQPAMKAGIPLLIKNVTNPTAHGTCITAKGAL
PHRPTLSVTALTSLNNIVLLTMSGSGMAGMPGIASRLFSVLARHRINIIFISQASSEQCI
TLAINPQQAEKAGALLEAEFAREREARQIEPLGIRRNLSMIAVIGNNMSGHPGVSAQLFE
TLGKNGINVVAVAQGANEMNISLVVESHDEEKALNCIHESFFLSQSKVHLFIA
>Cpha_Ab_|_CG-05
MKIYKFGGSSLGSAARIRKVAAIIAGARSEGPLVVVVSALFRCTDMLLESANEACLGDEN
YRKTFEEFDALHRNIAADLFNAEVCSDVVSAMSDELLELSDLLHGVFLLRELSEKSTALI
LSFGERLSARLISRFLPDGYYVDGRNLVVTDSNPLCARVDRHATEKRIQSALSSCSGVPV
VTGYIAAAPDGTVTTLGRGGSDYTASLVGASLSASEIVIWTDVDGFYSADPKRVRDARVL
PYISYAEAMELSHAGAKILHPFSIQPAMKASIPVLIRNSFNPDAPGTRIERDVQQEMKDR
LPVTGLSSINKVVLLNLAGSGMVGVPGIASRLFSCLALHGINIIFISQASSEQSISLAIN
PLQAEKAKKILEAEFHSEIESRLIDPLLIRRSLALIAVVGNNMSGHPGVSAQLFETLGKN
GINVIAVAQGANEMNISLVIESHDEDKALNCIHESFFLSQRKVHVFLA
>Ctep_Ab_|_CG-05
MRVFKFGGSSIASAAKISNVAGIIRRELKSTPLVVVVSAIGKVTDMLAETAALAGNGDAA
YRDKLEGIASLHGGIIRELFGTEASAEETWLGEMMAELNDVLHGVFLLRELSDKSLALVL
SYGERLSCRIVSRYMHVSGTPAECVDARSVIVTDDNHCFAKVDRLATGKLIHERFRSFDV
LPVVTGFIASAPDGSVTNLGRGGSDFTATILGAALHAEEVWIWTDVDGFYSADPKRVPDA
RVIPEISYAEAMELSHAGAKVLHPLAVQPVMKAGIPLRIKNSFNPEKPGTRIGIEAAGAE
ALPGTVTGLTSINHVVLLSLSGSGMAGVPGTASRLFTCLARHSINIIFISQASSEQSISL
AIAPGQASMAKKVLEEEFAREIEERRIDPVSVRRNLAMVAVVGNKMLGHPGVSAQLFETL
GKNGVNVIAVAQGANEMNISLVIDSADENKALNCVHESFFLSMRKVHVFIV
>Plut_Ab_|_CG-05
MKIFKFGGTSLGSADRIRNVSGIISRALADDRLVIVISAMHGVTDRLLEAARRACGGDSG
YVAVHEELAERHLSVAADLLEGQALEELSGILRRELEELHDVLHGIFLLRELSFKSSALV
QSFGERMSARIVAAWLRQAGLPAVYVDGRELIVTDASYPDARLDEPATRERVALRLARET
ELAVVTGYIAAAADGTVTTLGRGGSDYTASILGAALGAREIWIWTDVDGFFSADPKRVTD
ARVLPYISYAEAMELSHAGAKILHPLAVQPAMKASIPLIIKNSFNPGAAGTRIERDEHRD
EAVVLPVTGLTSINTVVLLNLSGSGMVGVPGIASRLFTRLARHRINVIFISQASSEQSIS
LAINPAQAAEAKLVLDDEFSAEITARQIDPLAVRRDLAMIAVVGNNMSGHPGVSAQLFET
LGKNGINVIAVAQGVNEMNISFVVESHDEDKALNCIHESFFLSRRRVHVFIA
>Pvib_Ab_|_CG-05
MKIYKFGGASLCSADRIRKVSQSIANALQNDGLVVVVSALKGVTDRLLDTARRASKGDAG
YRTLSGELEGFHLGIVDELFSAAPSRELSEAMRRELDELHDILHGIFLLRELSDRSSAMV
QSFGERFSALIVSSWLNFCGIAAQRVDGRELIVTDGASLDARVDTAMTKEKINARLPHGG
PLAVVTGFIAASPDGLLTTLGRGGSDYTATLLAASLGADEVWIWTDVDGFFSADPKRVPD
ACPLPYISYTEAMELSHAGARILHPLAVQPAMKAGIPLVIKNAFNPAAPGTRVEGEVKDD
QARRRQVTGLTSINKVALLNLSGSGMVGVPGIASRLFTCLARHRINIIFISQASSEQSIS
LAISPSQAAGARSVLQEEFRSEITARQIDSISVRRNLCMIAVVGNNMSGHPGVSAKLFET
LGKNGINVIAVAQGANEMNISTVVESHNEDKALNCIHESFFLSRRKVHLFLA
>Fjoh_Aa_|_CG-06
MRVFKFGGASVKDAEGIKNVYDVLQKVGYEDVILVVSAMGKTTNALEVVIKNYFEKSEEL
NSSVQEIKNYHFQIVLDLFKDEKHEVFAAVNAQFAELEYFLAHNKSPNYNFVYDQVVSFG
ELISTNILSHFMNFMGIQTQWLDVRNFIKTNANYRDAEVDWETTEQNISKNVPRKQLNIT
QGFLGADENNFTTTLGREGSDYTAGIFAYCLNAESVTIWKDVPGVMNADPRYFENASLLN
QISYREAIELAFYGATVIHPKTLQPLQKKEIPLYVKSFINPLLKGTCVSKGVDLEPQYPC
FIVKREQLLISLSSIDFSFIMEENISEIFGLFHEFKIKVNLIQNSAISFSVCVEDKFGNF
NDLNAILSKKFKVEYSENVTLYTIRHFTEQAAEMVEKNKEVLLKQVSRETMQIVTKELN
>Gfor_Aa_|_CG-06
MIKVFKFGGASVKDADGVKNLIKVLRATGSENKLIVISAMGKTTNALEVVVKDYLNIAGI
PASLDEVKNYHRNIITGLFPNKEASVYPKIETLFTELENFLQHNKSNQYDFVYDQVVSFG
ELFSTTIVSEYLNSRHISSNWLDARNFIKTDSTYRDAQVNWSKTQERVQENIDPKKLNII
QGFIASDLNNFTTTLGREGSDYSAAIMAYCLNAESVTIWKDVPGVLNADPRFFENAQLLN
KISYEEAIELAFYGASVIHPKTLQPLQGKEIPLFVRSFLNPSEEGTAVSKGKTIFPEIPC
FIVKKDQVLISLSSLDFSFMVEENISEIFKLFHQYQMKVDLIQNSAISFRVCVDNRFNQL
EKLIQHLKARFKVNYKTGVSLYTIRHFNEEAINSLEKDKNVLLKQLTQNTVQLVAEN
>Srub_Ac_|_CG-07
MESSAPASANWRVHKFGGTSLADPARIRHVADLLGARTPPVAVVVSAMSGVTDRLLALAE
KAHTDADGLADRLQSLRDDQRAVVTDLLDGDAAASVLRTLDQDLDDLADVLRATRLMGTA
PDTTRDLVAGYGELWSARVLGGVLRDRGLSAAVCDAREVLVVTHEEMGPVVDWDATQERF
ADWRAAHDAPDTIVATGFIATTPDGVPTTLGRNGSDHSAALFAALLEAEALTIWTDTDGV
MSADPQYVPDARRLDGLSYEEAMEMAYFGAGVIHPRTLSPAVEHEIPITIRNTFAPDRPG
TRIHLNDDGASVVKGFSTIDDVALLNLEGSGMIGVPGIARRLFDALEDEGVSVILISQGS
SEHSICFAVPQAQAEVAREAAEHAFYAELDRGQLRTVELVPNCSILAVVGDQMAGTPGVA
ATFFGALGEASVNVRAVAQGSSERNISAVVDRDDARRALRAAHAGFYLSKRTLSIGVI
>Ftul_Ab_|_CG-07
MIVHKFGGSSLATAEKIKNVSNIINCKDEAVVVSASAKTTRNLQKTIDQATIAQDYSETL
EQIYEHHNEIIKQLIPNDENLRTLIVTDLANIKHILSTITITGFCADSLRFFILGFGEIW
SARILTTYLKSKGKKAAFIDASECLIVNDRSYPVTVDWQQSLEKLEIIKSDNPADVYVIT
GFIAQNKYGKRTILGLNCSDYSAAIFAKLLQANKLYIWTDVAGVYSANPQVVPEAKPLTQ
LTYKEALELAYFGASVVHPLTIAPMALDRTPIYIKSSYTPDEVGTKISADKDENQGIIKG
LTSVSDVAIVRVQGAGMIGVSGISFKVFGALEKANVSVMMISQASSEYSICFAIDSLDVD
KATEALRQEFANDIKNNLIEEIIVHKHYSLITAVGEGMKSKTGSLAKLVNSLKLANINIH
AIAQGSSERSVTFAVKAEDEVRGVQAMHRHYNSVSDDIAIAVI
>Xaxo_Ab_|_CG-07
MSSHAVSFEPAAVLASSARTVVHKFGGTSVADAERYRHVAQLLLARDETVQVTVVSAMKG
VTDALIELAELAAKNRPEWRERWHETRARHRGAAVALLGEHSGPTVEWLDERFAHLSQIL
GALAVIGELPREVLDRVQGLGEVYSAQLLGDHFRAIGEDCAVLDARDVLVVNRGELGVDV
DWEASAQRLATWRQAHPQTRVVVTGFVARDRADRVTTLGRNGSDYSGAIFAALFDADELH
IWTDVDGVLSADPRVVPEAVQLETLSYDEACELAYFGAKVVHPQTMSPAIERGLPIIIRN
TFQPEHPGTRITASSAVSGPIKGLTLSPDLAVLNLEGTGLIGVPGTAERVFAALRTAQVS
VVMISQGSSEHSICCVVKQHESERARNALLQAFAHELTVGQVQRVQLTTGISVLAAVGDG
MAGQPGVAARLFESLGRAQVNILAIAQGSSERNISVAIDAAHATKALRAAHAGFWLSPQT
FSVGVI
>Xcam_Ab_|_CG-07
MSSPVVSFEPAAVPTPSARTVVHKFGGTSVADAERYRHVAQLLLARDETVQVTVVSAMKG
VTDALIELAELAAQNRPEWRERWHETRARHRGAAVALLGEHSGPTVEWLDERFEHLSQIL
AALAVIGELPREVLDRVQGLGEVYSAQLLGDHFRALGEDCAVLDARDVLVVNRGELGVDV
DWAVSAQRLDTWRQAHPQTRVVVTGFVARDRGDRITTLGRNGSDYSGAIFAALFDAHELH
IWTDVDGVLSADPRVVPEAVQLETLSYDEACELAYFGAKVVHPQTMSPAIERGLPIIIRN
TFQPEHPGTRITASSAVSGPIKGLTLSPDLAVLNLEGTGLIGVPGTAERVFAALRTAQVS
VVMISQGSSEHSICCVVKQHESERARNALLQAFAHEITVGQVQRVQLTTGISVLAAVGDG
MAGQPGVAARLFESLGRAQVNILAIAQGSSERNISVAIDAAHATKALRAAHAGFWLSPQT
FSVGVI
>Xory_Aa_|_CG-07
MRTGPPQRGLSMSLPAVSFEPAAVVASSARTVVHKFGGTSVADADRYRHVAQLLLARDET
VQVTVVSAMKGVTDALIELAELAAKDRPEWRDRWHETRARHRGAAVALLGEHSGPTVEWL
DERFEHLSQILGALAVIGELPREVLDRVQGLGEVYSAQLLGDHFRAIGEDCAVLDARDVL
VVNRGELGVDVDWEVSAQQLATWRQAHPQTRVVVTGFVARDRADRITTLGRNGSDYSGAI
FAALFDADELHIWTDVDGVLSADPRVVPEAVQLETLSYDEACELAYFGAKVVHPQTMSPA
IERGLPIIIRNTFQPEHPGTRITASSAVRGPIKGLTLSPDLAVLNLEGTGLIGVPGTAER
VFASLRTAQVSVVMISQGSSEHSICCVVKQHESERARNALLQAFAHELTVGQVQRVQLTT
GISVLAAVGDGMAGQPGVAARLFESLGRAHVNILAIAQGSSERNISVAIDAAHATKALRA
AHAGFWLSPQTFSVGVI
>Xfas_Aa_|_CG-07
MSTVETPVYVPRTVVHKFGGTSVADADCYRHVTRLLLAREETVQVTIVSAMKGVTDTLIA
LAEQAANHSPDWQVLWQQTRTRHCDAAQALLGEHAATLQDWLNTRFNELHEMLVALSVIG
MLPSEVLDRLQGLGEVYSAQLLGHYLQSQGEDCVVLDARQVLVVSPGEFGAEVDWATSAQ
HLAHWRMQHPQRRVVVTGFVASDRTGRAITLGRNGSDYSGAIFAALFEADELHIWTDVDG
VMSADPRVVPDAVQLDALSYDEACELAYFGAKVVHPQTMSPVMKRGVPIIIRNTFQPGHP
GTRITADSVVSGSVKGLTLSPGLAVLNLEGTGLIGVPGTAERVFAALRNARLSVVMISQG
SSEHSICCLVHQTEAERARDALLYAFAHELAIGHVQRVQLTNNISVLAAVGDGMAGHLGV
AARLFESLRRAHVNILAIAQGSSERNISVAIDSQQATKALRAAHAAFWLSPQTFSIGVI
>Atha_d_|_CG-07
MATLKPSFTVSPPNSNPIRFGSFPPQCFLRVPKPRRLILPRFRKTTGGGGGLIRCELPDF
HLSATATTVSGVSTVNLVDQVQIPKGEMWSVHKFGGTCVGNSQRIRNVAEVIINDNSERK
LVVVSAMSKVTDMMYDLIRKAQSRDDSYLSALEAVLEKHRLTARDLLDGDDLASFLSHLH
NDISNLKAMLRAIYIAGHASESFSDFVAGHGELWSAQMLSYVVRKTGLECKWMDTRDVLI
VNPTSSNQVDPDFGESEKRLDKWFSLNPSKIIIATGFIASTPQNIPTTLKRDGSDFSAAI
MGALLRARQVTIWTDVDGVYSADPRKVNEAVILQTLSYQEAWEMSYFGANVLHPRTIIPV
MRYNIPIVIRNIFNLSAPGTIICQPPEDDYDLKLTTPVKGFATIDNLALINVEGTGMAGV
PGTASDIFGCVKDVGANVIMISQASSEHSVCFAVPEKEVNAVSEALRSRFSEALQAGRLS
QIEVIPNCSILAAVGQKMASTPGVSCTLFSALAKANINVRAISQGCSEYNVTVVIKREDS
VKALRAVHSRFFLSRTTLAMGIV
>Atha_e_|_CG-07
MPVVSLAKVVTSPAVAGDLAVRVPFIYGKRLVSNRVSFGKLRRRSCIGQCVRSELQSPRV
LGSVTDLALDNSVENGHLPKGDSWAVHKFGGTCVGNSERIKDVAAVVVKDDSERKLVVVS
AMSKVTDMMYDLIHRAESRDDSYLSALSGVLEKHRATAVDLLDGDELSSFLARLNDDINN
LKAMLRAIYIAGHATESFSDFVVGHGELWSAQMLAAVVRKSGLDCTWMDARDVLVVIPTS
SNQVDPDFVESEKRLEKWFTQNSAKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMSALF
RSHQLTIWTDVDGVYSADPRKVSEAVVLKTLSYQEAWEMSYFGANVLHPRTIIPVMKYDI
PIVIRNIFNLSAPGTMICRQIDDEDGFKLDAPVKGFATIDNLALVNVEGTGMAGVPGTAS
AIFSAVKEVGANVIMISQASSEHSVCFAVPEKEVKAVSEALNSRFRQALAGGRLSQIEII
PNCSILAAVGQKMASTPGVSATFFNALAKANINIRAIAQGCSEFNITVVVKREDCIRALR
AVHSRFYLSRTTLAVGII
>Ahyd_Ad_|_CG-08
MEQQQQGEIAVATEAGLKRRHVHKFGGSSLADPVCYRRVASILEQQAEQQGGGRELVVVS
AAGKTTNRLIQLVELAEAGDEAAGEAISALQAYQQSLIDGLLEGELHLELSQQLADDMQL
IAKTLEGQFDRFERNGLLAFGEVWSARLLAALLTSRGDKAIWLDARSFLRAEDGALVKVD
TALSSELLKARLAEHAGRIVVTGFIAADMEGRSLLLGRNGSDYSASLLALLADGESTTIW
SDVAGVYSADPRRVKEARLLERLSLAEANELARLGSSVLHSRTLQPVADSRQRLTLRCSY
NPDEGCTHILRRAPRSGGARIVSSVDQIALIELKVLPQTHYEQTVAAIEAHLARHRLNPL
TLQRQPDRRILRLAYTLEVAQGAFELLRDFQLQGSFTGLIQREGYSLVALVGAGVTDNAE
QCHRFYQLLADQPLEFVQVAKDGLSLVAVLRQVVLEPLLIALHSALFSRPNRVGLVVF
>Asal_Ac_|_CG-08
MKRRQVHKFGGSSLADPVCYRRVAAIVEQQVGGDELVVVSAAGKTTNRLIQLVELADAGD
EAAGEAISALQAYKQSLIDGLLEGELQLDLSQQLADDMQLIAKTLEGQFDRFARNGLLAF
GEVWSARLLAALLSSRGEKAIWLDARSFLRAEDGALVKVDTALSSELLKARLAEHAGRIV
VTGFIAADMEGRSLLFGRNGSDYSASLLAALADGESTTIWSDVAGVYSADPRRVKEARLL
ERLSLAEANELARLGSSVLHSRTLQPVADSRQRLTLRCSYNPDEGCTHILRRAPRSGGAR
IVSSVDQIALIELKVLPQTHYEQTVAAIEAHLARHRLNPLTLQRQPDRRVLRLAYTLEVA
EGAFEILRDFQLQGSFTGLIQKEGFSLVALVGAGVTDNAEQCHRFYQLLADQPLEFVQVA
RDGLSLVAVLRQVVLEPLLIALHSALFSRPTRVGLVVF
>Cpsy_Ac_|_CG-08
MSSNEIADIDFIAEVAAENKLAKHAIQVHKFGGSSLATPKCIKRALEIIRENCQLNDIVV
VSANGKTTDRLFALYSLVERTIAEDTIQKSDELTQAIDELAKEQAQLITELLNANNTKQL
LLRLHKDIEQLTTWLTADIVQHHNDVLALGEVWSARLLSALLNEQVCPSNSIDSRDFLVI
DNEQSCVVDTALSAAQLRQRRQFGKLAVITGYISKDSRGKSCTLGRNGSDYSATIIASLV
AAGNVTLWTDVDGIYSADPRVVPSARKLHRLPNGVAKELGRLGNPVLHAKTLLPLINPLS
EHHTHLHVASSFDAQVIGTEIGKFGQIAKQELSVTYLNDLLLAQSVSFIGEAATRAKAEF
SPICIDDQKGFMVITQGQQKALSDWLASHDVEITFKPVAIIATVGHRVAERGDIRARFKR
SLKAAKPLNLVGSDNNHSVIAILPEPCSIELLNTVHHEMTKDARHIGLVVA
>Iloi_Ab_|_CG-08
MTTTQLTEEQKQAVADSVQVHKFGGSSLADAFCYRRVARIVTEYAGASDLVVVSAAGDTT
NRILAIINAKAQPGDTASILLDQLESFQQGLITELLSGNLQQQLLQQSQQDFARWRRWLA
CDETISHNAELLSYGELWSARLLSALLQKQGTRADHIDARDFLLAADAPEPVIQVEHSRE
KLLQRVAPHSGTRFIVTGFIARGLHGESLTLGRNGSDYSATLVGSLLDTRQVTIWKDVAG
VYSADPRKVERVVSLPTLDWTEAEELARLGSPVLHPRTFQPVDRQRMVISVRSSLKVENQ
QTRIGQFQNTQPRGKVFTSLSEVVLFKVELHDKALVKRLDELELEPLVSWTEPENHQQYL
VFHQNHLDYLTGWLDSLGAGDAITQIRGYSMLAIVGNRIQETDQFSTFKLQLSEQKVRRF
ALTQNGDSAVAILEQKLDNRLLNRLHSQLFNYRRSLGVLVI
>Phal_Ac_|_CG-08
MTNNIHKFGGSSLSSAERYKSVAKIIIGQAQPGDCVVVSAAGKTTDTLVKLWQSYQQHDT
QALADIVLQLNNHQSDLITQLLQGDLKRSALTTLNEELSLVAKLASTEQLQEAALLAHGE
LWSARLLAAYLQQLNVAACMQDARGLFTLSDGQLLHSQNTQQCSELISQHKINVVTGFIA
ANTQGDTVTLGRNGSDYSATLLASYCNAKQVYIWTDTQGIFSTDPRKVNKAIKYAKVCRA
QANLLARLGNPVLHAKTLSPLKNTDIKLAVRSSFDVQASSTNVVKEGCVKQKRFITTLEN
IDLLSVEGLVEGEVTQVSQLIQHSLHHFSSAGETYLIVPAVATHQVVSYFAGRANISESN
LHGCALVAPEQDINSLSTQARELLNLHNIEPRFVHQDSGYVLLLTDQLIDSDVLNVLHDK
LITKGQEIALIVA
>Sama_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTQGHSDDLVVVSAAGKTTNFLYKLLSLRDAGE
LWQEELQVLISYQQNLIEQLLSAEQARYLRERLSTDKAQLVSLLSLATLNDYQTSHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEGAVPNIREQESREKVAAMLAEHENERI
VITGFICANPAGETLLLGRNGSDFSATLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTQVSMAVRSSYAPHTDFTLVAPTSSQASAP
VVTNLSEVALFSLTTQADTDALLATLSASGLTPLASWQGSRGGLELAYTPENLKQVSAFL
KANAEAYGLGDVSISNDFGLVALVSADAVLYRKSFARLLSREAKPLYHDTLSLVTLVPKA
QVNLLTQKVHRRCAGPRKRIGVILL
>Sbal_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLALRDVGQ
LWQEELQVLTSYQQGLVEQLLSNEQARDLRERLATDQAQLISLLSLDERNEYQVNHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKLTGELTSLLDSLIAAGLTPLAHWTSAHQRVELAYTAENQKQVQRLL
DAEAQVLGISDQQINTDLGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGVLLL
>Sden_Ac_|_CG-08
MARSHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLDLRDTGQ
LWQEELQVLISFQQALIEQLLSNEQARDLRERLSNDKAQLASLLSLEQRNEYQISHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEGAVPKIRVEESKAKIQTLLAERTNERL
VITGFICANAQGDTLLLGRNGSDFSATLIASLADIGRVTIWTDVEGIFNADPNKINDAKL
LKSMSLAEADRLARLGSPALHSRTLQPLFNTQVSLAVRSSYASHTDFTLIAPQSSSASAP
VVTSLSQVVLFSFKLETHNKIESDSQSKPQPQSQFESVLAALTSAGLTPLAHWEYGADKH
ELAFMLENQKQVNALLSKQAPTFGITELQLNLDLGLVALVSADAEHFRRSFARLLSRDAK
PIYQDNLSLVTLVPRAQVNLLTQKVHRRCAGPKMRIGVLLL
>Sfri_Aa_|_CG-08
MTRSHLHKFGGSSLADADCYRRVAHILLTHGQSDDLVVVSAAGKTTNFLYKLLSLRDSGQ
LWQEELQILISYQQTLIEQLLSNEQARDLRERLSTDKSQLVSLLSLEQRNDYQLNQVVSF
GERWSARLMAALLREMGVAATHVDACSILVADEGAVPNILVAESRDKVQALLALHPQERL
VITGFICANRHGDTLLLGRNGSDFSATLIASLADIDRVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPLSSSASAP
VVTNLNEVVLFSFKMNADIEPLLAILDKAGITPLAYWSLAQHKFELALTLESQKQVQALL
NQYSSEFLIEELSAQTDLGLVALVSADAHHFRRSFARLLSRDAKPIYQDALSLVTLVPQA
QVSLLTQKVHRRCAGPRMRIGVLLL
>Sloi_Ab_|_CG-08
MTRCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLIVVSAAGKSTNFLYRLLELCDTDQ
LWQEELQVLVSYQQNLIEQLLSNEQARSLRERLATDKSQLTSLLSLDELNDYQRNQVVSF
GERWSSCLLAALLRESGVAATDVDARTLLVADEGAVPQIRLGESRQKVQALLEAHPQERL
VITGFICANEQGDTLLLGRNGSDFSATLLASLADIERVTIWTDVEGVFNADPNRINDAKL
LKSMSLTEANRLAHLGSPVLHNRTLQPLFDTEVSLAVRSSYAPHTDFTLIAPKSSSASAP
VVTSLSSVSLFSLTISVELPQLLACFAQAGLTPLAYWSLAHGRAELAFTHENQKQAQAIF
EAKRSELGIDELQLRDDLGLVALVSADASLYRRGFSRLLSREAHPLCNDGLSLVTLVPKA
QVNLLTQKVHRRCAGPRKRIGVLLL
>Sone_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKTTNFLYKLLSLRDSNQ
LWQEELQVLISYQQGLIEQLLSNEQARDLRERLTTDKAQLISLLSLDVRNDYQISHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKIAGDVASLLDQLVEAGLTPLAHWVSAHQRLELAYTAENQKQVQKLL
DAQAEALGIRDLQINTELGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGVLLL
>Sput_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLSLRDAAQ
LWQEELQVLISYQQGLIEQLLSHEQARDLRERLATDKAQLISLLSLDVRNDYQINHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKLTGELTRLLDLLIAAGLTPLAHWTSAHQRVELAYTAENQKQVQRLL
DAEAEALGISDQQINTDYGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGILLL
>SHEW-3c_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKTTNFLYKLLSLRDSNQ
LWQEELQVLISYQQGLIEQLLSNEQARDLRERLTTDKAQLISLLSLDSRNDYQISHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRTKVQTLLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKIAGDVASLLEQLVEAGLTPLAHWLSAHQRLELAYTAENQKQVQKLL
DAQAEALGIKDLQINTELGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGVLLL
>ENTE-2b_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSMPGDMMVVSAAGSTTNQLISW
LKLSQTDRLSAHQVQQTLRRYQSDLISGLLPAQAADGLISAFVHDLERLAALLDSGITEA
VYAEVVGHGEVWSARLMAAVLEQQGLEAAWLDARDFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRIVVTGFISRSNAGETVLLGRNGSDYSATQIGALAGASRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDICLIEFQVPAGQDVKLAHKDIDLILKRAQVRPLAVGVHSDRHLL
QFCYTAEVADSALKTLDEAGLPGELRLRQGLALVAMVGAGVSRNPLHCHRFWQQLKGQPV
EFTWQSEEGISLVAVLRKGPTESLIQGLHTTLFRAEKRIGLVLF
>Patr_Ab_|_CG-08
MSALGVAPSVTGRQLHKFGGSSLADVKCYLRVAGIMAEYSHPGDLMVVSAAGSTTNQLIS
WLKLSQSDRLSAHQVQQALRRYQSELIAGLLPAQDAEALTAQFIRDLERLAALLDGKITD
AVYAEVVGHGEIWSARLMCAVLNHRDMNAAWLDARDFLCAERAAQPQVDEGRSWPLLQQY
LTQHSGQRLVVTGFICRNDAGETVLLGRNGSDYSATQIGALAGVERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGTGAKIVTSHDDVCLIEVQVPSEHDFVLLQKEVEQILNRAQLKPLAIGVHQDRSL
LQLCYTSEVVESALQLLTQAALPVELSERDGLAMVAMVGAGVGKNPLHSHRFYQQLKDQP
IEFVRQADDGISLVAVLRVGPTEHLIRGLHHSLFRAEKRIGLVLF
>Ecol_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Plum_Ab_|_CG-08
MGALVVATAENDRQLHKFGGSSLADVKCYQRVAKIMANYSQPGDLMVVSAAGSTTNQLIN
WLKLSQSDRISAHQVQQVLRRYQQDLIRGLLPETVAEELVKRFIADLEKLSALLDKPVSD
VTYAEVVGHGEIWSARLMSAVLEAQGIPSAWVDARQFLRAERAAQPQIDVTLSQPLLNQL
LTQNLNKRLVVTGFISSNHDGETVLLGRNGSDYSATQVGALAGARRVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSFSDIDLLLRCSYQPEQGSTRIE
RVLASGTGAKIVTSHDDVCLIELHVAAHHNFKQTYKDIDLLLKREQIRPLATGIHLDCNL
IQLCYTSEVVNSALSVLEDATLPGKLSLREGLALVALVGAGVCKNPLHCHRFYQQLKDQP
VEFIWHAEDGISLVAVLRTNQTEHVIQGLHQSLFRAEKRIGLILF
>Sent_Nb_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLISW
LKLSQTDRLSAHQVLQTLRRYQCDLISGLLPADAADDLTSAFISDLERLAALLDGGVTDA
VYAEIVGHGEIWSARLMSAVLNQQGLDAAWLDARAFLRAERAAQPQVDEGLSYPLLQQLL
AQHPGKRLVVTGFISRNHDGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDICLIEFQVPASQDFRLAHKELDQILKRAQARPLAVGVHRDRQLL
QFCYTAEVADSVLKLLDDVGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSEEGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLMLF
>Styp_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLISW
LKLSQTDRLSAHQVLQTLRRYQCDLISGLLPADAADDLTSAFISDLERLAALLDGGVTDA
VYAEIVGHGEIWSARLMSAVLNQQGLDAAWLDARAFLRAERAAQPQVDEGLSYPLLQQLL
AQHPGKRLVVTGFISRNHDGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDICLIEFQVPASQDFRLAHKELDHILKRAQVRPLAVGVHRDRQLL
QFCYTAEVADSVLKLLDDVGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSEEGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLMLF
>Sdys_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRSERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPTSQDFKLAHKEIDQILQRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Sfle_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEFSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPSKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Sson_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Yent_Ab_|_CG-08
MNATAVAAAVTGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
WLKLSQTDRLSAHQVQQNLRRYQHDLISGLLSPEMAEPLISEFIHDLERLAGLLDNKVDD
AIYAEVVGHGEIWSARLMSAVLNKLDMAADWLDARSFLRAERAAQPQIDEGRSYPLLQQL
MAQHPHQRLVVTGFISRNNAGETVLLGRNGSDYSATLVGALAGVERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGSGAKIVTSHDDVCLIELQIAGHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
LQLCYTSEVVNSALRVLEDATLPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
VEFIWQAEDGISLVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
>Ypes_Ac_|_CG-08
MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
WLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFIHDLERLAGLLDNKIDD
VIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERAAQPQIDESRSYPLLQQL
MAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALAGAERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
LQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
VEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
>Ypse_Ac_|_CG-08
MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
WLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFIHDLERLAGLLDNKIDD
VIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERAAQPQIDESRSYPLLQQL
MAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALAGAERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
LQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
VEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
>Ppro_Be_|_CG-08
MKRQLHKFGGSSLADPECYRRVTDILREYSHPNDLIVVSAAGKTTNCLIEWVERLNKDGR
QAHETLQEIRQFQQHLIEASVNGEQADRLLSQLHAELSELAKLSGLEITEAVRSSILGHG
EIWSARLLAALLNRNNMPAVSLDSRDFLRAERAVQPEVDRTLSRPLLQQQLVQHNKCRIV
ITGFMARNQASETVLLGRNGSDYSATVIGALADVSRVTIWSDVAGVYSADPRKVADACLL
PLLRLDEADELARLAAPVLHSRTLQPVAQSTIDLTLRCSHQPESGSTRVERVLASGRGAK
IVTSLDEVCLIELDVPRSHDFDAIKTDIERTLQRAQLLPLAQSAEVELGRILLAYTSEMV
NCVLELLQNRGVAAELRLREGFSMVAAVGAGVVNNPVHCHGFYQQLKGLPVEFMTEAESG
LSLIAVLRKVDTEGLVARIHQSLFQAQKRVGIVLC
>Vcho_Fc_|_CG-08
MTHPRQLHKFGGSSLADPECYQRVAKILKSYSKSDDLVVVSAAGKTTNRLISFVEALSKD
GRVAHETLHALRQYQSELITKLLSNEAAEPLLSQLQQEISVLGELTAPLSNAQYAWVLGH
GELWSARLLAALLNQQDLPAVAQDARTFLRAEAGTQPEVDRARSYPLLKAVLAQHTQRRV
VITGFMAQNEQGDTVLLGRNGSDYSATVIGALAEVSRVTIWSDVAGVYSADPRIVSDACL
LPLLRLDEANELARLAAPVLHSRTLQPVAQSTMELHLRCSHQPESGSTRIERVLASGRGA
KIITSLDDVLLIELSFAHHHDFQRVQEDVLQHLQRVQLQPLTYEAQPDQYRLRLAYTAEI
APGAFAALQDAAFEAEIKLKEGYDLIAAVGAGVTKNPNHCYGFYQQLNALPVEFISASES
SLSLVAVLRQTPIHSLVNAIHKQLFQAQKHVAIALC
>Vfis_Ad_|_CG-08
MTIPCSRQLHKFGGSSLADPECYRRVATILKEYSNEHDLIVVSAAGNTTNRILEWIDDLS
KDGRLAHETLESLRTYQQGLITELLSAENAEPLLTVLYQELIAIGQLHAPLTEVQQADVL
GHGEVWSSRLLSAYLNQIDLQAAPLDSRTFLRAERAAQPEVDRVQSWPLFKEQVAQHPHG
RIVITGFMARNQRGETVLLGRNGSDYSATMIGVLGEVSCVTIWSDVAGVFSADPRKVEDA
CLLPLLRLDEASELARLAAPVLHSRTLQPVAQSALDLSLRCSYQPESGSTRIERVLASGR
GAKIVTSLEDVYLIQLGFGRGQYFERAQQEVLSLLTRSQLQPLALEPQADQFTLLLAYTS
EVVNEALEVLQNSAVHAEIKLKEGYSMVAAVGAGVTANAIHSHGFYHQLKNCPLEFVYAS
ESGLSLVAILRKVDTSSIINAIHNSLFQAQKRVGLILC
>Vpar_Ad_|_CG-08
MSVQRQLHKFGGSSLANPECYLRVADILKEYSAENDLVVVSAAGKTTNRLIEFLEGLDKD
GRIAHEALQGLRQFQSELIESLLEGEVQTQLLASLHDEFSTLAELTAPLTDAQKAAVLGH
GEVWSSRLLAALLSQQNVPAVAQDARAFLRAEAGTQPEVDRARSYPLIKEALAQHSHKRV
IITGFMAQNEAGETVLLGRNGSDYSATVIGALAEVTTVTIWSDVAGVYSADPRLVSDACL
LPLLRLDEASELARLAAPVLHSRTLQPVAQSTMDLSLKCSYQPESGSTRIERVLASGRGA
KIITSLDEVLLIQLSFRHGHDFNKTQSDVLKSLQRAQLEPLSYEVQADQQKLRLAYTAEI
ATGALKYLQDLAVEAEIKLKEGYSLVAAVGAGVTKNANHCFGFYQKLKHAPVEFVSETES
GLSLVAVLRRTDTEALVQLIHSQLFQAQKRVAVTLC
>Vvul_Aa_|_CG-08
MSQVRQLHKFGGSSLADPDCYRRVVNILKEYSGDNDLVVVSAAGKTTNRLIEFSEALEKD
GRLAHEALQALRQYQTGLVEALIASNQRSELLDQLADEFSTLAEFSAPLTTAQKAAILGH
GEVWSSRLLASLLNQHDLAAVAQDARAFLRAETGTQPEVDRARSYPLIKEVLAQHSHRRV
VITGFMAQNQAGETVLLGRNGSDYSATVIGALAEVAKVTIWSDVAGVYSADPRLVSDACL
LPLLRLDEASELARLAAPVLHSRTLQPVAQSATELNLRCSYTPESGSTRIERVLASGRGA
KIITSLDDVMLVQLNFSAGHDFERQQQEVLRALKRAQLEPLAFEAQKDQFKLRLAYTTEI
AGGALAHLQELGLAAEIKLKEGFSLVAAVGAGVTNNASHCFGFYQQLKHSPVEFISEAES
GLSLVAVMRRVDLPVLVKAIHTQLFQAQKRVALALC
>Srub_Ad_|_CG-09
MMPASGRPWVVCKFGGTSVSSRARWDTIVEVVRTHRAEGRAPFLVCSALQGISDQLEALC
AQLASAEPGAPESTLNTIRERHRALGQDLGVEAEAVLSGEFARLERWVDEIQATDGPSPR
QRAAVLATGELLSTRLGAAYLSAQGLPAEWLDAREFLRATDDPHLPPRRQYLAANCTSHA
DPGLQARLADAPETVYLTQGFIASNALDETVLLGRGGSDTSAAHFAAKLEAERTEVWTDV
PGLFTANPGEVPSGRLLRRLDYDEAQELATMGARVLHPRCLDPARRHQIPLHVRSTEAPS
LDGTIVSGEGPDVGPQVKAISAKTDITAVSMDTLGMWQEVGFLADVFQVFKHHGLSVDLM
ATSESNVTVTLDPVANALDPDILDRLLHDLNRYCDAELIDPCAIVSLVGRHIRSLLSELG
PAFEVFDEQKVHLVTQAASDLNMSFVVDEDQASRLVRELHAQFFGHRAPDAVFGPRWQEL
VEDGTPEETPDVWWRER
>Mmar_Ab_|_CG-09
MEHAQNWVVLKFGGTSVKSLADWRVISKRIEAVRAEGKRVFVVHSAIATISNLLDTLVAR
AVEGGGEAELDAIKARHLTLADELGVDGNNLLADHFDALTRLRAGLALTGDASPRLKARI
MAQGELMATRLGQAWLAKGGTDSIWLDARDHLAALPAAGARGYLAVDCEHDRDDGLLGQC
AALPPVIVTQGFIARREDGDTALLGRGGSDTSASYFAAKLGAERIEIWTDVPGFFSADPR
LTGAARQIRSLAYAEAQELASMGAGVLHPRAISPVRKAGIEMQVLCTHRPDMSGTTISVN
PSEDAPRLKAVSVKQGVRLITLETDGMWRASGFLSKAFEPFARHGVSIDLVSTSETSVTV
SLDDDPGLTPDVLGALEDDLAQIARVEIIENCAAVSLVGRGVRALLAQFGPAMEAFAHYP
VRLVSQAANDLNLTVVVDGDQGKPLCRRLHDQLIQPKPMDRTFGPSWREIGENLTETAPA
GTGTWWRAKRQALLDLCPVDGATYVY
>Lpne_Aa_|_CG-09
MSGILIMQQVVIKFGGTSVSTRATWNNIAAITQKHLNTGVQPVIVCSALTQISNKLEKAI
EAALLDEHHSLFNDIQSSHLNLAEQLEVNHQLIANDLHQLQQWLTGISLLKQAPAKTHAQ
ILSLGELMMTRLGHAFLEKQGIKVKWYDARELLTSTPTLGGETMNYLSARCESEYDSALV
EKFLSSGAQAIITQGFFAANPHGETVLLGRGGSDTSAALLAGKLQAASCEIWTDVPGIYT
ANPHQLPHARLLKQLNYDEAQEIASMGAKVLHPNCIPPVRKANIPMVVKYTHLPEHSGTL
ITKDIDESAPLIKSIQVKHSILLISIDTLNMWQQVGFLADVFAAFKKHGFSVDLLSSSEF
NVTLSLDVNAKIHDRPAINALLDDLNQFGRAKLIEPCSAVSLVGHHIRTVLPHLGPALEV
FEAKQVYLMSLASNDLNLTFVVDESHADKLCQRLHHLLIESNPQIFYYSKSWHEEFGKPN
VRPTPWWEIERDRLLTTSAIHSPCYVY
>Xaxo_Aa_|_CG-09
MSAPHSTDRWIVLKFGGTSVSRRHRWDTIGKLASKRANETGGRVLVVVSALSGVTNELTA
IADGAADSAQRVAALDQRHREFLAELELDADAVLGERLAALHALLGDARAATRTLDWQAE
VLGQGELLSSTIGAAYLHASGLDMGWLDARQWLSALPPQPNQSEWSKRLSVSCQWQSDAD
WRTRFAAQPTRLLITQGFISRHADGGTAILGRGGSDTSAAYFGALLGASRVEIWTDVPGM
FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDSGVPMAILDTERPDLPG
TSIDGNAELVLGVKAISRRNGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
TNVTVSLDPSENLVNTDVLAALSADLSQICKVKIIVPCAAITLVGRGMRSLLHKLSDVWA
TFGQERVHMISQSSNDLNLTFVIDEADADGLLPILHAELIDSGAMPVSEGEVFGPRWRQI
IGSVRPRPTPWWHAERAHLLSLSRAGTPRYAY
>Xcam_Aa_|_CG-09
MSASLSTDRWIVLKFGGTSVSRRHRWDTIGKLASKRANETGGRVLVVVSALSGVTNELTA
IADGAADSAQRVAALELRHREFLAELELDADAVLGARLAALHALVGDARAASRTLDWQAE
VLGQGELLSSTIGAAYLHANGLDMGWLDAREWLSALPPQPNQSEWSKRLSVSCQWQSDAA
WRARFDAQPTRLLITQGFISRHADGGTAILGRGGSDTSAAYFGALLGASRVEIWTDVPGM
FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDSGVPMAILDTERPDLPG
TSIDGSAEPVLGVKAISRRNGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
TNVTVSLDPSENLVNTDVLAALSADLSQICKVKIIVPCAAITLVGRGMRSLLHKLSDVWA
TFGQERVHMISQSSNDLNLTFVIDESDADGLLPILHAELIDSGAMPVSEGEVFGPRWRDI
IGSVRPRPTPWWHAERAHLLTLSKAGTPRYVY
>Xory_Ab_|_CG-09
MSAPHSTDRWIVLKFGGTSVSRRHRWDTIGQLASKRASETGGRVLVVVSALSGVTNALTA
IADGAADSAQRVAALDQRHREFLAELELDADAVLGERLAALHALLSDARAATRTLEWQAE
VFGQGELLSSTIGAAYLHASGLDMGWLDARQWLSALPPQPNQSEWSKRLSVSCQWQSDAD
WRARFAAQPTRLLITQGFIARHADGGTAILGRGGSDTSAAYFGALLGASRVEIWTDVPGM
FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDSGVPMAILDTERPDLPG
TSIDGNAEPVLGVKAISRRNGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
TNVTVSLDPSENLVNTDVLAALSADLSQICKVKIIVPCAAITLVGRGMRSLLHKLSDVWA
TFGKERVHMISQSSNDLNLTFVIDESDADGLLPILHAELIDSGAMPVSEGDVFGPRWREI
TGSVRLRPTPWWHAERAHLLSLSKAGTPRYAY
>Xfas_Ab_|_CG-09
MSASPTAERWIVLKFGGTSVSRRHRWDTIAMVVRKRLEEHGTRVLIVVSALSGVTNELTA
IAQGVVDSAKRVTALEQRHRDFLVELGLDAQAVLGTRFAMLSDLLQDARAVTRSLDWQAE
LLGQGELLSSTLGAAYLGASGIDIGWMDARDWLTALPPQPNQSEWSQRLSVSCQWKSDVE
WRTRFDAQRAQVLITQGFISRHQDGGTAILGRGGSDTSAAYFGALLGAACVEIWTDVPGM
FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDTGVPMLILDTERPDVLG
TRIDAEVEPVLGVKAISRRDGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
TNVTVSLDPSENLVNTDVLTALSTDLSQICKVKIIVPCAAITLVGRGMRSLLHKLSEVWA
TFGKERVHMISQSSNDLNLTFVIDETDADGLLAVLHFKLIESGAMPVQDRAVFGSPWREI
IGHVRTRVMPWWHSARMRLLAMRDEEGIGPCYVY
>Oale_Ab_|_CG-09
MTDQTPLANRVWTVLKFGGTSVAKPENWAVIAKLAKARLKQDKPGGKVLIVHSALSGVSN
RLEALPDQALLGDVSSEIAAIKAVHLDFAEAALLDGSTLLVSHFETLDRLAAGIALVREA
SPRVRAELLALGEQMASVLGMERLRQEGLSPVFLDARDALQAASNSEDAGGYLSNSVIEG
ADARLQMRLKDAELVLTQGFIARNSRDETVLLGRGGSDTSAAYFANKLDAAKLEIWTDVP
GLFSADPRLTEGARLLQALSYDEAQEIATMGGKVLHPRCIGPARRANVPVEVRSTLRPEL
AGTLITAKPGDDAPQLKAVSVKSGVRIVAMEGAGMWRQAGFLADVFACFKECGVSVDLVS
TSETNVTVSLDPDPSLDQARLDALRARLERFCRVKIMDDGAAVSLVGYGVRRILHKLAPA
LEMFQDKPIRLVSQAANDLNFTVVVDASEGRALAARLHEELIAPA
>Cchl_Aa_|_CG-10
MAVMKFGGTSVGNARAMQQAIAIVANKEKSGAPLVVLSACSGITNKLIHIADAAGRSALA
EAMVLAAEVRAFHLALAAELVTTPERLHTLTTSITELVDRLEMLIKGVDIVGELTERSKD
MFCSFGELFSTTIFAAAMQERGHNAAWVDVRTVMITDDNFGFARPLDSVCEANALSIIRP
LLEQGTTVVTQGYIGATRDGRTTTLGRGGSDFSAALLGAWLDDSVIEIWTDVDGVMTCDP
RLVPDARSIRVMTFTEAAELAYLGAKVLHPDTIAPAVQKNIPVYVLNSIHPEAKGTLITN
DSEHLSGMSYEGLVKSIAVKKNQCIINVRSNRMMGRHGFMSELFELFAHYGVSVEMISTS
EVSVSLTVDDKCVTSELIQALGSLGDTEIEHNVATISVVGDNLRMSRGVAGRIFSSLKEV
NLRMISQGASEINVGFVVDEAEVATAVNTLHKEFFSTPNDHAIFEKPAGSH
>Cpha_Aa_|_CG-10
MAVMKFGGTSVGTARAMQQAITIVATKKKERAPLVVLSACSGITNKLIRIADAAGLSRLD
EAMAIAGEVRRHHLDLLDELVKSPAVKEELTVAVNLLVGELELLVKGVDIVGELTARSMD
MFCSFGELLSTTVFAAAMKEQGHDALWVDVRKVMVTDDNFGFARPIQALCEANALSMIKP
LLDAGTTVITQGYIGSSKAGKTTTLGRGGSDFSAALLGAWLDENAIEIWTDVDGVMTCDP
RLVPEARSIRVMTFTEAAELAYLGAKVLHPDTIAPAVLKNIPVYVLNSLHPQAKGTLITD
DPRMLSGMSYGGLVKSIAVKKGQCIINVRSNRMFGRHGFMNELFDVFSRYGVSVEMISTS
EVSISVTVDDRSFNEELIRELKTFSDVEIEHNVATVSVVGDNLRMSRGVAGRIFSSLKDV
NLRMISQGASEINVGFVVEEHDVAIAVNTLHREFFSGQETAGIFEIPAGSR
>Ctep_Aa_|_CG-10
MVVMKFGGTSVGSAAAMRQVIANVAEKKKSSAPLVVLSACSGITNKLIQIADAAGSGCLE
EAQQLVGEVRQFHLDLIGELIESEELQQEVIAKIEVYLTRLERLTEGIEIVGELTERSKD
RFCSFGELLSTSVFAAALNEAGVSCKWIDVRTVMITDDRFGFARPLAEICQKNTSEIIKP
LLDAGTVVVTQGYIGATESGRTTTLGRGGSDLSAALFGAWLHSESIEIWTDVDGVMTTDP
RIVPEAKSIRVMTFSEAAELAYLGAKVLHPDTIAPAVQKNIPVYVLNTWHPDSKGTLITN
DPELLAGKSHGGLVKSIAVKKAQAILNIRSNRMFGRHGFMSELFDVFERFGISVEMISTS
EVSVSLTVDDAVVSEPLIKALGALGEVEIEHKVATVSVVGDNLRMSKGVAGRIFNSLRNV
NLRMISQGASEINVGVVVDESDVQAAVASLHCEFFAESQCDAIFEKPAGS
>Plut_Aa_|_CG-10
MAVMKFGGTSVGTARAMQQAISIVAREAELSTPLVVLSACSGITNTLLKIADASGRGSLD
EAMALVGEVRSHHIGLVRELIPSAESQAVLIPRIEELLSRLELLVKGVEIVGELTERSRD
MFCSFGELLSTTVFAAAMQAAGHRAEWVDVRTVMVTDDHFGFARPILKECMANTEQIIRP
LQRAGTTVVTQGYIGRTEDGRTTTLGRGGSDLSAALLGAWLHESQIQIWTDVDGVMTCDP
RIVPEARSIRVMTFSEAAELAYLGAKVLHPDTIAPAVEKNIPVFVLNTWHPDARGTVITN
DPERLSGMSYGGLVKSIAVKKGQSIINVRSNRMLGRHGFMNELFNVFARYRVSVEMISTS
EVSVSVTVEDAPFSQELLGELREFGQVDIEHGVATVSVVGDNLRMSKGVAGRIFGALAEV
NLRMISQGASEINVGVVVGLHDVPVAVSALHREFFSGDDAAGIFEVPAGKA
>Pvib_Aa_|_CG-10
MAVMKFGGTSIGSAKAMRQAISIVARQEQESTPLVVLSACSGITNMLLRIADASGSGLLD
DALALAGEVRAHHLGLVDELLTEEAAKAELVLRIEEILSRLELLVKGVEIVGELTERSRD
MFCSFGELLSTTVFAAALQAAGHSARWVDIRTIMITDGNFGFARPIEAECRARATEVIAP
LLAAGTTVVTQGYIGATADGRTTTLGRGGSDLSAALLGAWLHLSAIQIWTDVDGVMTCDP
RVVPDARSIRVMTFSEAAELAYLGAKVLHPDTIAPAVEKNIPVFVLNTWHPDARGTVITN
DPVRLSGMSYGGLVKSIAVKKGQGIINIRSNRMLGRHGFMNELFDVFARYAISVEMIATS
EVSVSVTVDDACFTDMLLDDLREFGEVDVEHGVATVSVVGDNLRMSRGVAGRIFGALKEV
NLRMISQGASEINVGFVVGEHDVVAAINALHSEFFSGEDAAGIFEVPAGKP
>Bfra_Aa_|_CG-11
MKVLKFGGTSVGSAQRMKEVAKLITDGERKIVVLSAMSGTTNTLVEISDYLYKKNPEGAN
EIINKLEAKYKQHVDELYATEEYKQKGLEVIKSHFDYIRSYTKDLFTLFEEKVVLAQGEL
ISTAMVNYYLQECGVKSVLLPALEYMRTDKNAEPDPVYIKDKLQAQLDLYPDAEIYITQG
FICRNAYGEIDNLQRGGSDYTASLVGAAIHASEIQIWTDIDGMHNNDPRIVDKTAPVRQL
HFEEAAELAYFGAKILHPTCIQPAKYANIPVRLLNTMDPHAPGTLISNDTEKGKIKAVAA
KGNITAIKIKSSRMLLAHGFLRKVFEIFESYQTSIDMICTSEVGVSVSVDNTKHLNEILD
DLKKYGTVTVDKDMCIICVVGDLEWENVGFEAKALDAMRDIPVRMISFGGSNYNISFLIR
ECDKKVALQSLSDMLFNGK
>Bthe_Aa_|_CG-11
MKVLKFGGTSVGSAQRMKEVAKLITDGEQKIVVLSAMSGTTNTLVEISDYLYKKNPEGAN
EIINKLESKYKQHVDELFATQEYKQKGLEVIKSHFDYIRSYTKDLFTLFEEKVVLAQGEL
ISTAMVNFYLQECGVKSVLLPALEFMRTDKNAEPDPVYIKEKLQTQLELYPDMEIYITQG
FICRNAYGEIDNLQRGGSDYTASLIGAAVKASEIQIWTDIDGMHNNDPRIVDKTAPVRQL
HFEEAAELAYFGAKILHPTCIQPAKYANIPVRLLNTMDPDAPGTLISNDTEKGKIKAVAA
KNNITAIKIKSSRMLLAHGFLRKVFEIFESYQTSIDMICTSEVGVSVTIDNTKHLNEILD
DLKKYGTVTVDKDMCIICVVGDLEWENVGFEAKALDAMRDIPVRMISFGGSNYNISFLIR
DCDKKTALQSLSDMLFNNK
>Pgin_Aa_|_CG-11
MKVLKFGGTSVGDAERIRSVARLITSVKGRKIIVLSAMAGTTNSLVEIASHLVKRNVAQA
KEVVQVLREKYHREINALYKRPDTLSAAKKAVDSLLDSLGHMCDVEGFTLFEEKRVLILG
ELMSTTMMQIYLQEMGAVVAMLPALEYMRTDKNAEPDKDYIRKHLLPMIEAHPDEDMLFL
TEGYICRNAFGEIDNLQRGGSDYTASLIGAALNADEIQIWTDIDGMHNNDPRVVDVTAPV
RRLHFEEAAELAHFGAKILHPTCIKPAKEKNIPVRLLNTMDPDAPGTLISLDTEKDCIKA
VAAKDGITVIKVKSSNKLLSWHFMRKLFEIFEFYQEPVDMVATSEVGVSLTIDNDKNLPD
IVRALSDIGDVTVDKDMVIICIVGDMEWDNVGFEARIINALKGVPVRMISYGGSNYNVSV
LVKAEDKKKALIALSNKLFNSRATKA
>Gfor_Ab_|_CG-11
MKVLKFGGTSVGSAVSIRNVKEIISNLPGDKLLVLSAMSGVTNQLVEISEFVKTGSLDQV
SEKIQALKAKHFSLIDELVPDKTSNQSIKDHIVLQLEELVEICQVQPWSNEVDAKIITTG
ERLLTSIFSSYLKFEEVANTLLDARKFMKIHNLENPDTGLVGELLNDTLKSSFESNILIT
QGFVRLNAQNEVSTLKRGGSDYTATILGAAIRAAEIQIWTDISGLHNNDPRFVENTHAVS
QLSFEEAAELAYFGAKILHPQTISPVIGKNIPVYLKNTFTPEATGTCISALAERKGLKAI
SAKDEITAIKIKSNRMLMAHGFLKKIFEVFDTYETSIDMITTSEIAISLTIDNTANLDLI
LQELDQYGEISVDASHSIICVVGEGLIEDRGTSRLFEILQDVPIRMISYGGSSNNISLLV
DTRNKIEVLQKLNEKLFVNQLKSV
>Chut_Aa_|_CG-11
MRVLKFGGTSVGKPERMHSVAKLISSPDPKVVVLSAVSGTTNALVDISTKLCKKDIKAAE
DAIEKLFTPYHAFVEELYTTEAGKYKGHAIMRTYYELIKSYVTAPSFGDKETRFFLAQGE
LISTNLFQEYLAEQGYSSALLPALEFMKTDADSEPMLEYIEEKLNEQLAKHPNKQLYITQ
GYVCLNSDGEVDNLKRGGSDYTATLIGAALRMEEIQIWTDIDGMHNNDPRIVKRTFPIPE
ISFDEAAELAYFGAKILHPTCIRPAQVRKVPVRLLNTMQPEQKGTVINSKPSDRDITAIA
AKDDITAIKIKSSRMLQAHGFLRKVFEIFENYKTSVDMITTSEVAVSLTIDDAKNLEQIV
KELKEFSIVEVDTDQTIICIVGNFGKEKTGISKRLFDAMETIPVRMISYGGSASNISILI
NSTLKNETLNALNERLFFQAETVK
>Bfra_Ac_|_CG-11
MKRRQIRKKNRITKKNREMKIYKFGKIPTGSVQGMKGMLRLIDNSIPKIIVLSATTETTE
RLAGIAAHLFNRDTEQAHDEISRLEFRFIDFANELFNDESIKQQAVDSIIDRFRTLWNFT
RQRFTSVDEKDILAQGEFISSMLVSLYLKEQGINNRLLNSLDFMRLAPEEEPDMEYIGTK
LHLLLAEHKSTNVFLTQGHLCRNAYNETCYLKQGGDDVSATLIGAALQAQEVCLWTDSKE
LHSCDPRFVKHPAMVKQLSFDEAEQLAYCGWTGFNPHCILPARENNIPIRLLCSMEPAEG
GTLISNSQSGENIKAITARDNIYYIKFQSNRTLRPYLFISKIFDTFAKYHTSLCLFASSG
SDVSVAINDKERLSHILHELSRYAATVVKDHMCILSAIGNMQWQCAGFEARIINALATIP
IRMISYGSNNNNVSLVIRAEDKREALQRLNDTLFAPCHANPSQIHVPTLKHS
>Bthe_Ac_|_CG-11
MKVCKFEKMKEEDEIRQVINYILKEHPYVVVVPTLTQLQEWLQDISISWFHEEDSASHTT
INNIEEYCCTLADHLITDLPLNTDIKKYIRECIEKMHKLVEDKADLLIDKIIKAEIYRLS
GELFACCLRQHGLNARTLDTGTFMQMNLERKPDIPYIQESIRQYINENRDTDIFIAPLSL
CKNVYGEIDFMNEKRNDYYATVLASIFEADEIILSTELTNIYANRNCAREQHSLTYTEAE
QLINSGVHLIYTDCITLAARSNIVIRLIDTHDLETERLYISSHDTESSVKAIIVQDSVTF
VRFTSLNVLPGYLLMGKLLEVINKYQINVISMASSNVSVSMILTASRDTLRIIQRELHKY
TEMVVDENMSVIHIIGSLHWERTQLESNIMETIRHIPISLISYGGSDHCFTISVHTADKK
QLLNSLSQRFLERLSA
>ACID-2a_|_CG-12
MIVMKFGGTSVESAEAIDRVAGIVRGRLDRRPTVVVSAMSKATDQLLAMAAAAGAGDKEK
AVTLCQALRDRHFGVASALVSDASNPVHTSIAADYLALEQLLEGICAVGELTPRTQDNVV
AYGERINSKVVAAAFAARGLKATHVDAREIIVTDHTFGKATPQVAEIDRRLMAKVKPLID
DGVVPVLGGFIGSTPDGITTTIGRGGSDFSAALVGAGLNAEAIEIWTDVDGMKTTDPNLC
PDAHRIKVISFEEAAELAYFGAKVLHPATVLPAIEKNIPVYVLNSRNPSNEGTKIVARAP
QTRNPFKAIAAKKRITVIDVVAARMLMAHGFLRQIFEIFDRHKCAVDVVSTSEVSVSLTV
DSNERIPEIAADMEKLAFVKYSGRKAIVCLVGENIRERPGIAAQVFTAISDINVRMISQG
ASEINITFVIDEADVPEAVRRLHAHFFTDVDPEVFD
>ACID-2b_|_CG-12
MIVMKFGGTSVEDAAAISRVAGIVRDRAKQKPAVVVSALGGFTDSLVAMGKAAAKGDLAA
ALKLWKAGRQRHLAVLAGVKGAGAAEEQVQELFGNLQDVLKGIAALGELSPRTQDNVLSF
GEMLSSVMVVALFKAAGVDAIHIDARQCIVTDNCHTKAVPLLDQTNSRLRSALKEHLAKN
RVPVLGGFVGATEDGTQTTLGRGGSDFSAAIVGAALGAKKIEIWTDVEGMLTTDPRICKD
ARRIEVIGFEEASELAYFGAKVLHPATLIPAVESNIPVYVLNSRNPKSTGTCIQQHAPHS
ATTFRAIALKKGTKILNIRAPRLLINHGFLRSLFEVFEKHSLSPDLVNTSEVSVSVALDG
TRDVKALVSDLKRLGQVDVENGKAIVCLVGDNIRGRVGICADVFAVVAKHGVNIHMVSQG
ASEINISFVAEENEAVRAVKALHAHFFEEEKLTFAAKGDEVYAGCSGVA
>Susi_Aa_|_CG-12
MIVMKFGGTSVESAAAIERVAGIVRAREARRPVVVVSAMGKTTNKLLAIASAAIAGKRNE
YIPQLHDLRDYHSREARLVVPLSERAELDRFLDEHFQELTELVKGLAVLGELTPRSIDAI
SSYGERLSSYIVTLAFRHFGMAAEHIDSRDVIITDRRHTQAAPNFPETYARLQKTIPPLA
AQSVVVMGGFIGSTEDGVTSTLGRGGSDFTAAIVGAGIQAEEIQIWTDVDGMLTADPTIL
AGGHRVKTISFAEAAELAYFGAKVLHPATVVPAIEKNIPVMILNSRRPEVPGTHITAHTV
HCENAVKSIACKRKITTVSIHSTRMLMAHGFLHRIFEIFDRYQTPVDMVATSEVSVSLTI
DNTTHIDLVLGELRQFAEATVEHDSVIVCLVGENIRHTPGVARRVFNSLDGINIRMISQG
ASLLNISFVIAETDLVNAVRLLHEEFFATLDPNVFERKEAVHA
>Atha_a_|_CG-13
MASLQLYGVKTPGLALSSKRLEFASKGACFSVTLPSSSAVFRDVEHSCRNIGLRVSCEAL
RVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVESAERMKEVANLILSFPDERPVIVLSA
MGKTTNKLLKAGEKAVTCGVTNVESIEELSFIKELHLRTAHELGVETTVIEKHLEGLHQL
LKGISMMKELTLRTRDYLVSFGECMSTRLFSAYLNKIGHKARQYDAFEIGFITTDDFTNA
DILEATYPAVSKTLVGDWSKENAVPVVTGYLGKGWRSCAITTLGRGGSDLTATTIGKALG
LREIQVWKDVDGVLTCDPNIYPGAQSVPYLTFDEAAELAYFGAQVLHPLSMRPARDGDIP
VRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFTTF
EDLGISVDVVATSEVSISLTLDPAKLWGRELIQRVNELDNLVEELEKIAVVKLLQRRSII
SLIGNVQKSSLILEKVFQVFRSNGVNVQMISQGASKVNISLIVNDEEAEQCVRALHSAFF
ETDP
>Atha_c_|_CG-13
MAASMQFYGVKTPELALNSKRIEFSSKGLNFSALVSSARVFSRNVDRSCKNIALRVTCEA
GRVELLERKASETFKLNKTEKKLTCVMKFGGSSVASAERMIQVAKLILSFPDEKPVVVLS
AMAKTTNKLLMAGEKAVCCGVTNVDTIEELSYIKELHIRTAHELGVETAVIAEHLEGLEQ
LLKGVAMMKELTLRSRDYLVSFGECMSTRLFAAYLNKIGHKARQYDAFEIGIITTDDFTN
ADILEATYPAVSKKLLGDWSKENALPVVTGFLGKGWRSCAVTTLGRGGSDLTATTIGKAL
GLREIQVWKDVDGVLTCDPNIYCGAQPVPHLTFDEAAELAYFGAQVLHPLSMRPAREGNI
PVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDITSTRMLGQYGFLAKVFST
FEKLGISVDVVATSEVSISLTLDPSKFCSRELIQHELDQVVEELEKIAVVNLLRHRSIIS
LIGNVQRSSFILEKGFRVLRTNGINVQMISQGASKVNISLIVNDDEAEHCVKALHSAFFE
TDTCEAVSECPTGYIAASS
>Atha_b_|_CG-13
MAATRVRCCHSNAAFTRLPLTRHRNSPTLPISLNRVDFPTLKKLSLPIGDGSSIRKVSGS
GSRNIVRAVLEEKKTEAITEVDEKGITCVMKFGGSSVASAERMKEVADLILTFPEESPVI
VLSAMGKTTNNLLLAGEKAVSCGVSNASEIEELSIIKELHIRTVKELNIDPSVILTYLEE
LEQLLKGIAMMKELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDD
FTNGDILEATYPAVAKRLYDDWMHDPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIG
KALGLKEIQVWKDVDGVLTCDPTIYKRATPVPYLTFDEAAELAYFGAQVLHPQSMRPARE
GEIPVRVKNSYNPKAPGTIITKTRDMTKSILTSIVLKRNVTMLDIASTRMLGQVGFLAKV
FSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQQELDHVVEELEKIAVVNLLKGRA
IISLIGNVQHSSLILERAFHVLYTKGVNVQMISQGASKVNISFIVNEAEAEGCVQALHKS
FFESGDLSELLIQPRLGNGSPVRTLQVEN
>Aful_Aa_|_CG-14
MRIVMKFGGVSVKDGENIYHCANLVKKFSEGNEVVVVVSAMQGVTDALLKAAHRCCSEPS
AGFIKMFIADMMKRHYEAIEYAVRNDEIKAKVIAAVERLLDELEKVLLGISYLGELTRRS
EDYIVSFGERLSAPIFSAALLSLGVDSVALTGGDAGIITDRNFGRAKPLPGVYTTIRNRL
EPLLTIKKTIPVVTGFIGATDDGSITTLGRGGSDYTATILAAALDADEVWLWKEVDGIMT
CDPKYVPNARVIPEISYQEAMELSHFGAKILHPRALEPVMRKNIPVRIKNTFNPDAPGTV
IGPTTKDSSEIVKALSLIPQAGIVNVSGAGFDFAEIMSEVFGRLAEERVNVIMVAQSSSE
LNLSIVVDIRDLEKAYNALKSLENGVIKVEKIPYIAVVSAVGSGMAGTPGVAGKIFSALG
KNGINVIMISQSCSEYNVSFVVDGSDGVNAVKVVHDEFGLGN
>Umet_Aa_|_CG-14
MRLVMKFGGTSVGDGARIRNVARLVKGYQDQGNEVIAVASAMTGVTDKLYEMAQVAKDTC
STSDVEKRFGELAKRHETAIHDAIQDQGIRQEVSAEIERRLSELKNALVGVCYLGELTNR
SLAYIYSFGERMSVPILSGALRDLGAKSKPFTGGEAGVITDSRYESARPDPITDIKVREK
LLPLLQEGVIPAVTGFVAADSRGIITVLGRGGSDYSASIIGAAVDADEIWVYTDVNGIMT
TDPRIVPEAKTLPVVTYLEAMEMSYFGAKVLHPKTIEPAVKKGIPVRVLNTFQPDHPGTV
VLMKDNSANCAPIKAVTMIKNIGLVNISGAGLSGTPGIAGKIFSVLGKEDINIIMISQAS
SEFNVSMAIDGAQVDKAIAALRREFNGEIERDLTCDNNVCVVAVVGAGMAGSPGTAGKIF
TALGKSGVNIRMISQGSSEANISFVINKEDAQRAVKILHDEFELHNL
>Mthe-2_Aa_|_CG-14
MARLVMKFGGVSVADGRRLRNVGELVRGFSSGNEIVVVTSALQGVTDDLLECARSSAKYG
RVSDVDDFIMRLAEKHEQAITDAISDEAIRDEIRSDIRKKIDTLEKAYVGICYLGELTPR
SIDYISSFGEQLSAPILSGVFRDMGIESRYYTGGEVGIITNSDYGNAKPLEKSYSLIAKK
LLPIKGIPVVTGFIAMDENGIITTLGRGGSDFSASIIGAAIDADEIWFWKETSGVLTADP
KIDPSAKTIPTISYIEAMELSFFGAKVLHPRAIEPAIRKGIPVRVKCTFDPESPGTQIVQ
EEELKDGVIKAVSLSTNVALLNVSGAEMIGTPGVAARVFSALANAGVNIIMISQGSSEAN
ISMVVEEKDLDKAEEALRRDLPREIVRGISHNKDVCVVAVVGSGMAGTPGVAGRLFSAMG
RAGINVRMISQGSSEHNISFVVAAKDGKRAVQKIHREFRLNGDRA
>Mbur_Aa_|_CG-14
MRYVMKFGGTSIADGKKIRHVAQLLIGYKEGGDQVVAITSALGGVTDGILTNAAEASQKG
KVSQVKEFMAELAKKHYDAISDAIDNERIADEVIETIDIRIDELEKALIGICYLGELTPR
SIDYISSYGERLAVPIISGSIRSMGIDSKPFTGGEAGINTTENYGNARPLKKSYAQIKEV
VGPLVENSIPVVTGFIAEDKNGIITTLGRGGSDFTASLIGAAIQADEIWLWKEVHGIMTT
DPKIVPEASTISQISYIEAMELSYFGAKVLHPRAIEPAIIHGIPVRVKNTFDTQFPGTLI
VADQNCSEEVAKAVTLIRNVAAINICGAGMVGAIGTAAKIFTTLANAGVNIIMISQSSSE
ANMSLVIEQSHLKRAIKSLEHAFNEGVVGEVAYDEDVCVVAVVGAGMDGSPGVAGKIFGA
LGKEKINVIMISQGSSQHNISFVVKEEDAEEAVKVLHREFGLGKKNGCN
>Mace_Aa_|_CG-14
MKIVMKFGGTSVGDGKKIRHVAQLLKRYHEEGNQIVVVTSALGGVTDRLLENARLASTKG
KVSLVKEFKTELTNKHHEAVKDAIEDPRVAKEVLQVLDLRIEELEKALIGICYLGELTSR
SIDYISSYGERLAAPIVSGAVRSLGAASIEYTGGEAGIVTTSDYGNARPLEKTYELVLKR
LGCRLESHILVVTGFIGENEDGIITTLGRSGSDFSASILGAALKADEIWLWKEVNGIMTT
DPRIVPEAKTIPQISYAEAMELSYFGANVLHPRTIEPAMREHIPVRVKNTFNPEFPGTLV
VAEKFQCRHVVKAVSLIKNVALINISGAEMPGTVGTVARLFTALARAGVNIVMISQGSSE
SNLSFVVSESHVESALKALHAEFNREIVKEITSDRNVCVVAVVGAGMAGTPGVAKRVFGA
LGNSMINIIMISQGSSQYNISFVVREGDAFAAVKTLHDEFELYNGNGIEKKL
>Mbar_Aa_|_CG-14
MKIVMKFGGTSVGDGKKIRHVAQLLKRYREEGNQIVVVTSALGGVTDELLENALFASTKG
KVSLVKEFKTEITNKHHKAVKDAIDDPTVAKEVIQTLDLRIDELEKALVGICYLGELTSR
SIDYICSYGERLAAPIVSGAIRSLGIESTEFTGGEAGIITSSDYGNARPLEKTYELVNKR
LGCRLETQILVVTGFIGENEEGIITTLGRSGSDFTASILGAALKADEIWLWKEVNGIMTT
DPRIVPEAKTIPQISYAEAMELSYFGANILHPRTIEPAMREHIPVRVKNTFEPKLPGTLV
VAEKFQCKNVVKAVSLIKNVALINISGAEMVGAIGTVARLFAVLAKSGVNVIMISQGSSE
SNISFVISEAHVKTALKALHEEFNRGIVKEITSDKNVCVVAVVGAGMAGTPGVAKRVFGA
LGNSLINIIMISQGSSQYNISFVVRENDAFAAVKTLHDEFELYNGNGIEKQL
>Mmaz_Aa_|_CG-14
MLKRDPIMKIVMKFGGTSVGDGKKIRHVAHLLKKYNEEGNQIVVVTSALGGVTDRLLENA
RLASTKGKVSLVKEFKTELTNKHHEAVRDAIEDPNVAKDVLHILDLRIDELEKALIGICY
LGELTNRSIDYISSYGERLAAPIISGAVRSLGIPSIEYTGGEAGILTTSDYGNARPLEKT
YELVSKRLGCRLDSHILVVTGFIGENEDGIITTLGRSGSDFSASILGAALKADEIWLWKE
VNGIMTTDPRIVPEAKTIPQISYAEAMELSYFGANVLHPRTIEPAMREHIPVRVKNTFDP
EFPGTLVVSEKFQCKHVVKAVSLIKNVALINISGAEMAGTIGTVARLFTALARAGVNIVM
ISQGSSESNLSFVVSEAHVEPALKALHAEFNREIIKEITSDKNVCVVAVVGAGMAGTPGV
AKRVFGALGNSMINIIMISQGSSQYNISFVVREDDAFAAVKTLHDEFELYNGNGIEKKL
>Mmar-6_Aa_|_CG-15
MKFGGTSVGEADCIGRVADIVESHRSAGDEVAVVVSACSGITDRIIAVADEVIASKEQPD
IGTLLDAMRERHTRLLKETAPDHAREVTAVIDDRLTRLQNILTAVHTLKELTPRSRDYIV
SFGERLSAPIVAAALRQRGIASVALDGAEAGITTTANHGDARALPVSAENIRARVAPLLA
DAVPVIMGFMGATEQGVITTLGRSGSDYSAAVIGAGVDADEIWIWTDVDGVMTSDPRIIP
DARVLDDISYLEVMELSYFGAKVLHPRSIEPAMQKDIPIRVKNSFKPEVPGTLVLRDKHQ
EKRVVKAIALIEKVALVNINGAQMVGRPGVAKTIFSALAEREVNVMMISQGSSEANISLI
IDESHLDAALGALDPLVEQGIVREVTYDHDVAAVAVVGAGMAGTPGTGGRIFSAIGRAGI
NMMMISQGSSEVNVSFVVKAGDGKRALQVLHDEFRLSENSDD
>Mhun_Aa_|_CG-15
MKLIMKFGGTSVQNAESVRRAVDIVYDRYSRHDRLAIVISARRGVTDRLITCAEAMVTSR
DAAEVTDLVEYLTEGHLSTLKEVAPDFSPEVSGIITRRIENLRDFLYAVYHLRELTVRSR
DYIISFGERLNAPIISAALRQRGIPSMVLDGCEAGILTTENHGDAIALPAGEARIKSRLE
PVIDHSVPVITGFMGCTEKGVVTTLGRSGSDYSATIIGAALDADEIWIWTDVDGIMTTDP
RLVPEARVIPRISYIEVMELSYFGAKVMHSRSIEPAMQKGIPVWVKNTFNPSYPGTVIEG
GEQKDSRVVKAITYIDKVAAITIAGAQMVGRPGVARHIFTLLAEHQINVMMISQGSSEAN
ITLIIEANQVRTAMEALLPLKERCVFRDITANEDVCAVAVVGSGMAGMAGTAGRTFSALG
KAGINVMMISQGSSEVNISFVVRQQDGPRAVKVLHDEFNLMNEEA
>Mjan_Aa_|_CG-16
MTTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVR
DIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPK
SRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLP
LLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDP
RLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITN
DMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETN
ISLVVSEEDVDKALKALKREFGDFGKKSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGI
AGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEKTNS
>Mmar-5_Aa_|_CG-16
MVTVMKFGGTSVGNGERIRNVAKIVVNKTNEDKDVVVVTSAMTQVTNSLVEISAQALDVR
DIAKINNFIEDLRRKHEIAIEQAIENHDIRVEVSKTIQSSINDLEKVLVGVSYLGELTPK
SKDFILSFGERLSAPILSGAIRDMGKHSLFLAGRDAGIITDDTFTCAKILRLDVADKIEP
LLKDGFIPVVTGFVAGTEEGHITTLGRGGSDYSAALVGRGLMANMVEIWTDVSGVLSADP
RMVENVKKIPKMSYIEAMELAYFGAKVLHPRTMEPVMEKKIPLRIKNTFEPENEGTLITD
SSETSNGVIKAITTIKDVILINIFGGGMVGVSGTAARIFNVLGKSNANVILITQGSSETN
ISIVIYDGELEAKKCVRELRSEFGECHLIKDISFDKDVCVVSVVGSGMKGAKGIAGKLFD
AVAESGANIKMIAQGSSETNISFVINEDKLEPCLKNLHKTFVEDDINF
>Dgeo_Aa_|_CG-17
MAYSLLVMKFGGTNMQDAQAIRHSASLAARSIREGVKVVVVVSAMAGVTNQLLGLADAAQ
RGDIATANDEIAALRTRHFAAAQELGAAPDSEVVREIRELHETLRQAVYGVYLLRELTPR
SRDLIVAFGERFSAPLMRLALEGQGLLAHHLTGGQAGITTDTHFGNARPLPGTYERIRDR
LGGLLAAGVTPVVAGFMGETEEGAITTLGRGGTDFSATIIGKALDADEVWAWKDVDGVMS
ADPRVVPDARNIEVLSYGEVMELAYFGAKVLHPLAVTPLQESGIPLRVKSAADPDFPGTL
VQEGAHNEAGHPVKAVTAIRRVSIINVTGAGVLGVPEVVASLFEAIARENITLLMVSQSS
SMSNVSLAVQSADAARTLDALRRRVTGELNIEEQPGVAVLAIVGAGMRGQKGVAARLFGA
LAAADVNILMISQGSSELNISVALEDAQVERATRAVHAAFGLGQTAAAAD
>Drad_Aa_|_CG-17
MSQPQPPSRLLVMKFGGTNMQSAHAIRHSASLAGRSVREGVKVVVVVSAMAGVTNGLLHL
ADAAQSGDIARANDEIAALRTRHFTAAQELGAAPDSETVRELRELHETLRQAVYGVYLLR
ELTPRSRDLIVAFGERLSAPLMSLALEQSGLRARHLTGGEAGILTDTNFGNARPLPGTYE
RVGDRLSGFLSAGVTPVIAGFMGETEQGAITTLGRGGTDFSATIVGKALGADEVWAWKDV
DGVMSADPRVVGDASNIGVLSYGEVMELAYFGAKVLHPLAVTPLQDSGIPLRVKSAADPD
FAGTLVRSQAEEIPGRPVKAVTAIKNVSLLTVTGAGVLGVPEVIASVFTAIARENITLLM
VSQSSSMSNVSLAVPSADAARALQALRAGLSSELNVEETNGVAVLAIVGSGMRGQQGVSA
RLFTALASEDINILMISQGSSELNISVALSGEEVDRATAAVHAAFTLSQPVGA
>Paby_Aa_|_CG-18
VRKMIVLKFGGSSVKNDFHEAVSLTKSIFEEKEVAVVVSALKGITDMLIKYAKTFDSKYA
IKIADSYVKFARTNGVDPNILSPHIQELFNPPSLPKDALTDYILSIGELLSAVIFAEVVE
GQVIYPWELFSAYGKFGDGFIDLKKSKKNAKIIYEVIDSGKIPIVPGFVGGMDGYRVTLG
RGGSDYSAVALGVILNSELVAIMSNVEGIFTADPKLVPSARLIPYLSYEEALIAAKHGMK
AIQWKAAELAKEKKILMLFGRTNNWRMGTVISNRTSRMPLMTYKDGLLLINVEEELEYRV
IDEGPFWKLYDVPGNEGIRIIRELHKAIFGNVLSMLQEPGKHIRINRHKVGKSFEHMTFN
QSFSRKFY
>Paby_Ab_|_CG-18
VVYKLLVVKFGGSSVRYAFEEALELVKYLSERIPIVVVVSALKGVTDELIRFANGDKGAL
PRIERIHEEFLNYHGLNTKISISFRKDMPPEALRDEIISLGERISAKIFAEGLELLGIKS
KVVDPLEFLIAKGEFGDAYINIQESKRRAGKLIRLIKSGVIPVIPGFYGNLNGFRVTFGR
GGSDYSATALARILDSRCVLIMSDVEGIFTADPKLVPSARLIPYLSYEEIKVAAKLGMKA
LHWKAVDPVVGDIPIIFGKTKDWKFGTIVLNARSNFPIIVHRVREDFAEIFVVGRNISLP
GFLVEEEREDFVKIVVAREDLPEAIREIHREVVEREEKNLRTGNNSELWARI
>Pfur_Aa_|_CG-18
VVEKPVVVKFGGTSVRYAFEEALELVANLNENTRTIVVVSALAGVTDCLLRLANGDMSAL
LEIEEIHEELSQELDVQLDHLMYQLHKTLNSKSSFPSKEAFVDEIASFGERFSAELFSEG
LKILGINAKAVDSKDILFAKGDYGNAEVDFKKSVYGAGILYRMLRRGIVPVVTGYYGNLN
GFRATFGRGGSDYSATSIARLVNAKATLIMSDVEGIYTADPKLVPSAKLIHYISYREAKI
AAKLGMKALHHRAIDPVEGRIPVILGKTRDLKFGTLISHKSQGIPVVVHKLIEDHAEVSV
VSTRRSFSLPYEVYEEGDFYFKIKIPKEQFLEVLKDIHRRVVENESLRPSYDSELWAWV
>Pfur_Ab_|_CG-18
MIVLKFGGSSIKYDFEEATNLALSLFEDDAVIVVVSAIKGITDKLILYSQTLDKTIATKI
ASEYVSFAKSHGIDPVILKPYLDELFNLPDLPEEALRDYILSLGEVLSAVIFSASIGGKF
VPSWDIFEAEGNFGNAFIDIKSSKKKFKRVFEVLEEGYIPVIPGFTAGKDGYILTLGRGG
SDYSGVAAGVLGKAKLVAIMSDVEGIYTADPKLVPSARLIPYVSYDEIIISSKHGMRALQ
WKAAELAKEYKIPVLFGRTRNWRMGTLMSERSSGMPLMTYKDGLLLVNVTEEIKYPIIAE
GPFWKLYKVSQEEGIHLMRELHTKLFQPSFIQYSVYKSSENGQKTQEFNEKISIEQGENR
KIYYSEEEVNLPG
>Phor_Aa_|_CG-18
MNLRGKMIVIKFGGSSLRSEFKSAVSLIKALSEEKDVVVVVSALKGITDLLEKYTDTFDS
RYAVEVSKTYLEFGKRMGIDTSSLSPYLKQLFNPPDLPPQALRDYILSIGELLSAAMIAE
KANGAVIFPWDLFVAHGSFGNGFIDIKKSKRNVKLVKEALESGKIPIIPGFIANLNGYRV
TLGRGGSDYSAVALGVLLNSELVAIMSDVEGIFTADPKMIPYSLLIPYMSYDEILIASKY
GMEAIQWKAAKLAKEYEALILFGRASDWRMGTVVSNSSSHMPLLSYDQGKLLVMNMDSEI
PYEVVEEGEFWRVYRVPKRDSIKIIKELHRKIIYQENAQLLGRVKA
>Phor_Ab_|_CG-18
VVEKPVVIKFGGTSVRYAFEEALELVAKLHENMKIIVVVSALAGVTDCLLRLAKGDKSAL
LEIDEIHEELSQELNVQLEHLIHQLKKTINSKSSFPSEKAFIDEIASFGERFSAKLFSEG
LKILGITARPVDSKDVLFVKGEFGNAEVEFKKSAQGVDVLYRMLRRGIVPVVTGYYGNLN
GFRATFGRGGSDYSATSIASLVNAKAVLIMSDVEGIYTADPKLVPPARLIHYISYKEAKT
AAKLGMKVLHPRAIDPVEGKIPVILGKTRDLKFGTLISHESQGIPIVTHKLLENHAEISV
VSVKTNIPLPYEVYEEGDLYFKIKTSKDQFLEVLRDVHRRVVENENLHSSHDGELWTWV
>Tkod_Aa_|_CG-18
VVKFGGTSVRDDFREAVTFVSRLWDENEVALVVSAIKGVTDALLKFSRTGEGFEWIEKVH
RDFAKKYGIPFETLAAPLRELKKLSREDFPSFEAYRDHVLSYGEWLSGLAFAEALRREGI
QVELFEPWEILETDGNFGNARVDIAKTSRNLKVVEEALERGRVAVVPGFVGSYNGLRTTL
GREGSDYTAAVLGKGLKARAVLIMSGVDGIYTADPRRVVSARLIPFVSYDELYVASKAGM
KAIHHGAIDVVRGIPIIFGRTRDWSIGTIAGYESSSLPILVHRVAGEEAVITAVGVAEVP
GFDGENGSELGIPLVRLTVPSARLGSTLNLIHLRLIADRISPPRALSIIRGGVSAGNV
>Aper_Aa_|_CG-19
VVGCAPNDLVVVKFGGSVLNGSPGFLAAGRLVLGLLESGLEPVVVVSAVKGVTDALLSSF
ERRDPGVGGAVGKTYLSIARELGLPPESVRDVSLASAEVSKLLWAAEVLGQWTPRVRDLV
VSYGERLSAALMAGLLRRLGVEARWLGGGEAGIVTDGEFGDATPLYGYTEGVIRERLEPM
LEEGVVPVVAGFTGATREGDTTLLGRGGSDLTATLLASALGAGRVVLYTDVPGILSGDPR
VVGEPRRVGYMSYEEAWEVARLGLRKFHPRTFEPLIAGGLGVEVVVSDLRGRSTRIGPGR
GGPPLKVVSLSRGVARLVVRGPSMAGKRGFLSRLAGLLAGRGVNILAIRQPPSETAIELV
VDERDLPAAVEELGARSGAAGVRLEVERGFDVVSIVGWGAVEALPEALSAAEKTGGRLLS
TGELSPSISILARGRTSPELARLLHRRVVESWVTG
>Mkan_Aa_|_CG-19
MEVHKFGGTSVASEEGLRTLEASAASGHVIVVSALAGVTDALEDFVRRAAEGSADPTPIL
ERHREFITEHLEQRHEEVESFLKDMETLLHGVATVLEQLGRPEERLRDLVLSLGERASAR
IVAAYLKERGIKAMAYDAWDVGLVTTDDPGNADIVGWDGTRSRLLRDLRSGRVPVVTGFI
GRSDRGHVTTLGRGGSDYTATVLAGVLGSRSVIWTDVDGIMTTDPELADAEVVERLSYEE
AMMAGASGAGVIHPKAVEAAKNLGVTVLIGNSFTGEIGTVISDSTEPGPKVVASRDDVAL
IRVSGAKMVDEPGVVGRVTSALGNAGVNLLAVFTTVSEPYINLLVEETALRSAEEALNGL
DYDWEVDKDVGLVTVVGEGMSARDVSTFLAACEGFDLLGSAHGVVAVSVVVPESEVREVT
RRLAERLLA
>Msed_Aa_|_CG-20
MLVVKIGGSIQKDERDFELIANRISQYSSRDRTIVVTSALKGVTNSLIEATENRDKAVEI
VSEIYDRHVKLLSKIVDGPEFDNAFKSISKLADELFRIAWSIKVLDEISARVRDYILSFG
ERMASVTLGAMLRSRKMDAQSYPEPLLVTDDSFGEANVIEDLSAMEARKVLDIPSKIVVV
PGFIGKTPTERYTTVGRGGSDYTATLLGKLLGFPEVRLVTEVPGIMTADPRKFPGAKTIS
RLSLEEAMELAQMGAKRLHPRTFEPMFDRDIRVYIEGLYDEGYTLVQGTCDSSDKLKGIA
VLDDLKLISVESTNIVGKIGSAARVMEKAREAGVNIISLSQPASETTIHIVVDSKNAERL
SSRLQELRDVDSINVQDASAVSVVGCGLRNKELFREVLREASSFEVASISRGLRNVSATF
VVKKDEGFNLAKDLHEVVVKWIN
>Saci_Aa_|_CG-20
MIKVIKIGGSIQKDEKDYELIADKISKYSDENRTLIVTSAIKGVTDQLTSVINETDKAVD
KVTEIYDKHIKLLSKLVDGIEFEKAFRDISRLVDELYRIAWSIRVLDEATPRVKDYILSF
GERLAVILLSSFLRTRKFSVNNLIEPPIVTDENYSEANVLLEDSKELLSKKLEESQQKIV
VLPGFIGKSKNNRYTTIGRGGSDYTATLIGKLVDAKEVRLVTEVPGIMTADPRKISNSVT
IQRLSLEEAIELSQLGAKKLHPRTFDPLFDANMKVIIEGLYEEGCTIIEGLCTSKDGLKG
ITTKEGLSLITIESTRIVGKIGSASTITSEAKNANVNIIALSQPASETTIQFVVDQKDQK
KFVERLSQLSGLIKNIELSEVGAVSIVGCGLRNKEISSKVLSKASSYNPIFVSRGLKGVS
ITFIVDKKELDSISKELHEVVVNWSIN
>Ssol_Aa_|_CG-20
MALIVKIGGSIQKDEKDYELIVKKIQDFSKKSDKIIVVTSAIKNVTNELISATSNTDNSP
NIVTEIYERHIKLLSKLADGKEFENSFKDISRLSDELFRVAWSIRVLDEVTPRVRDYILS
FGERMATLLLSAILRSNGIEAEGIITPPFLTDENYGEANVIEDLSKNEIANILENAKANV
IVLPGFIGRTREGRYTTLGRGGSDYTATLLGKLVGVREVRLVTEVPGIMTGDPKKFENAK
TISRLSLEEAIELSQLGAKRLHPRTFDPVFGSDMKVIVESLYEDGFTIINGECQNNDGLK
GISLLDNAKLITVESTKIVGKIGSAARITNEAKEAGVNIISISQPASETTIQLVVDSLSA
NRLLSKLEEIRGTLVKDIEVNDINIVGIVGCGIKKKEISTKVLSIASSYDPLAISRGISN
VSMTFIVNKDEGEKLAKELHKVIVSG
>Stok_Aa_|_CG-20
MKVIKIGGSIQKDEKDYELILDKLKKEIDYNDKNIIVTSAIKNITNQLLDIIKNTDKAMD
IVTDIYDRHVRLLSKLTNGIEFERSFGEISKLADELFKIAWSVRVLDEVTPRVKDYILSF
GERFAVILLSAFLRSNNIQSSYILDPPLITDENFGEANVLLQQSKENLTKKIDGINGNVI
VIPGFIGKSTQNKFTTIGRGGSDYTATIVGKILGAKEVKLITEVPGIMTADPKKIPQAKT
IPRLALEEAIELSQLGAKKLHPRTFDPIFNTNLKVVIEGLYEEGSTVIEGNCTKDDILKG
IATRNNLELITIESTNIVGKIGSAATIMSEARNANVNLIAISQPVSETVIQLVIESQDKD
RLIERLNNLNNLIEDIQSRKVSAISIVGCGLRNKEISAKVINKASSLDPIFISRGLKGVS
LTFIVDEKDENSLAKELHEVILEWQTK
>Bbac_Ab_|_CG-21
MAKLVVSKFGGTSMGDADCMLRSAEVSFRQGSGLVVVSATSGTTNDLIALGKTAESQAWS
ESEKILSKIQDKHNKIAQDLKLPADAKAKLETLFEEMSSLAKGMHLLKDCSVKAMDTLMS
LGERMSSVLFTEAMSQVLKKHGSAKSAELLDVRTVLRTDDQFGKAKPLTNDVANLCQKNL
SFLREGKKVMCTQGYIGMTEEGITTTLGRGGSDYSAAILAEGVSADVLEIWTDVAGIATT
DPRLCPKAQPISEISFKEASELATFGAKVLHPATLLPAIRKNIPVFVGSSFDVEARGTWV
RMDVEDHPLIRAMALRKKQVLVTLSTPEMLYAHGFLFQIFKIFNDHKVSIDAITTSEISV
SVTLDDSTLLNKNLIKDLSQIADVQVEENLALISLIGNNINHTPGLGKRIFETIPDINVR
MICLGASKHNFCFLVADEQGPEVIKRLHACFIEAGIEEMA
>Ahyd_Ab_|_CG-21
MSPINVAKFGGTSVANAAAMNNCAEVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
QEAQLARLTEIQQAILTELGDPGDLSDLIHGQLGEIRTMARQAHLHTDAELADRLIACGE
LMSTRLFTELLRQRGVKACWQDARQLLRTDSRFGKASVDLAATRALCQAALGPLLGDSLI
ITQGFIGADGDGRTTTLGRGGSDYSAALLAEALDAGTIEIWTDVPGIYTTDPRLVTRARP
IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTRTNPLF
RAVALRRNQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
SNGEPILGDKVLAELGQLCKVQVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
YGASAHNLCFLVKEDEAGHIVNRLHQELLD
>Asal_Ab_|_CG-21
MSPMNVAKFGGTSVANAAAMNNCANVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
QEAQLAKLAEIQQAILTALGDPADVSTLIHATLGEIRTMARQASQHTDAELADRLIACGE
LMSTRLFTELLHQRGIKAHWQDVRQLMRTDSRFGKATVDLGATRGLCQQALGPLLGDSLI
ITQGFIGSDADGRTTTLGRGGSDYSAALLAEALDAGSIEIWTDVPGIYTTDPRLVTRARP
IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTSTNPLF
RAVALRRQQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
SNGEPVLSDKVLAELGQLCKVKVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
YGASAHNLCFLVKEEEAGHIVNRLHQELLD
>Cpsy_Aa_|_CG-21
MNSVQSTSSLTVAKFGGTSVADYQAMLRCANIIKNDNSNRLVVVSASSGVTNLLVRLSQK
NVSVIEQKDIVENIRAIQVNITQHLSSDVEAQLNQEINSLLDELTQHALTQLLQYSTKTA
DAILAFGEQFSSRIFAQVLQSVDIPGEYFNVQQVMKTNSLYGKAVVDLNQLSEQSTQLLA
PKLIDKVIVTQGFIGQDSQGHTTTLGRGGSDYSAALLAEALNGTNLSIWTDVVGIFTTDP
RITDQARAIKEISFGEAAEMATFGAKILHPATLIPAMRRNIPVFVGSSKEPEKGGTQIKQ
KVDSNPTYRSIALRREQTLVTVKSPAMLHASGFLAKVFGVLAKHELSIDLITTSEISVAL
TFDNPSGSTQSLITNAVVAELEQLCEVSVEHGLSLVAVIGNGLTCAKGIGQSIFETINDV
NIRLICHGASANNLCFLVNEDEANYVVEKLHNTLFA
>Iloi_Aa_|_CG-21
MTFTVAKFGGTSVADYASMLRCAEIIQSNSSIRLVVVSACAGVTNRLVAIADLQGRQIEK
LLNEIYEIHFAIQKRLKNASQVQKSLEQLHHKLALHCQKTTEDQASWRDELLSFGERCSS
LLFSSLLVEQGLCSSTLDARQLLKTNSDFGRAQPDEVTTKSHCLEQKQKLESGCVRVTQG
FIGSDENNQTTTLGRGGSDYSAALLAAGFNATDLQIWTDVAGIYTTDPRICPSARAIAEM
SFSEAAELATFGAKILHPSSLAPAIKNDIRVFIGNSQDALSGGTYISASPTSRPDVRAIA
LRRDQTLVTVHSLNMLHASGFLARLFEILARYNVSVDLVTTSEVSIALTLDEGGSAANGQ
ALLPAAALEELEQFCRVEVETGLSLVAIIGNGIGRDAHISQLTFNTVNDYAVRLICQGAS
EHNLCFLVADNEGENVIRTLHDRILR
>Patl_Aa_|_CG-21
MSDSSINVAKFGGTSVATYATMLNCAKVVKGNPATKVVVVSASAGVTNILVELAHKALTK
DEISAYIEQIQAIEFAILNDLGAPTLVADKLLELLESLKQLAFHEEILHRPDLKDSLLSH
GERMASLLFSEVLTQQGLPADNFDVRNVLLTDSEFGQAAPQLDGIKQRAAKLMAPEIAKT
VLVTQGFIGSDEAGNTTTLGRGGSDFTAALLAEALGAQSCEIWTDVIGVYTTDPRITDAA
RPLPELSFEEAAEMATFGAKVLHPATMEPALRQNIKVFVGSSKEPEKGGTWIVRDCEHEP
SYRAITRRKDQVMVTVKTPKMMYAQGFLQNVFTIIAKHNLSVDLVTTSEICVSFTLDNPP
NSVLQRLNRETIEELSQICEVELEEHFDLVTVVGNNMHSAAGVSSRIFAAVSDFNLRMIC
FGANVHNMSMLVSEKDSSNVVKALHKSLFEAE
>Phal_Ab_|_CG-21
MGLNPQNCHQYRWRASGSEFSYLIFAAKFFLFYYGLDAVKGDEMTTQSVPHVVLGNKSNY
TVAKFGGTSVANFAAMDHSSKIIVADKSVRIVALSASAGVTNHLVELCNSSLSEDERQAH
INGVLAIQQAILAELSLDTDLEQGFAQTLAAFEKLASQTLQTKALHDELLSFGERLSTYL
FTQVLRSKGLNAIRFDVRQVLKTDSQFGKATPNVAATAQAASALLIPLLDDQVIVTQGFI
GSDEHGQTTTLGRGGSDYSAALLAEAIHAKSVHIWTDVVGIFSTDPRLCVKATPIARLSF
DEAAEMATFGAKVLHPATILPASRSHINVFVGSSREPERGGTWIEREKSQLPGIRAVTQR
KNQILLTLKSPEMLLASGFLARVFTILSEFNISVDLVTTSEISVAITLDNAPNASRPELD
QGCLDKLAEFCHVSVENNLTLVALIGSEIQLRQHEMNLMQVLSDFNIRLICHGASKHNLC
FLVEQGESDNVVQAIHSRLLESDCAA
>Sama_Ab_|_CG-21
MSLVVAKFGGTSVADFNAMSRCAAIVLANSATRLVVVSASSGVTNLLVELTQATVTDERR
LQLLKQIAQIQYAILDKLERPQDVAAALDALLSRISVLSESLILNRSKAIMDELLSMGEQ
CSALLFSAVLRQQGAKSSSFDVRQVMRTDSHFGRAEPQIEDIAALARDFLQPLLERDIVV
TQGFIGADAEGRTTTLGRGGSDYSAALLAEALRADAVEIWTDVAGIYTTDPRLAPNARPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSREPEKGGTWIRHQVDNPPIYR
AVAVRRDQTLLNLHSLQMLHARGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
TGSGLLSEALLQELSQHCRVRVEDNLALVAIIGNRIASTPGICRQVFTVLENHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFEGQA
>Sbal_Ab_|_CG-21
MSLVVAKFGGTSVADYNAMNRCADIVLANPHCRLVVVSASSGVTNLLVELTQESINDDGR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMSVLSDALASQRSKATMDELLSLGEQ
CSSALFSAVIREKGVNSSAFDVRRVLRTDSHFGRAEPQVEQIATLARDYLQPLLAEQVIV
TQGFIGADEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAFPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVTESEAAQVVKSLHQNLFEGA
>Sden_Aa_|_CG-21
MSLVVAKFGGTSVACHYSMVRCAQIVINSPMTRLVVVSASSGVTNCLVELTQSNINDQQR
QTLLTEIAKIQYGICDGLSRRAEVLSNIDVILSRIAELSDALVLNRSKALMDELLATGEQ
CSALLFAAVLREQGANAQAFDVRQVLRTDNHFGRAEPQIAFIADLAQTQLAPLLQSQVIV
TQGFVGADVDGNTTTLGRGGSDYSAALLAEALQASAVEIWTDVAGIYTTDPRLAPNARPL
KEISFNEAAEMATFGAKVLHPATILPAVRQQINVFVGSSKAPEEGGTWIRHQTEDSPVFR
AVTLRKDQTLLNLHSLQMLHTQGFLAETFATLAKHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLTEALLADLSEHCRVKVEDQLALVAIIGNKIASTAGICARVFNVLVDFNVRMICQ
GASPHNLCVLVSAADASAVVQALHSDLFE
>Sfri_Ab_|_CG-21
MSFVQSEIDTPELVVAKFGGTSVADYASMSRCADIVLANQATRLVVVSASSGVTNLLVEL
TQANVNDERRLVLLKQIAQIQYAILDELGRPQDVAASIDKILSRMSVLSESLELNRSKAV
MDELLSTGEQCSSILFSAVIREKGTASNHFDVRQVLRTDSHFGRAEPQIEAISTLAGDFL
QPLLARYVIVTQGFIGADEEGRTTTLGRGGSDYSAALLAEALRATAVEIWTDVAGIYTTD
PRLAPNARPIAEISFNEAAEMATFGAKVLHPATILPAVRQKIQVFVGSSKAPELGGTWIR
HQVEDTPVFRAVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVS
LTLDKTGSDSSGQGLLSESLLQELSQHCRVRVEENLALIAIIGNRIASTAGICSRVFKVL
ENHNVRMICQGASPHNLCVLVAESEAAQVVNALHQNLFE
>Sloi_Aa_|_CG-21
MSIVVAKFGGTSVADYEAMNRCADIVLANPETRVVVVSASSGVTNLLVELTQEHVDFERR
QQLLKAIASIQYKILDELGQPHDVAARLDAILSKIASLSESLSQNRNKATTDELLAQGEQ
CSSVLFAAVLREKGERASAFDVRQVMRTDSHFGRAEPQIEAVKQLCTEHLLPLLSEQRIV
TQGFIGADEQGATTTLGRGGSDYSAALLAEALDASAVEIWTDVPGIFTTDPRLAPNARPI
PEISFNEAAEMATFGAKVLHPATILPAVRHKIQVFVGSSKAPELGGTWIRHQVNDEPIYR
AVAVRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
AGNSLLSEALLQELSQHCRVRVEDGLALVAIVGNKIATTSGVCRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVSALHQNLFEGSL
>Sone_Ab_|_CG-21
MSLVVAKFGGTSVADYGAMNRCAEIVLGNPDCRLVVVSASSGVTNLLVELTQESINDDGR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALVSARSKATMDELLSLGEQ
CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIALLSREHLLPLLSEQVIV
TQGFIGADEAGQTTTLGRGGSDYSAALLAEALTASAVEIWTDVAGIYTTDPRLAPNAHPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFEGA
>Sput_Ab_|_CG-21
MSLVVAKFGGTSVADYGAMNRCADIVLANPDCRLVVVSASSGVTNLLVELTQEAITDDAR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMALLSEALVSVRSKATIDELLSLGEQ
CSSALFSAVLREKGASSSAFDVRKVLRTDSHFGRAEPQVEQIALLSYEHLLPLLSEQVIV
TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAHPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFETA
>SHEW-3b_|_CG-21
MSLVVAKFGGTSVADYGAMNRCADIVLGNPDCRLVVVSASSGVTNLLVELTQESMNDDGR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALASQRSKATMDELLSLGEQ
CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIAILSREHLLPLLSEQVIV
TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALKASAVEIWTDVAGIYTTDPRLAPNAHPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFEGA
>ENTE-2a_|_CG-21
MTSFVVAKFGGTSVADYAAMNRSADVVLADPDTRLVVLSASAGVTNLLVALSEGLEATER
FVKLDALRKIQFDILERMQNPHVIREEIERLLENITTLAEAASLATSTALTDELVSHGEL
MSTLLFVEILRERDVMAQWFDVRKVMRTSDRFGRAEPDVATLSELSKQQLAPRLAEGIVI
TQGFIGSEAKGRTTTLGRGGSDYTAALLGEALYATRVDIWTDVPGIYTTDPRVVPAAKRI
DVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPKAGGTLVCKNTVNPPLFR
ALAMRRKQTLVTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSIALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEDLALVAIIGNKLSRACGVGKEVFGVLDPFNIRMICY
GASSYNLCFLVPGHEAEQVVQKLHHNLFE
>Patr_Aa_|_CG-21
MSATEVSANANATVIAKFGGTSVADFDAMNRSADVVLSNPNVRVVVLSASAGITNLLVAL
AEGQTQETRAEHLAKIRQIQYAIIDRLTNQSVIRDEIDRMLDSVTTLSEAAALATSNALT
DELVSHGELMSTLLFVEILRQRDVIAEWFDVRKIMRTDDHFGRAQPDCDVLGELTRSLLQ
PRLEQGLVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALNVNRIDIWTDVPGIYTTDP
RVVPTAKRIDQIMFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPAAGGTLVCN
KTENPPLFRALALRRKQTLLTLHSLNMLHTRGFLAEVFSILARHNISVDLITTSEVNVAL
TLDTTGSTSTGGSLLSSALLTELSSLCRVEVEENLSLVALIGNKLSQACGVGKEVFGVLE
PFRIRLICYGASSNNLCFLVPGDDAERVVQTLHRSLFE
>Ecol_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Plum_Aa_|_CG-21
MSAVSSQCPEIGGHVVAKFGGTSVANFDAMNNSADIVLANKAVRVVVLSASAGITNLLVA
LAAGCDADKRADYLKQIHSIQYAIIDRLHESDTIRQEIDRLLENIKTLAKAASLATSAAL
TDELVSHGELMSTRLFTELLRQRGKDAEWFDIRKVMYTDESFGRAEPNYEQLQSLATEHL
LPQLKNSLIVTQGFIGREENGRTTTLGRGGSDYTAALLGEALGLKRVDIWTDVPGIYTTD
PRVVPAAQRIDKIAFDEAAEMATFGAKILHPATLFPAIRCGIPVFVGSSKNPQAGGTLVC
DTTEAPPQFRAIALRQKQTLLTLHSLKMLHAQGFLAEIFTILSRHNISVDLITTSEVNVA
LTLDTTGSTSTNGSLLTNALMTELSTLCRVEVEEDLALVAIIGNQLSQTNGLGKKVFSVL
EKFNLRMISHGASNHNLCLLVQGKDAEQIVQTLHQRLFE
>Sent_Na_|_CG-21
MTEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGMEPGER
FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGDDAEKVVQKLHQNLFE
>Styp_Aa_|_CG-21
MTEIVVSKFGGTSVADFDAMNRSADIVLSDTNVRLVVLSASAGITNLLVALAEGMEPGER
FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGDDAEKVVQKLHQNLFE
>Sboy_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNDGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Sdys_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPSER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLTEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPTVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TDDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHFNLFE
>Sfle_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Sson_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Sglo_Aa_|_CG-21
MSNNSAVPLRVAKFGGTSVADFDAMDRSADIVLANPSVRLVVLSASAGVTNVLVTLSEGN
EAERRAYYLDEIRRIQYSIIDRLAEQTVIREEIDRMIDNIAMLAEAAGLATSLALTDELV
SHGELMSTLLFVEVLRQRGVPAAWFDVRKVMRTNDQFGRAEPDSHALKAQARTLLLPRLE
TELVITQGFIGSEAKERTTTLGRGGSDYTAALLGEALEAGRIDIWTDVPGIYTTDPRVVP
TAKRIDEISFEEAAEMATFGAKILHPATLLPAVRSAIPVFVGSSKDPGAGGTLVYNHTDN
PPLFSALALRRRQTLLTLHSLNMLHARGFLAEVFNILARHAISVDPITTSEVSVALTMDT
TGSTTTCASLLTQALLTELSSLCRVEVEEDLALVALIGNKLSQACGVGKEVFGVLDPFNI
RLICYGASSHNLCLLVPGHDAEQVVRTLHSALFD
>Ypes_Aa_|_CG-21
MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
VALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPMFVGSSKDPAAGGTL
VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
>Ypse_Aa_|_CG-21
MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
VALADGSEPEKRADHLEEIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPVFVGSSKDPAAGGTL
VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
>Hduc_Aa_|_CG-21
MSHFSVAKFGGTSVADFNAMNACANIVVKDNHTRVVVLSASAGITNYLVELANGCAPLRR
VEILQNVRSVQYNIIQQLQQPEAISAEIDRLLQHISVLAESASVTTSATLTDELIAHGEL
MSSKIFTQLLIEREIPAIWVDVRDVIATNSHHGKATPDDKKTQQQADAIVKPLLEANKII
ITQGFIARDQQGNTTTLGRGGSDYSAALLAEVLSAKDVLIWTDVPGIYTTDPRIVPNAQR
IATIAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPTCRPIF
RAIALRRNQTLVTLSSLAMLHAQEFLASVFSILAKYQVSVDIITTSEVSITLTLDKTDST
ASTAQILSDALVHELSQFCHIKIENDLSLLAIIGNDLHLQQGIAKELFQTIEPFNIRLIN
YGASTNNIYMLVKNSDADHILLALHYDLFES
>Msuc_Aa_|_CG-21
MANLSVAKFGGTSVANYAAMTACAKIVIADPNTRVVVLSASAGVTNLLVALANGCEATQR
AKLLAEVRQIQENILNELKDAGTVRLEIEELLTNIEYLAEAASLATSSALTDELISHGEM
MSTKIFVQVLRELNAQATWVDVRTVVATNSNFGKAAPDDEQTQKNSDNVLKPLIDRGELV
ITQGFIGRDPNGKTTTLGRGGSDYSAALIAEVLNAKDVLIWTDVAGIYSTDPRIVPNAQR
IDTMSFAEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
RAIALRRDQTLLTLSSLNMLHAQGFLANVFNILAKHKISVDTITTSEVSVALTLDKTGSA
SSGAELLSSDLLNELSEVCTVKVDTGLALVALIGNDLHLSAGIAKRIFGTIEEYNIRMIS
YGASTNNICTLVHSAHADDVVRALHKELFE
>Pmul_Aa_|_CG-21
MSHLSIAKFGGTSVANYAAMSASAKIVVNDPNTRVVVLSASAGVTNLLVALANGCDNEER
TKLINEVRQIQENILSELKDDSLVRNKVEKLLANIESLAEAASLATSPALTDELISHGEM
MSSLIFVEILREFNTPSTWIDVRNIIATDSHFGKAVPNDHKTQENSTHILKPLIDRGELI
ITQGFIGRDEQGKTTTLGRGGSDYSAALLAEVLNAEDVLIWTDVAGIYTTDPRIVPNAKR
IDTMSFSEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEAGGTWVTRDPQHRPIF
RAIALRRDQTLLTLSSLNMLHAQGFLANVFTILAKHKISVDVVTTSEVSIALTLDKTGSA
SSGLSLLSSALIDELSQLCSVKVDSDLALVALIGNDLHITSGIAKRIFDTLAPYNIRSIS
YGASTNNVCLLVTNAHADAVVSALHKNLFE
>Aple_Aa_|_CG-21
MSHLSVAKFGGTSVANFDAMTSCANIVTSDANTRVVVLSASAGVTNYLVELANGCEKERR
EEILDAVRTIQYNIIEKLQNQSEVSAEIDELLQHIAALAESASLATSNALTDELICHGEM
MSTKIFTQLLKERNFPAVWVDVRDIVATNSNYGKAAPNDEKTQQQSDAIIKPLIAAGNVV
ITQGFIGRDDEGKTTTLGRGGSDYSAALLAEVLNANDVLIWTDVPGIYTTDPRVVPNAQR
IDTMAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
RAIALRRNQTLLTLSSLSMLHAQGFLANVFAILAKHKISVDVITTSEVSVALTLDKTGSA
SSGADMLSKELLDELNAYCHVQVEHDLALIAIIGNNLHTQAGVAKQLFHTIENFNIRLIS
YGASTNNVCTLIKNDEADEVVRALHAGLFE
>Ftul_Aa_|_CG-21
MSEIIVAKFGGTSVANQQAIRQCANIVNSDNRIKLVVVSAQSGITNLLIQLANNKDNSKI
QEIIGQIESIVNPISQSINSESVTTSVSNMIAELRMFANMAAYFSGKQLSDSILAFGEII
SSFLVANIFNQKGINAYHLDSRKILKTNSHFGCASPDLSALATNAIEHILPKIREGYVCV
LGGFIGSDAHGNTTTLGRGCGDYSAALYTQAIKASQLKIYTDVTGIYQIDPRVIPRAISL
SKLGFSEAAELATFGAKVVHPKTFGPAISSNFDIYIGSTFQPELGGTLITQKIDYDRNII
AVAERKAQTLLTIKSFNMFGSQGFLVKVFSILANHNIAVDLVSTSEVSVAITLDKLGSHS
MGDDLVTPELLKDLESIGNVNIKVENDLSLVSVVGSNLHQINGVSGELFNSLKDYNIRLF
SHGASENSICMLVASKDAQKVVNNIYGSFFS
>Ppro_Bc_|_CG-21
MSLVDSYVNPYTSLTVAKFGGTSVADFTAMSRSAAIILHAPQTRLVLISACSGVTNILVE
LANGVTDTQQRHALLTRLTDIHQSVLSQLKQPQQADEAITLLLKNVAELAKKAAIEKSVA
LTDQLVSHGELLSTHLFAQILRELGIKAIRFDIRDVMRTDGQFGKAIPQPSIIRQLSEQH
LLPQLKKHVVVSQGFIGSDEQGNTTTLGRGGSDYSAALMAEAIGASTLEIWTDVPGMYTT
DPRIATKAKPIKEISFSEASEMANFGAKILHPSTLVPAIRQQIPVFIGSSKAPEQGGTWI
RETVSDAPLFRALALRCNQTMVTLTSLNMFHAYGFLAEVFRILAEHKISVDLITTSEVSV
SLTLDQTDTSGGAPTLPAQALAELSELCRVEVEQDLCLVALIGNQMSSTKGSAKTVFSTL
EYYNLRMICYGASPHNLCFLVKAQDAKSAIKDLHCAIFE
>Vcho_Fb_|_CG-21
MLYKKHSLHNIGRWVTNNSFFRKSGRIAVSTFNVAKFGGTSVANFEAMSRCSAIIENNPQ
TRLVVSSACSGVTNLLVELANGVASTERRQAILQQLADIHYVIIDQLADPTRVEKEVKAV
LDSVASAAEAASFQSSKKLTDHLVACGELISTYILTQLMRERGVDAVRFDIREVLRTDDH
YGRAEPQLKEIAQLAKEKLVPLCEQYVVVTQGFIGSDAQGNTTTLGRGGSDYSAALIAEA
VQASGLEIWTDVPGIYSTDPRIAPKAAPIPEISFSEASEMANFGAKILHPSTLLPAVRHG
IPVFVGSSKEPEKGGTWIRKQVESAPLYRALALRCNQTMVTLRSAQMFHAYGFLAKVFEI
LAKHKISVDLITTSEISVSLTLDKTDTSGGAPELPEAVRAELEELCTVEVEYNLCLIALI
GNKMKESRGYAKQVFSVLEDYNLRMICYGASAHNLCFLLHESVSKQAVQKLHKELFEQE
>Vfis_Ab_|_CG-21
MNPINVAKFGGTSVANFEAMTKSASVIEQNPNTHLVVISACSGVTNLLVELANGVQDNHR
KKAILEGLKTIHFSVLDQLADPLIPEQAILDILDDIEKTAETAASQSNDKLTDHLVSCGE
LMSTHLFTQLLIERGNPAVRFDIRTVLRTDSRFGKGEPQLNDISRLAQKKLTPLCQQQIV
VTQGFIGSDSEGNTTTLGRGGSDYSAALIAESVDACGLEIWTDVPGIYTTDPRIAPKASP
IPEISFSEASEMANYGAKILHPSTLLPALRHQIPVFVGSSKEPEKGGTWIKEKVDSTPLF
RALTLRCNQTMVTLHSPSMFHAYGFLAEVFKILAKYQISVDLITTSEVSVALTLDQTNTN
GKAPELPLEAQQELEELCTVEVEHNLCLIALIGNKMSHSKGSAKQVFGTLEEFNLRMICY
GASQHNLCFLLHESESKQAVKILHKELFEQ
>Vpar_Ab_|_CG-21
MSAFNVAKFGGTSVANFEAMSRCATIIENNPNTRLVVSSACSGVTNILVELANGVQDQEH
RAELLKNLAEIHDSILAQLEDATEASSEVYGILDTVTSLAEAASIQANTKLTDHLVACGE
LMSTHILAQLMRERGINAVRFDIREVLRTDDNFGRAEPNVEAIAQLAQEKLIPLCLDSVV
ITQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAPKASP
IPEISFSEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHQVESSPLF
RALALRCNQTMVTLRSANMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDQTDTS
GGAPQLPQAAREELEELCKVEVEHDLCLVALIGNKMSERKGYAKQVFGTLEDLNLRMICY
GASPHNLCFLVNESVAKQAIQKLHTELFEQ
>Vvul_Ac_|_CG-21
MSALNVAKFGGTSVANFEAMSRCSAIIENNPETRLVVSSACSGVTNLLVELANGVQSQER
RAELLAQLAEIHDAILNQLEDATEAAAEVYAILDTITSLAEAASIQASNKLTDHLVACGE
LMSTHILAQLMRERGVNAVRFDIREVLRTDDNFGRAEPDVAKIAELAQEKLLPLCRDYVV
VTQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAAKAAP
IPEISFAEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHEAQSSPLF
RALALRCNQTMVTLRSAKMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDKTDTS
GGAPELPQAAREELEELCTVEVEHNLCLVALIGNHMETKGYAKEVFSTLGDFNLRMICYG
ASDHNLCFLVDAHDSKSVIQKLHQDLFER
>Cmur_Aa_|_CG-22
MFKEKKAPLVCKFGGTSVGTSSSIQRVCEIIRKEKPSFVVVSAVAGVTDLLEEFCRAPVG
QKSQFTAMIREKHESIAKELGIDVAIEPFLGPLKQFEGAGHLQQEDQAKILAIGEDLSAS
LICSYCRANSLQLEQLEARQVILTDSQFLRAEPDLALMQTMWGELVLKENTIYLMQGFLG
ATASGATTVLGRGGSDFSASLVGELCEARELRIYTDVRGVHTADPKILKDTQLIDFLTFE
EMQELASSGSKVLHQDMLKPCIRAKVPIFVTSTFDLTKEGTWICASLNEGVEGPEIKALS
LKANQALWFVEYHSPLMRLENVLRCVRGLGSIPGVVMAQNSGVYFTVDWEENNQSMTEAL
REFGAVSCEGPVSLVALVGAKLTSWSMTGVFDALQGTPVLYWSQTDTVINLIINEESGVV
VTKLLHDYVLGLNRSGL
>Ctra_Aa_|_CG-22
MLRQETAPLVCKFGGTSVGTAQSIRRVCEIIQEERPSFVVVSAVAGVTDWLEEFCRLPKG
KRAALTEKIRERHESIAKELGIEVSLAIFWEILEHFEDVEELFSEDQARILAIGEDLSST
LICSYCCTYVLPLKRLEARQVILTDSQFLRAVPDLALMQTAWGELALQEDTIYLMQGFLG
ATSSGKTTVLGRGGSDFSASLIGELCKARELRIYTDVCGVHTADPKILKDTQLIDSLTFE
EMQELASSGAKVLHQDMLKPCVRAKVPIFVTSTFNVTKEGTWICASLNESTEGPVIKALS
LKSNQALWFVEYNSPLVRLEDVLGCVRSLGFVPGVVMAQSLGVYFTIDWEEYPQTITKAL
EAFGTVSCEGPLSLVALVGAKLASWSMSRVFEALHRTPVLCWSQTDTVINLIINKDFGVA
VTELLHDCLFK
>Cabo_Aa_|_CG-22
MPPVVYKFGGTSLGTAESIRKVYDIVHKDTPWFIVVSAVAGITDLLDMFCSVSSEYREHI
ILDIANKHNEIIHDLQLTFSIAPWMEKLQRCMHKEKISLRDRAEILAIGEDISASLFHAF
CCSHDFSLEFLEARTVILTDGEYSCATPDIPRMRENWHALNFRSDVCYITQGFIGANAAG
ETTLLGRGGSDYSGALIAEMSHAKEVRIYTDVNGIYTMDPRIIEDAQLIPELSFEEMQNL
ATFGAKILYPPMLSPCVRSGIPIFVTSTFDLSKGGTWIYAMDKIMSHEPRVKALSLRQHQ
RLWSIDCSGSSTVGFDKILSILDTHHVLPGLITSQDSTVSFTTDDDDVSDDVIRELYDQL
SSIGTVHMLYDLALITMIGSGLASTKVVTTVTEKLRHYPSPIFCCCQSCMALSLVVPENL
AGNVVEQLHNDYVKQKFSVV
>Ccav_Aa_|_CG-22
MSPVVYKFGGTSLGTAESIRKVYAIVCKNTPRFIVVSAVAGITDLLDMFCCVSSEYREQI
VLDIAKKHDEIIHELQLAFSLSPWIEKLNKWVDKKEISLGDRAEILALGEDISASLFQAF
CHSNNFPIEFLEARTVILTDDEYHRATPDISRMRENWHTLNLKGDACYITQGFIGASTSG
KTTVLGRGGSDYSGALIAEMSCAEEVRIYTDVNGIYTMDPRIIEDAQLIPELSFEEMQNL
ATFGAKILYPPMLSPCVRAGIPIFVTSTFDVSKGGTWIYAMDKTVSYEPRVKALSLRQHQ
RLWSVDCGILGAVSLDKILPILDTYRILPGLITSQDAKVSFTTDDDDISEEIIQDLYSQL
SNIGTVHMLYDLALITMIGSGLASTKVVTTVTDKLRNYPAPVFCCCQSCMALSLVVPENL
AGSIVEQLHNDYVKQKFSVV
>Cfel_Aa_|_CG-22
MLPVVYKFGGTSLGTAESIKKVYDIVCKNTPRFIVVSAVAGITDLLDLFCAVSRESREQI
IFDIAKKHNEIIRDLQLIFSISPSMERLYNCVDKEEISPSDRAEILALGEDISASLFQAF
CRSNNFSLEFLEARTVILTDDEYDRATPDVFRMHSNWQTLNLQRDVCYITQGFIGANSSG
KTTLLGRGGSDFSGALIAEMSNAREVRIYTDVNGIYTMDPRIIKDAQLIPELSFEEMQNL
ATFGAKILHPPMLSPCVRAGIPIFVTSTFDVSKGGTWIYAMDKIVGYEPRVKALSLRLHQ
RLWSVDCGNLGAASLDKVLSILESYRVFPGLITSQDSAVSFTTDDDDVSDNVIRDLYGQL
SSIGSVHMLYDLALITMIGSGLASTKVVTTVTEKLRNYLSPVFCCCQSCMALNLVVPENL
AGSIVEQLHNDYVKQKFSVV
>Cpne_Aa_|_CG-22
MSKIVYKFGGTSLATAENICLVCDIICKDKPSFVVVSAIAGVTDLLVDFCSSSLREREEV
LRKIEGKHEEIVKNLAIPFPVSTWTSRLLPYLQHLEISDLDFARILSLGEDISASLVRAV
CSTRGWDLGFLEARSVILTDDSYRRASPNLDLMKAHWHQLELNQPSYIIQGFIGSNGLGE
TVLLGRGGSDYSATLIAELARATEVRIYTDVNGIYTMDPKVISDAQRIPELSFEEMQNLA
SFGAKVLYPPMLFPCMRAGIPIFVTSTFDPEKGGTWVYAVDKSVSYEPRIKALSLSQYQS
FCSVDYTVLGCGGLEEILGILESHGIDPELMIAQNNVVGFVMDDDIISQEAQEHLVDVLS
LSSVTRLHHSVALITMIGDNLSSPKVVSTITEKLRGFQGPVFCFCQSSMALSFVVASELA
EGIIEELHNDYVKQKAIVAT
>Hmar_Aa_|_CG-23
MRVVAKFGGTSLGSGDRINRAADSIAAAVQQGHEVAVVASAMGNTTDELLEEINYDADSA
DRAEIVSMGERTSVRMLKGALAARGIEAVFLEPGSEDWPIITDEYGEVDVEETQKRAHAL
AGQLKDVVPVITGFLAQDYQGNVTTLVRGGSDTSAVMMGDYMDADEVVIVTDVEGVMTGD
PRVVEGARNVGKISVDELRSLSFRGAEVVAPSALSYKSEDLGVRVVHYQHGDLLSGGTSI
EGEFQNLIDLQEQPIACVTVAGRAIRNSPGILADLSGAIADEDINIEANSSGMDSLTFYV
DEDDAEEAEALLHARIVDDETLSSVTVEDEIAVIRVTGGDPSQSALAHQVVAPLADAHIH
LYDVITSATSVSVFVPWEDREQALSLVQDVF
>HALO-10a_|_CG-23
VRVVTKFGGTSLGSGDRVERAADSIADAVAAGHEIAVVASAMGNTTDELLDDITFDADEP
DRAEIVSMGERTSVRMLKAALAARGVDATFLEPGTTDWPIVTNERGEVDADATAAGVDRL
AGRLGDTVPVITGFLAEDPQGNVTTLGRGGSDTTAVMLGRYLDADEVVIVTDVEGIMTGD
PQVVEGARNVGRITVDELRNLSFRGAEVIAPSALSFKDDALDVRVIHYQHGDLLSGGTRI
EGTFESMIDMRDSPLACLTVAGRAIRNRPGITSALSTALSDSDINVDAVASGMDSMTFYV
DESVAERAENILHQEVIAVSELSSVTVTDDIAAIRVLGGELPNRPGVLCRIIDPLADRNI
NVIDIISSATSVAVFVSWADREPALDVVQNGFGS
>Hwal_Aa_|_CG-23
MRIVTKFGGTSLGNGDRITRAADSIAAAIDAGHEIAVVASAMGSTTDYLLDEIHYDAADK
DRAEIVSMGERTSVRMLKGALSARGVTAQFLEPGSDDWPIITNERGEVDVGETQRRAADL
ASNLDDVVPVLTGFLAESHDGTTTTLGRGGSDTTAVMLGHYTDADEVVIVTDVEGVMTGD
PRVVEGARNVGQITVDELRNLSFRGAEVVAPSALTYKNDDLGVRVVHYQHGDLLTGGTLI
EGEFENLIDMQEDMLACVTVAGRSIRNSTGILADLSQSLRDDGINIDAVASGMDSITFYI
SEDIASKAENLLHAKVINNQTLSSVTVDDGIAVIRVTGGELPNRPGVILDIVRPIAEAGI
NIRDVITSATSVAVFVAWDDREETLSIVQSKF
>Npha_Aa_|_CG-23
MRVVAKFGGTSLGNGDRVNRAADSIAAAVEEGHEVAVVASAMGSTTDFLLDAIEFEADEA
DEAEIVSMGERTSVRMLKAALGARDINAKFLEPGTEEWPVITDEHGEVDVEATQRRAKQL
AADMAAEGYVPVITGFLAQDHAGNVTTLGRGGSDTTAVMLGNYMNADEVVIITDVEGVMT
GDPRVVEGARNVGEITVDELRNLSFRGAEVVAPSALSYKTADMIVRVAHYQHGDLLDGGT
TIEGQFQNLIDMREEPLACLTAAGRAIRNTPGILSDLSTELSEADINVDAVASGMDSVTF
YVDAEVAEEAETVLHQAVIDLDELSSVTVDDDIAVIRITGGELPNNSGILEDIINPLADA
HINVLDLVTSATSVAVFLEWDDREDALEIIQDAV
>Msmi_Aa_|_CG-23
MDLIVAKFGGTSVGDGSRIRKAAQSVVNEYMKGNQLVVVVSAVNNATDELIELSNEAIGG
GLTDKQKAEIMAMGELTSSRLFAAAIESLGVKAEFIDPYNDKWPVITDSNSLNAKIDFAT
TDKKCEGIKNLISQGIIPVICGFLGKGPSGEITTIGRGGSDVTAFLLGHCLSANNVVIVT
DVDGVMSTDPNKIEEAELLDEISVEEMRDLATHGAQVLHPHALKYKDPLISAKIINFNNG
DLSSEGTKITGPFEGDMLKTVSLYKNPISVIAIVGEEMLKKVGLLADLTSCLAENEINIF
GISAGQNSITVFVEKKDSDKAYHLLHSWVIDEDVLSSLSLGDDTAMITVVSPEFIDEPGI
ISNITNPLRKNDINIVEISSSQTAVVLFVDWKDGEKALELIKEVLK
>Msta_Aa_|_CG-23
MGIVVAKFGGTSVGSGERIYKAANSVVNEYMQGNQVVVVVSAINKTTDESIKLVNESIGE
LVTEKQLAGILSMGEMQSVRIMAATIESLGVKAEFIDPFSEKWPVITDSNYLNAKIDKKE
TQKRVTKYIKKLLNQGIIPVVCGFLGCDVDGSVTTLGRGGSDVSAFLIGHCLGADEVVIV
TDVKGVMSTDPRKLNTARKLDKITVEEMIDLANYGAQVLHPNALRYKDPNIKAKIISFEY
GDLRVQGTDIIGPAHEEYDVITITKCDDKLSVLAVVGENLMNQQCIIAQITQKVCENKLN
IYGISTGESSITLFFKEDEAIKAHEKLHDLVIGGDTLSSISLGQKIAMISVVSHDFIDTP
GIIASITKPLHENEINIVELSSSQTAVVVFVDWNDGDKAYDLIKETLQ
>Mthe-5_Aa_|_CG-23
MELIVAKFGGTSIGNGRRIKKAARSVVKEYMKGRKVVVVVSAINKTTDELLQIVDEAMED
AVTEKQLAEIVSMGEMTSVRIFSSAIEALGVKSEYIDPFMDEWPIITDSNLLNAKVDFEA
TEEKSRELLKLLDQGIIPVVCGFLGRDPNGYITTLGRGGSDITAFLLGHCLKADEVIIVT
DVGGVMSTDPNKLQGAKKLDKISVEEMRDLATHGAQVLHPHALKYKDPDIKAKIIGFEHG
DLSAPGTEIIGPSKNKMVKTTTLNPDPISVVAVVGEKILNKPGILARLTSRLAENSINII
GISTGQNSVTIFVDKKDADEAHRLLHDVVIADDDLSSLSLGRDIAMITISSPDFIDTPGI
ISEITKPLRDNDLNIVEISSSQTSVVIFVDWNDGKKAYELVRGVLE
>Bant_Ab_|_CG-24
MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
EGTLIAAYDGATKGQDVEERPVTGIAHVSNVTQIKVLAKETAYDIQQHVFKEMANEGISV
DLINISPTGVAYTVNDNVSARAVEVLKQLGYEPIVTEHCAKVSIVGAGMAGIPGVTAKIV
TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
>Bcer_Ab_|_CG-24
MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
EGTLISASDGATKGRDVEERPVTGIAHVSNVTQIKVLAKETAYDLQQHVFKEMANEGISV
DLINISPTGVAYTVSDNVSNRAVELLQNLGYEPIVTEHCAKVSIVGAGMAGYPGVTAKIV
TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
>Bcla_Aa_|_CG-24
MKIIIQKFGGTSVKTDESRLQAVRHVQKAVNDGYKVVVVVSAMGRKGDPYATDTLLSLVS
KSRITKREQDLLVSCGETISAVVFSDLLNAHGVQATAMNGAKAGFRTNEEFGNAKIKEMK
CEHLLKKLETEDVVVVAGFQGQSKSGDVTTLGRGASDTSATALGAALHAEWVDIFTDVEG
VMTADPRIVSDARALEAMSYNEICNMAYQGAKVIHPRAVEIAMQAKIPIRIRSTYSDNEG
TLVTALGASHSMDVNERMITGIAHVANVTQIKVAAKEGQLDLQENVFKSMAQAKISVDFI
NISPSGVTYTVSDEAADKAKQVLEHLGYTPELRRGCAKVSAVGAGMSGVPGVAAKIVSAL
SGENVQILQSADSHTTIWVLVKNEDMKKAVNALHKMFQLSEATTV
>Bhal-1_Ab_|_CG-24
MKIIIQKFGGTSVKTAEVREMAAKHVEKAVEGGYKVVVVVSAMGRSGDPYATDTLLQLVD
TKTIAKREQDLLVSCGEIISSVVFTELLLKKGIQATAMTGAQAGFRTNEEFTNAKIVDMK
VDRLKKTLVHQDVVVVAGFQGQSPTGETTTLGRGGSDTSATALGAALDAEWVDIFTDVEG
IMTADPRIVSEARPLDTMTYNEVCNMAYQGAKVIHPRAVEIAMQAKIPIHIRSTYSDGKG
TLVTSMLTEAGARDVQDRIITGIAHMSGVTQIKVHAKDGEFDLQEKVFRAMAAEKISVDF
ININLTGVVYTVMDEVADRAIEVLRELGFDPEVKRHCAKVSAVGAGMTGVPGVTAKIVAA
LSQENIRILQSADSHTTIWVLVSEDDLTKAVNALHRMFHLEQSEQTKQKQV
>Blic_Aa_|_CG-24
MKIIVQKFGGTSVKDDRGRKLALNHIKEAVNEGYKAVVVVSAMGRKGDPYATDSLLDLLY
GGQDTITEREQDMLLSCGETISSVVFASMLLENGIKAAALTGAQAGFLTDNNHTNAKILE
MKPERLVSMLADHDAVVVAGFQGATAKGDITTIGRGGSDTSAAALGAALDAEFIDIYTDV
EGVMTADPRIVEKAKPLPVITYTEICNLAYQGAKVIHPRAVEIAMQAKVPIRVRSTYSNE
TGTLVTSHHNSKAGSDVFERLITGIAHVKDVTQFKVPAKEGQYNVQTEVFKAMANAGISV
DFFNITPSEIVYTVAGNMTDRAHSILKELGYEPAVTRNCAKVSAVGAGIMGVPGVTSKIV
TALSEKGIPILQSADSHTTIWVLVHEKNMATAVNALHEVFELSK
>Bsub_Ab_|_CG-24
MKIIVQKFGGTSVKDDKGRKLALGHIKEAISEGYKVVVVVSAMGRKGDPYATDSLLGLLY
GDQSAISPREQDLLLSCGETISSVVFTSMLLDNGVKAAALTGAQAGFLTNDQHTNAKIIE
MKPERLFSVLANHDAVVVAGFQGATEKGDTTTIGRGGSDTSAAALGAAVDAEYIDIFTDV
EGVMTADPRVVENAKPLPVVTYTEICNLAYQGAKVISPRAVEIAMQAKVPIRVRSTYSND
KGTLVTSHHSSKVGSDVFERLITGIAHVKDVTQFKVPAKIGQYNVQTEVFKAMANAGISV
DFFNITPSEIVYTVAGNKTETAQRILMDMGYDPMVTRNCAKVSAVGAGIMGVPGVTSKIV
SALSEKEIPILQSADSHTTIWVLVHEADMVPAVNALHEEFELSK
>Bthu_Ab_|_CG-24
MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
EGTLIAAYDGATKGQDVEERPVTGIAHVSNVTQIKVLAKETAYDIQQHVFKEMANEGISV
DLINISPTGVAYTVNDNVSARAVEVLKQLGYEPIVTEHCAKVSIVGAGMAGIPGVTAKIV
TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
>Gkau_Aa_|_CG-24
MKLIVQKFGGTSVRDERGRNLARRHIERALEDGYKVVAVVSAMGRCGDPYATDTLLSLIG
GVHHHVTKREQDMLMACGEIISSVVFSNLLNEHGIKATAFTGAQAGFCTNSDHTNAKILE
MRCDRLLEALRQYDVVVVAGFQGMAENGDITTLGRGGSDTSAAALGAALNAEWVDIFTDV
DGVMTADPRIVESARPLDVVTYTEICNMAYQGAKVIHPRAVEIAMQAKVPLRIRSTYSDA
PGTLVTSSVRGRKGSDVKERLVTGITYVADVTQIKVLAKEGHYELQSDVFQAMAHEGISV
DFINISPYGVVYTVSGDMTEKAVAALRRIGYEPAVTPRCAKVSVVGAGIAGVPGVTAKIV
TALSEQGIQILQSADSHTTIWVLVKQDDMEKAVNALHDAFCLSEADAGEDEAIWSEE
>Gthe_Aa_|_CG-24
MKIIVQKFGGTSVRDERGRNLARRHIEKALEDGYKVVVVVSAMGRNGDPYATDTLLHLIG
GTGHHVTKREQDMLMACGEIISSVVFSNLLNEHGIKATAFTGAQAGFRTNGDHTNAKILE
MRCDRLLEALEQYDVIVVAGFQGVAENGDITTLGRGGSDTSAAALGAALNAEWVDIFTDV
DGVMTADPRIVESARPLEVVTYTEICNMAYQGAKVIHPRAVEIAMQAKVPLRVRSTYSDA
PGTLVTSSVRGQKGSDVKERLVTGIAYVANVTQIKVLAKEGHYELQSDVFQAMAREGISV
DFINISPYGVVYTVSGDMTEKAIAALRRVGYEPAVTPRCAKVSVVGAGIAGVPGVTAKIV
TALSEQGIQILQSADSHTTIWVLVKQDDMEKAVNALHDAFCLSEEGGYEAIWNEE
>Oihe_Aa_|_CG-24
MQVMVQKFGGTSVQSSENREHVIRHIREALVQEYKLVVVVSALGRKPDPYATDSLLGLVD
FPTNTNSSRELDLLMSCGEVISSVVLSNELQKNHISAVALTGAQAGFVTNEDFNRAKIKE
VNPTRILKELETHDVVVVAGFQGQSESGEITTIGRGGSDTSAAALGVALSAERIEIFTDV
EGIMTADPRVVKNARPLDVVTYTEICNLAYQGAKVIHPRAVEIAMQGKIPMRIRSTYSEQ
LGTLVTSSRVHELGMDIPDRMITGIAHISPVTQIKVQTKESAYRVQSEVFKAMAEAGISV
DFINISPTGVVYTVPDTLTTKAIEILEMLGFHPEVTKGCAKVSAVGAGMSGVPGVASKIV
QALTDSGVQILQSADSHTTIWVLVHNDDLITAVNALHDVFGLSITEELLES
>Linn_Aa_|_CG-24
MKIIVQKFGGTSVQNEKIRLMAFNHIKNALKDGYKVVVVVSAIGRYGDPYATDTLLELIG
AKDTKLTAREQDTLLSVGETISASVFTNMLREADIKAEAFSGGQAGIITSNNHLNAKITE
VDTKRLKKALETLDVAVVAGFQGITENGDITTLGRGGSDTSAAALGVSLQADYIDIFTDV
DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKVPMRIRSTYLES
TGTLVTSLADDSGHFDVKERMVTGVAHVTNLTQIFVKTDTVKAQQQTFKILADAGISLDF
INISTDSVIFTVPEEKRRVVKQLLEEANLQTTVREDCAKVSIVGAGITGVPGVTAKIVGA
LSEKNIPILQSADSHTTIWVLVREEDLISAVNALHDVFCLEIK
>Lmon_Aa_|_CG-24
MKIIVQKFGGTSVQNEKSRLMAFNHIKQVLKEGYKVVVVVSAIGRYGDPYATDTLLELIG
AKNTKLTAREQDTLLSVGETISASVFTNMLKEANIKAEAFSGGQAGIITSDDHLNAKITE
VDTARLKDALTNLDVAVVAGFQGITANGDISTLGRGGSDTSAAALGVSLQADYIDIFTDV
DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKIPMRIRSTYLES
TGTLVTSLTNDSDHFDVKERIVTGVAHVTNLTQISVQTDTVKAQQLAFKILADAGISLDF
INISTNSVIFTVPEEKSHVVKQLLEDADLQTTVRQACAKVSIVGAGITGVPGVTAKIVGA
LSEKNIPILQSADSHTTIWVLVKEEDLISAVNALHDVFCLEIK
>Lwel_Aa_|_CG-24
MKIIVQKFGGTSVQNEKIRLMAFNHIKHALKDGYKVVVVVSAIGRYGDPYATDTLLELIG
AKDTKLTPREQDTLLSVGETISASVFTNMLKEADIKAEAFSGGQAGIITSNHHLNAKITE
VDTSRLKTALKTLDVAVVAGFQGKAKNGDITTLGRGGSDTSAAALGVSLQADYIDIFTDV
DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKIPMRIRSTYLES
TGTLVTSVADELGHFDVKERMVTGVAHVTNLTQISVKTDTVKAQQQAFKILADAGISLDF
INILTDSVIFTVPEEKRLVVKLLLEEADLQTNVRENCAKVSIVGAGITGVPGVTAKIVGA
LSEKNIPILQSADSHTTIWVLVREEDLISAVNALHDVFCLEIK
>Lpla_Aa_|_CG-24
MEIIVQKFGGTSVKDEAARIQALKHVQYAVDQGDKVIVVVSAIGRKGAPYATDSLLGLVG
AEHSRLTNRELDMLVSVGETISTAVFTELARKQGLNVTAMTGHDAGIVTNDDFQNAKILR
VDPKPITDAFIDADVVVVTGFQGATESGHVTTIGRGGSDTSAAILGAALKAKRVDIFTDV
NGMMTADPRLVTHARFIKAISYEELANMAHEGAKVIHPRAVEIAEQAHVPMRIRSTYQEP
DELGTLVTDRTTTQIEHYRTVTGIAHQTDLTQFTVPTDTLSSSAIFQLMAQHGLSVDFIN
ITPHQVVFNLVDGDADVAKQLLTDAHVHCQSIANCAKVSVVGAGITGTPGVTARIVSALA
AQHIDILQSTDSYTTIWVLVKEADLKAAMNALHDEFLGIE
>Lsal_Aa_|_CG-24
MKIMVQKFGGTSVQDDESRKSAMRHIEHAVNEGYKVAIVVSAIGRKGAPYATDSLLSLVG
GERTKLTPRELDMIVSVGEVISTAVFTQMLKENGFNAVAMTGPDAGFRTNNDYQNAKVLE
VKTDAVLDAFASHDVVVVSGFQGMSEEGHVTTLGRGGSDTSAALLAVALDAERVDIFTDV
SGMMTADPRIVKNAHFLKTVSYDEVANMAHEGAKVIHPRAVEVAHQAHLPMRIRSTWDNV
DELGTLVTDKNLSIEHYRTVTGIAHQTGLTQINLSVNNTEAEKIFKVLAENEVSIDFINI
SPNQVVFNTSREDGLKAKKIFEEYNIPVNFVENCVKVSIIGGGMVGTPGVIAKMVTALSK
TGVEILQTADSDTTVWILVTEDNFKLAVNTLHEAFLEN
>Sthe-17_Aa_|_CG-24
MRIIVQKFGGTSVATPEGREAVVRRVRQALDDGYATVVVVSAMGRQGDPYATDTLIQLAQ
SAGPDLAPREMDLLLSCGEIISSVLMAATLTAAGIPAVALTGGQAGIQTDENYGNAQIVK
VDPAPVLSRLKEGLVVVVAGFQGVNAAGEVTTLGRGGSDTTAAALGGALRAEVVEIYTDV
DGVKTADPRLVAEARTLSVTTYDEIAQMAHYGAKVVHPRAVEIAMQHRVPIRVRSTFSDN
PGTLITYSAEAGVIWSEPFSDRVVTAVTHVVGLAQVVVKTGRDWATPRLFRRLANAGISV
DLISVSMESSAFSIPESRAAQAEMILTELGLVDLQVRHGCAKVTVVGSGMRGRPGVMATV
AEALYAAEVPIWQTADSHVTISCLIPAADVQRAVQALHDAFELGRI
>Cace_Aa_|_CG-24
MKIIVQKFGGTSVSTPERRSFVVQKVSSAIKEGYSPIVVVSAMGRAGEPYATDTLLSLID
NDFKETNKRASDLLMCCGEIISTVIMSNELKRAKIAAIPVTGGQAGIITDDEYSNASVKK
VNPENLLKLLCHNEVPVVAGFQGKSQNGFFTTLGRGGSDVTASLIGCAVNAEKIEIYTDV
DGIMTADPRIVQDAALIETISYNEVFEFAEQGAKVIHPRAVEVAMNGNIPLIIKNTLNDC
KGTLINREGDSLNKNLITGITSLSGRVQVTTKFKDSKIKSTEFLSLLGERNINIDLINVF
PKENIFTIDKKDLNKLKDTLIKTKVQYYLEDDCSKIAIIGNRICGVPGVMAKILKAITKE
GIEVLQTADSHTTIWCLVKSNVRNKAINALHREFNLNNK
>Cbot_Bb_|_CG-24
MKILIQKFGGTSVSTAERRSLVVDKIVKAKKAGYYPVVVVSAMGRKGQPYATDTLRSLVE
EDFLDKNTLAADLLMGCGELISTVVMSSELFNKGIDAVPLMGGQAGIITDNNFNNASVLR
VEKDRIVDLLKKDKIPVVAGFQGKSEDGYITTLGRGGSDVTAALLGTALEAESVEIYTDV
DGIMTADPRIVENASLIKEISYNEVFQFADQGAKVIHPRAVEIAMTSNIKLVIKNTMTDC
KGTTINNIGIKNSNNVITGITHMSNRTQIIVDAEENKGNKNYTNLLNSLAENSISIDLIN
VFPKEKIFTIDEKDFNEFSSIMEGLKIKFSYLKDCSKIAIIGSRMRGIPGVMAKILKALV
ERNIEVLQTADSHTTIWCLVSKEDTEKAIKSLHCEFKLDCI
>Cdif_Ab_|_CG-24
MSILVQKFGGTSVESYEKMNEVCKIVKAYKKNDEELQLVLVVSAMGRKGAPYATDTLINL
CSAVNDEPSKRELDLIMSCGEIISGTILANLLNAQGIDSVFFTGQQAGIITSDEYSNAKI
KYINPKKVKRALDDGKVVVIAGFQGVTDDGEITTLGRGGSDTSAVAIGKALECETVEIYT
DVDGIMTADPRVEPNAKVLSFIDYEEVFQMADKGAKVIHPRAVQLAKSGNITLAIKNTMN
PTFEGTKIGSLCRHLEDNIEYEQERDFKVAVANKDSVAQVKIKSAEEVFTEVLNEIEKKL
ITIDMINFFISEKAFVVEDADIKSLKEILDKFELDYEVNRDCAKVTLICSRIADEMSGIM
SKVVRGLSKAGVSLLQTSDSNMTISCLVSEEDMHTAVHAIHQQFYLK
>Cnov_Aa_|_CG-24
MKILVQKFGGTSVSTSEKRKLVVKKVSNAIKAGFKPVVVVSAMGRKGDPYATDSLLGLLT
DEFKENNSLATDLLMSCGEIISSVVMSNELNKNNINAIPLMGGQAGIHTDENFSDASVKS
VDNANIMKILEEGKIPVVCGFQGVSEKGFITTLGRGGSDVTASLLGVALNAEQVEIYTDV
DGIMTADPRIVKGASLIKEISYNEVFQFAEQGAKVIHPRAVEIAMKGSIPLVIKNTMSDC
TGTTIDNIGDLNASNIITGITHMANRVQIRIKLEDNSGNENYYDLLPILAENSISIDLIN
VFPNEKIFTIDKKDFFKFDGIMNSINVKYSHIDDCSKIAIIGSRMRGIPGVMAKILKSLV
KEKIEVLQTADSHTTIWCLVESKYTETAINLLHEEFNLERL
>Cper_Aa_|_CG-24
MKIVVQKFGGTSVSTKERRTMVVEKVKGAINKGYLPVVVVSAMGRKGEPYATDTLLGLVS
EEFKKENKLATDLLMGCGEIISTVVMSDELREAEIEAVPLTGGNAGILTDDNYSSADFID
INPKLILEVLKEGKVPVVAGFQGVDRNGFLTTLGRGGSDTTAAVLGVALKAEEIEIYTDV
DGIMTADPRIVGDAELINKISYNEVFQLADQGAKVIHPRAVEIAMKGNVTLVIKNTMSTC
IGTMIDSLGDVDNNKFITGITHQGNRIQVSIKSDDNKDNINYKTILESLANNKISLDLIN
IFPKEKVFTIDAGVKELFEDIMRKNNLKYSLVEDLSTIAIVGSRMRGIPGVMAKIVGALD
NENIEVLQTADSHMTIWCLVESKNVREAIKALHRVFMK
>Ctet_Aa_|_CG-24
MKIIVQKFGGTSVSTKERRQRVVEKIIKAKNAGYSPVVVVSAMGRKGEPYATDTLLSLVS
NELKKNNLAIDLLMSCGEIISTVVMADELLSKNIDAVPLTGGQAGILTDDNYSNASILKL
ECDKILDVVEENKIPIVAGFQGISENGFITTLGRGGSDVTAVLLGGALKAEKVEIYTDVD
GIMTADPRIVSDATLIKEISYNETFQFSHEGAKVIHPRAVEIAMNENIPIVIKNTLTNCD
GTLINNISDLNLNNIITGITHTNDRTQIKIELEQNKENESYFRILDILAENSISIDLINV
FPRESIFTIDGKDFEKFSSIMNKINLKYSHIDSCSKIAIIGNRMRGIPGVMAKIIYVLMN
ENIEVLQTADSHATIWCLVKDIHTEKAIKALHNAFNLSNNK
>Chyd_Ab_|_CG-24
MAKKFIILKFGGTSLKTAELREKVAQKIINTFESGYQPVVVVSAIGRKGDPYATDTLLNF
AYEVNRDLPPREADLLMACGEIISGVIMVNTLAKMGYKAKLFTGAQAGIITDDNFTSASI
LKVKADKILKAVDEGFIPVVCGFQGVTEDGEVTTLGRGGSDTTAAALGVALKAEFIDIYT
DVEGIKTADPRIVEDAKTLEVVTYNEISQLAHEGAKVIHPRAVEIAMQKNIPLRIKSTLT
DGEGTLVTSHAEVYGEVIEVIRDRIITGIAHIPGVTQIKILREDTPEIVNLAQKVFKGLA
LAEISVDFINISPEGLAFTVKGEVTEKAVDVLENMGFTPRIRRNCAKIAAVGAGMTGVPG
VMAKIVEALTREQIEILQSTDSYTTIWVLVDGENMEKAVRAIHKAFKLNE
>Dred_Aa_|_CG-24
MRFIIQKFGGTSLVTQELRELVANKIIAAVDEGFSPVVVVSAIGRAGEPYATDTLLNFAL
SINRDIPPREMDMLMSCGEIISGVAMANTLQRMGHQAVLLTGAQAGIITDDNFNDARIIR
VEPQNVIKHVEQGKIVIVTGFQGICQGGDITTLGRGGSDTTASALGVALNAEYIDIYTDV
EGIMTADPRIVEDARILDSVTYNEICQLAHEGAKVIHPRAVEIAMQKNIPLRVRSTFLDS
PGTLVTSHHGVYGTIDITRDRLACGVTHIAGVTQLKIIAKDIAVEDPALRIFRALALADI
SIDFINVSPELIMLTVKDEVAKKAVDVLENLSVFPQVKPNCAKVSTVGAGMTGVPGVMAS
IIQALTEEGVEILQSSDSHTTIWVLVEKENMKKAIRALHRKFKLGQRE
>Pthe_Ab_|_CG-24
MKFIVQKFGGTSLVNDETRRMAAKKVIEAKNKGYLPVVVVSAIGRMGDPYATDTLLKLAC
DGNWELSPRESDLLMSCGEVISGVVMAATIQKEGHPAVFLTGLQAGIITDNNHNDARILK
VNPENIIKHARDGKIIVVAGFQGATENGEITTLGRGGSDTTAAALGVALDAEWVDIYTDV
EGIMTADPRIVSDARLLEVVTYNEICQLAHEGAKVIHPRAVEIAMQKDIPLRIKSTFSSA
PGTLVTSRGEAYKGSIDITRDRTITGITYISDITQFRIPMDGCGDTAGLQRRMFEALALA
GISIDFINVHPDVVIFTVKNSVAAKAAQILENMGLRPSILPDCAKVAAVGAGMTGVPGVM
ARIVGALADEKVQILQSSDSYTTIWVLVKKKDMEKSIRALHRQFGPGEKDIERR
>Mthe-3_Ab_|_CG-24
MKVLVQKFGGTSVASPEQRLVVTGHIERACRVGYQVVVVVSAMGRRGAPYATDTLLELLG
DNEVEPRERDLLLACGEVISGVVLTGLLKSKDLPAVFLTGGQAGIITDAQFGDARILRVE
PRRIQSYLDQGRVVVVAGFQGVTESGEVTTLGRGGSDTTAVALGVALGAEAVEIFTDVDG
VKTADPHIVSDARTLSTITYNEVCQMAYEGAKVIHPRAVEIARQKNIPLRIKSTFNDGPG
TLVVAWQPGVTGVHISRDRVITGITHMDGLTQLRVSLPSGEGAGEVFPLLAQNNISVDFI
NIFPGELVFTVKSEVARQARELIEGLGLKVTARPGCAKVATVGAGMRGVPGVMATIVTAL
EREGIKILQSADSYTSIWCLVDRKDMERAVQTLHREFKLNDGKTGEVKVYAVG
>Tten_Aa_|_CG-24
MKILVQKFGGTSVSSEEKREKAVSKVIEAVKNGYNVVVVVSAMGRNGDPYATDTLINMAK
SIYSDIPKRELDLIMNCGEIISSVLFAATLSNKGYKAKALTGGQAGIITDDNFGNAEVIN
VDPSRILEVLREGIIPVVAGFQGITQKGELTTLGRGGSDTTAALLGVALKAEAVEIYTDV
DGIMTADPRIVSTAHIIDKISYNEVFQFAEQGAKVVHPRAVEIAMRGNIPLIIKNTMSDS
GGTIITNYSDAYDSIYEVDKLVTGIANMNNRVQITIESTENVQDIFEKIGEEKISIDLIS
IFPDKQVFTISEADFEKLRRLFEKYGVKYSYRTNCAKVSIIGNRIRGVPGVMARVIKALS
KRNIEIYQTADSHNTISCLVSQDKVEEAIRVLHDEFSL
>Acel_Aa_|_CG-25
MPLIVQKYGGSSVADAERIKKVAQRIVATRKQGYDVCVVVSAMGDTTDELLDLAAQVSPM
PPPRELDMLLTAGERISMALLAMAIANLGMEARSFTGSQAGVITDSRHGRAQIIDVTPGR
IREALAAGHIAIVAGFQGVAQDTKDVTTLGRGGSDTTAVALAVALGAEVCEIYTDVDGVF
TADPRIVPTARQIPRISYEEMLEMAAAGAKILHLRCVEYARRFKMPIHVRSSFSTKPGTW
IVDIPPEEQMEAPIISGVAHERGEAKITVVGVPDKPGEAAQIFQVIADAGINVDMIVQNV
SSTATGRTDITFTLPTSDLPTAMAALSKAKDRIGFEGLLSDDQIGKVSLIGAGMRTQPGV
TAKFLTALADAGINVEMISTSQIRISVVIREDDLPAAVAALHRAFELDDPEGQAVVYGGT
GR
>Cglu_Aa_|_CG-25
MALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGDTTDELLELAAAVNPV
PPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLTTERHGNARIVDVTPGR
VREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVY
TADPRIVPNAQKLEKLSFEEMLELAAVGSKILVLRSVEYARAFNVPLRVRSSYSNDPGTL
IAGSMEDIPVEEAVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNV
SSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLYDDQVGKVSLVGAGMKSHPGV
TAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEAVVYAGTG
>Cdip_Aa_|_CG-25
MALVVQKYGGSSLESAERIRRVAERIVATKKQGHDVVVVCSAMGDTTDELLDLAAQVNPV
PPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVITTERHGNARIVDVTPGR
VREALDEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVY
TADPRIVPNAQKLEKLCFEEMLELAASGSKILVLRSVEYARAFGVPLRVRSSYSNDPGTL
VAGSMEDIPVEEAVLTGVATDNSEAKITVLGIPDSPGSASAVFRALADAEINIDTVLQNI
SSLEDNRTDITFTCPRADGPHAMELLRNLQAKNDWQNVLYDDQIGKVSLVGAGMKSHPGV
TAEFCEALRDAGVNIELISTSEIRISVLIRESDVDVAARAIHEKFELGGETEAIVYAGTG
>Ceff_Aa_|_CG-25
MNERCARVALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGDTTDELLDL
AAAVNPVPPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLTTERHGNARI
VDVTPGRVREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAAALGADVCEIY
SDVDGVYTADPRIVPNAQKLERLSFEEMLELAAVGSKILVLRSVEYARAFNVPMRVRSSY
SNDPGTLIAGSMEDIPMEEAVLTGVATDKSEAKVTVLGIPDKPGEAAKVFRALADAEINI
DMVLQNVSSVEDGTTDITFTCPRSDGPRAMELLKKMQQQGDWTNVLYDDQVGKVSLVGAG
MKSHPGVTAEFMEALRDVNVNVELISTSEIRISVLIREDDLDKSAKALHEKFQLGGDEEA
TVYAGTGR
>Cjei_Aa_|_CG-25
MALIVQKYGGSSLESAERIRRVAERIVETKKQGNDVVVVCSAMGDTTDDLLELAEQVNPV
PPAREMDMLLTAGERISNALVAMAIASFGAEAQSFTGSQAGVLTTERHGNARIVDVTPGR
VREALDEGKICLVAGFQGVNRETRDVTTLGRGGSDATAVALAAALEADVCEIYSDVDGVY
TADPRIVPDAQKLDTISFEEMLEMAAVGAKVLMLRSVEYARAFDVPLRVRSSYSTDIGTL
VSGSMEDIPMEEAVLTGVAHDRSEAKIAVLGIPDSPGEAAKVFRAVADAEINIDMVVQNI
SKIDNNRTDITFTCPRTDATRAMQLLKGIKEQNDWQDLIFDDHVGKVSLVGAGMKSHPGV
TADFCEALRDAGVNIELISTSEIRISVLIRDTDVDKAVRAIHERFQLGGDKEATVYAGTG
>Mavi_Ba_|_CG-25
MALVVQKYGGSSVANADRIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLMDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQAALDEGRIVLVAGFQGVSQDTRDVTTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
SADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRYNIPVHVRSSYSDKEGTV
VVGSIKDKPMEDPILTGVAHDRSEAKVTVVGIPDIPGYAARVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSREAGPTAVAKLDALKDEIGFTQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAQVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGAETATVYAGTG
>Mbov_Aa_|_CG-25
MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
>Mlep_Aa_|_CG-25
MALVVQKYGGSSVADADRIRRVAERIVQTKKQGNDIVVVVSAMGDTTDDLLDLAQQVCPE
PPARELDMLLTAGERISNALVAMAIESFGAQARSFTGSQAGVITTGTHGNAKIIDVTPTR
LQFALDEGRIVLVAGFQGVSQDTRDITTLGRGGSDTTAIAMAAALGADVCEIYTDVDGIF
SADPRVVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYADKPGTV
IVGSIKDVPMEDPILTGVAHDRSEAKVTIVGIPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDSGPIAVAKLGSLRDEIGFTQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVFALHEAFGLGGEDEVTVYAGTG
>Msme_Aa_|_CG-25
MALVVQKYGGSSVADAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDLLDLARQVSPA
PPPREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVITTGTHGNAKIIDVTPGR
LRDALDEGQIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVAVAAALDADVCEIYTDVDGIF
TADPRIVPNARHLDTVSFEEMLEMAACGAKVLMLRCVEYARRYNVPIHVRSSYSDKPGTI
VKGSIEDIPMEDAILTGVAHDRSEAKVTVVGLPDVPGYAAKVFRAVAEADVNIDMVLQNI
SKIEDGKTDITFTCARDNGPRAVEKLSALKSEIGFSQVLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAEAGINIDLISTSEIRISVLIKDTELDKAVSALHEAFGLGGDDEAVVYAGTG
>Mtub_Aa_|_CG-25
MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
>Nfar_Aa_|_CG-25
MALVVQKYGGSSVASAERIRRVAERIVETKKQGHDVVVVCSAMGDTTDELLDLAEQVAPA
PPAREMDMLLTAGERISNALVAMAIHSLGAQARSFTGSQAGVITTGAHGNAKIIDVTPSR
LREALDEGTIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALEADVCEIYTDVDGVF
TADPRIVSDAQRLEQVSYEEMLEMAACGSKVLMLRCVEYARRYNVPVHVRSSYTDKPGTY
VYGSMEDIPLEKAILTGVAHDRSEAKVTVVGLPDEPGYAAKVFRAVADAEINIDMVLQNI
SKVETGKTDITFTLPKTEGARAVEMLTKRQGEIGFSQVLYDDHIGKVSLVGAGMKSHPGV
TATFCEALADAGINIDLISTSEIRISVLVKDTELDDAVQVLHRAFDLGGDEVAVVHAGTG
>RHOD-5a_|_CG-25
MALVVQKYGGSSVATAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDELLDLAQQVCPA
PPAREMDMLLTSGERISNSLVAMAIHSLGAEARSFTGSQAGVITTGAHGNAKIIDVTPGR
VRDALDEGSIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALEADVCEIYTDVDGIF
TADPRIVPDAQRLETVSFEEMLELAACGAKVLMLRCVEYARRYNVPVHVRSSYTTKPGTI
VSGSMEDIPVEEAIITGVAHDRGESKITVVGLPDTPGYAAQVFRAVAEAEINIDMVLQNI
SKVETGKTDITFTLPTADGPRAVEKLTKLQGDIGFTQVLFDDHIGKVSLVGAGMKSHPGV
TATFCEALAKAGVNIDLISTSEIRISVLVKDVELDKAVKAIHDAFGLGGDEEAVVHAGTG
>FRAN-2b_|_CG-25
MALLVAKFGGSSVADADRIKRVAERIVENRRAGNDVVVVVSAMGDTTDELLDLAEQVSPL
PPARELDMLLTAGERISMALLAMAITTLGAEARSFTGSQAGVITDSVHGKARIIDVTPGR
IRAALDSGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALGADACEIYTDVDGVF
TADPRIVPDARRIDTISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFSAKPGTW
VTEIPEEQLVEQAIIRGVAHDLSEAKVTVVGCPDKPGVAAAVFRAVADTDVNLDMIVQVG
SVAGSGRTDISFTLPKADGRTALTALTKVQSEIGFERTLYDDHIGKLSLIGAGMKSHPGV
SARFFGSLADAGVNVEIISTSEIRISVVVRDTDLPLAVRAVHGAFDLGDPNGGAIVYAGT
GR
>Faln_Ab_|_CG-25
MALLVAKFGGSSVADADRIKRVAERVVEARRDGNDVVVVVSAMGDTTDELLDLAEQVSPL
PPARELDMLLTAGERISMALLAMAITTLGAEARSFTGSQAGVITDSVHGKARIIDVTPGR
IRAALDEGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALHADACEIYTDVDGVF
SADPRIVPDARRIDTISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFNAKPGTW
VTEIPEAQLVEQAIIRGVAHDVSEAKVTVVGCPDKPGVAAAVFRAVADADVNLDMIVQVG
SVAGSGRTDISFTLPKTDGRTALTALAKVQGEIGFERTLYDDHIGKLSLIGAGMKSHPGV
SARFFGALADAGVNVEIISTSEIRISVVVRDTDLPGAVRAVHGAFELGDPDGGAVVYAGT
GR
>Cmic_Aa_|_CG-25
MSLIVQKFGGSSVADAESIKRVAKRIVATRKAGNDVVVAVSAMGDSTDELLDLAHEVTPI
PAPRELDMLLTAGERISMALLAMAIKSMGYDARSFTGSQAGMITDAQHGAARIVDVTPGR
VRDALGEGAIAIVAGFQGFNRGTGDITTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
TADPRVVPLARKIDRITSEEMLELAASGAKVLYIRAVEYARRHGVLLHVRSSFTHNEGTI
VYNPTDGENVEEPVIVGVAADLSEAKVTVVGVPDVPGKAAQIFTIVAKTGANIDMIVQNV
SAAATSLTDISFTLPKSDAQRVLTVLAAEKDEVGFTGLQHDDQIGKLALVGAGMRTNAGV
SAQLFTALSDAGINIEMISTSEIRISVVTRADTIDEAVRVVHHAFGLDADDVAVVHAGTG
>ARTH-1a_|_CG-25
MSMPTTEVKTENQPYVLPVATARTKQLIVQKFGGSSVSDADGIKRVAKRVVDAQRAGNEV
VVVVSAMGDTTDELLDLAAQVTDSAPAREMDMLLSSGERISMALVAMAINKLGASAQSFT
GSQAGMITDGIHGKARIIDVDPHRIRTALDKGHIAIVAGFQGMSRTTNEITTLGRGGSDT
TAVALAAALDADVCEIYTDVDGIYTADPRVVPSAQKIDRISSEEMLELAASGAKILHLRC
VEYARRFGVPLHVRSSFSQNEGTWVMPGADDKITTQEGVALEQPIISGVAHDRSEAKVTV
VGVPDIPGKAAAIFQVIADAHSNIDMIVQNVSTHGTGRTDISFTLPIVEGADALAALRAA
QPEIGFENIEYNEQIGKLSLIGAGMRSHPGVSATFFKALSDAGININMISTSEIRISVVT
HADLLDDAVRAIHKAFDLDSEDEATVYGGTGR
>Lxyl_Aa_|_CG-25
MALIVQKFGGSSVSDAESIKRVAKRIVETRKAGNEVVVAVSAMGDTTDELVDLAHEVTPI
PAPRELDMLLTAGERISMALLAMAIKSMGSDARSFTGSQAGMITDAVHGSARIVDVTPGR
IQDALSEGAIAIVAGFQGFSRESRDITTLGRGGSDTTAVALAVALGAEVCEIYTDVDGVF
TSDPRQVPLARKIDRITSEEMLELAAAGAKVLHIRAVEYARRHDVTLHVRSSFSNREGTY
VLNEAAAAAAAKKDGIVEEPIIAGVATDLSEAKITVVGVPDVPGKAAQIFKIVAKANANV
DMIVQNVSAAATSLTDISFTLPKSEGQRVLTALTAEKYEVGFQSLQYDDQIGKLALVGAG
MRTNTGVSAKLFEALFDAGINIEMISTSEIRISVVTCADTVAEAARVVHSAFRLDGDQQA
IVYAGTGR
>Stro_Aa_|_CG-25
MALVVQKYGGSSVDNAERIKRVAERIVAARKAGDDVVVVVSAMGDTTDELTDLANQVSPL
PPGRELDMLLTAGERISMALLAMAIHNLGYEARSFTGSQAGVITTSVHGRARIIDVTPGR
LKGALDEGAVVIVAGFQGVSQDTKDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVF
SADPRIVPDARHIRQITYEEMLELAACGAKILHLRSVEYARRAGLPVHVRSSYSTNTGTM
VTGSMEDLPVEQALITGVAHDRSEAKITIVGVPDEPGAAAWIFDTVAGAEINIDMIVQNV
STEGTGRTDISFTLPKTDGPTAMAALSKIQDSVKFKGLLYDDHVGKVSLIGAGMRSHPGV
AAGFFAALGQAGVNIEMISTSEIRVSVVCRDTDLDDAVRAIHDAFELGGDTEAVVYAGTG
>Mgil_Aa_|_CG-25
MRAALILYGISPRIAKGSPVALVVQKYGGSSVSDADRIRRVAERIVETKKAGNDVVVVVS
AMGDTTDELLDLAKQVSPAPPVREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQAG
VVTTGTHGNAKIIDVTPTRLRSALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAV
AAALNADVCEIYTDVDGVFTADPRIVPNARKLETVSFEEMLEMAAAGAKVLMLRCVEYAR
RFNLPIHVRSSYTDRPGTLVTGSMEDIPMEDAILTGVAHDRGEAKVTVVGLPDVPGYAAQ
VFRACADADVNLDMVLQNISKVEDGKTDITFTCSRESGPGAVEKLTSLQNEIGFTRVLYD
DHIGKVSLIGAGMRSHPGVTATFCEALANAGINIDLISTSEIRISVLIKDTELDRAVAAL
HEAFGLGGDEEAVVYAGTGR
>MYCO-4a_|_CG-25
MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDLLDLAKQVCPA
PPARELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVVTTGTHGNAKIIDVTPTR
LRSALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAVAAALNADVCEIYTDVDGVY
TADPRIVPNARKLDTVSFEEMLEMAACGAKVLMLRCVEYARRYDLPIHVRSSYSDKPGTI
VKGSIEDIAMEDAILTGVAHDRSESKVTVVGLPDVPGYAAKVFRAVADADVNIDMVLQNI
SKIEDGKTDITFTCARDNAPGAVEKLTSLQDEIGFTRVLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAEVGVNIDLISTSEIRISVLVKDTELDKAVAALHEAFGLGGDEEAVVYAGTG
>Mulc_Aa_|_CG-25
MALVVQKYGGSSVGNAERIRRVAERIVETKKQGNDVVVVVSAMGDTTDDLMDLALQVCPV
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIEVTPGR
LQAALDEGRIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
SADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDKPGTL
VVGSIKDIAMEDPILTGVAHDRSEAKVTIVGIPDIPGYAAKVFRAVAEADVNIDMVLQNV
SKVEDGRTDITFTCSRDSGPTAVAKLDSLKDEVGFTQLLYDDHIGKLSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGEETATVYAGTG
>Mvan_Aa_|_CG-25
MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDELLDLAKQVSPA
PPARELDMLLTAGERISNALVAMAIESLGAEARSFTGSQAGVVTTGTHGNAKIIDVTPTR
LRAALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAVAAALKADVCEIYTDVDGIF
TADPRIVPNARRLDTVSFEEMLEMAAAGAKVLMLRCVEYARRFDLPIHVRSSYSDNPGTI
VKGSIEDIPMEDAILTGVAHDRGEAKVTVVGLPDVPGYAAQVFRAVADADVNIDMVLQNI
SKVEDGKTDITFTCSRESGPGAVEKLTALQDEIGFTRVLYDDHIGKVSLIGAGMRSHPGV
TATFCEALADAGINIDLISTSEIRISVLIKDTELDRAVEALHDAFGLGGDEEAVVYAGTG
>NOCA-3a_|_CG-25
MGIVVQKYGGSSVADAAGIKRVAQRIVNTRKAGHDVVVVVSAMGDETDNLRDLAEQVTPL
PPPRELDMLLTAGERISMALVAMAIAALGHEAKSFTGSQAGVITDSAHGKAKIIDITPGR
IEKALKDGAIAIVAGFQGVSQDTKDVTTLGRGASDTTAVALAAALGAEVCEIYSDVDGVF
TADPRIVPAARKLARVSTEEMLEMAASGAKILHLRCVEYARRYDMPIHVRSSFSQKEGTW
VIPDSKAGEDEMEQAIIAGVAHDRSEAKITVVGVPDKVGEAARIFEALAATEVNLDMVVQ
NVSAAATGLTDISFTLPRADGQSAMGALARIQDEVGYDKLLYDDQIGKVSLIGAGMRSHP
GITARFFASLAAAGVNIEMISTSEIRISVIVDEAQVDEAVRATHTAFDLDAEEVEAVVYG
GTGR
>Tfus_Aa_|_CG-25
MALIVQKYGGSSVADADAIKRVAERIVAQKKAGYDVVVVVSAMGDTTDELLDLAKQVSPL
PPGRELDMLLTAGERISMALVAMAIGNLGYEARSFTGSQAGVITTSLHGNAKIIDVTPGR
IRDALAEGAICIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALNADLCEIYTDVDGVF
TADPRIVPSARRIPQISYEEMLEMAASGAKILHLRCVEYARRYNIPLHVRSSFSQKPGTW
VVSEVEETEGMEQPIISGVAHDRSEAKITVVGVPDRVGEAAAIFKALADAEINVDMIVQN
VSAASTSRTDISFTLPADSGQNALAALKKIQDKVGFESLLYNDRIGKVSLIGAGMRSYPG
VTARFFDAVAREGINIEMISTSEIRISIVVAQDDVDAAVAAAHREFQLDADQVEAVVYGG
TGR
>Pacn_Aa_|_CG-25
MTRVVQKFGGSSVADAASIKRVARRIAATKQAGNDIVVVISAMGDTTDDLMDLALEVSPQ
PAPRELDMLLTTGERQSAALLAMALSDVGIPARSYTGSQAGVITTAAHGNARIIDITPGR
IEKSLEAGDLVIVAGFQGVSQTTKDVTTLGRGASDTTAVALASSLGADFCEIYSDVDGVF
TADPRIVKGARRIPEISYEEMLEMAACGAKILHLRCVEYARREDVPVHVRSSFSDKPGTW
VKDPTDITKGSDMEEAIISGVAHDRSEAKITIAGLPDAVGRAAQIFEIIAHADINIDMIV
QNASRVMNGRTDLSFTLPMNDGPTAVRALTAVKDELGYEQILYNDQIGKVSVVGVGMRTH
PGVTSTFFRALADCGINLQMISTSEIRISVVVDADQVDEAVRVAHTAFGLDAEGEAVVYA
GTGR
>Sery_Aa_|_CG-25
MALVVQKYGGSSLESADRIKRVAERIVETRKAGNDVVVVCSAMGDTTDELLDLAQQVNPA
PPERELDMLLTAGERISNALVAMAIEALGAEARSFSGSQAGVITTSAHQNARIIDVTPGR
VQEALKQGQVVLVAGFQGVAQDTKDITTLGRGGSDTTAVAVAAAMNADVCEIYTDVDGVY
TADPRIVSDAKHLDRITYEEMLEMAATGAKVLHLRAVEYARRYGVPLHVRSSYSPKSGTI
VSGSVEDLSVEQAMITGVAHDRSEAKVTVRGVPDNPGIAGRIFRVIADAEIDIDMVLQNV
SGTASGRTDITFTVARSNGALAVTELEKIKDELGFDQVVYDDHVGKVSLVGAGMRSHPGV
TATFCEALSHAGVNIEIINTSEIRISVLIRDTQLEDAVAALHAAFELGGDEEAVVYAGSG
>Save_Aa_|_CG-25
MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGHQVVVVVSAMGDTTDELIDLAEQVSPM
PSGREFDMLLTAGERISMALLAMAIKNLGHSAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTALDEGNIAIVAGFQGVSQDKKDITTLGRGGSDTTAVALAAALDAEVCEIYTDVDGVF
TADPRVVKKAKKIDWIAFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
VSNTPLVQKAQQQGEQKVEQAIISGVAHDTSEAKVTVVGVPDKPGEAASIFRAIADAEVN
IDMVVQNVSAASTGLTDISFTLPKTEGRKAIDALEKAKSVIGFDSLRYDDQIGKISLVGA
GMKTNPGVTAGFFEALSDAGVNIELISTSEIRISVVTRADDVPEAVRAVHTAFGLDSDSD
EAVVYGGTGR
>Scoe_Aa_|_CG-25
MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGNQVVAVVSAMGDTTDELIDLAEQVSPI
PAGRELDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTSVDEGNVAIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALDADVCEIYTDVDGVF
TADPRVVPKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
VSSEPIKQGEKHVEQALISGVAHDTSEAKVTVVGVPDKPGEAAAIFRAIADAQVNIDMVV
QNVSAASTGLTDISFTLPKSEGRKAIDALEKNRPGIGFDSLRYDDQIGKISLVGAGMKSN
PGVTADFFTALSDAGVNIELISTSEIRISVVTRKDDVNEAVRAVHTAFGLDSDSDEAVVY
GGTGR
>Sgri_Aa_|_CG-25
MGLVVQKYGGSSVADAEGIKRVAKRVVDAKKNGNQVVVVVSAMGDTTDELIDLAEQVSPM
PTGREFDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTSIDEGNIAIVAGFQGVSQEGKNITTLGRGGSDTTAVALAAALDAEVCEIYTDVDGVF
TADPRVVKKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLRGTW
VSNEPQGDQQVEHAIISGVAHDVSEAKVTVVGVPDKPGEAAAIFRAIANAEVNIDMVVQN
VSAASTGLTDISFTLPKAEGRKAIDALERARGVIGFDSLRYDDQIAKISLVGAGMKTNPG
VTAGFFEALSDAGVNIELISTSEIRISVVTRADDVNEAVRAVHTAFGLDSDSDEAVVYGG
TGR
>Tmar_Ab_|_CG-26
RVAKYKVLGGAEKFSVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTT
DHLIELAKTIDENPDPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKR
YGSARIIDINTDIISRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGAD
LCELYKDVDGVYTADPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVL
IKNAHKETRGTLIWEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGV
NIDMIIQGMKSGEYNTVAFIVPESQLGKLDIDLLKTRSEAKEIIIEKGLAKVSIVGVNLT
STPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDRE
>Tpet_Ab_|_CG-26
RVAKYKVLVGAEKFSVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTT
DHLIELAKTIDENPDPRELDLLLSTGEIQSVALMSIALRKRGYKSISFTGNQLRIITDKR
YGSARIIDINTDIISRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGAD
LCELYKDVDGVYTADPRIVKNARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVL
IKNAHKETRGTLIWEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGV
NIDMIIQGMKNGEYNTVAFIVPESQLGKLDIDLLKTRSDAKEIIIEKGLAKVSIVGVNLT
STPEISATLFETLANEGINIDMISASNSRISVIIDGKYVEDAVKAIHSRFELDRE
>Bbac_Aa_|_CG-27
MKPLIVQKYGGATLADPEKIKSVSSRIAAQSKENSLIVVVSAMGKTTNSLIDLANQVSSH
PQRREMDMLLTVGERISMSLVSMALNDLGCPAISFTGSQAGIFTDDSHVNAFIKDVKPMR
LDEALKNNRVVILAGFQGVSPVTKEITTLGRGGSDTSAVAMAAAFNAERCEILKDVPAVF
TADPNIVKSARPLSELNYDQLMEMTFWGAKVLHYRSVELAKMRDVTLYIGPASSKTSDGT
IVKKGLNMFESCKALSLNSHELVLGIHCREKNPAKALQGLQNLLDKNQIAFPQLLSCETS
LDKTEIFLTGPQEIMFAVKKELEKHPDFTLLPTDYSTVTLTCTGATSPEMTQKVLNTLTG
KNLETQKILISAMSLTVLVEAPLRKQVIECLHPLI
>Adeh_Aa_|_CG-27
MPVVVQKYGGSSVGTVEKMRKVAEKVAAARRAGKDVCVVVSAMGDTTDDLLSLAKQISPA
PARRELDMLLSAGERISMALLSMALNDLGVPAISFTGSQSGIITTDSHSAARILEVRAFR
VQEELAKGKVVIVAGYQGVSTRKEVTTLGRGGSDTTAVALAAALGADCEIYSDVAGVFTA
DPRVVPSAARLEALSYEEMQELAAAGAKVLNAQAVEFAKERGIAIHARSTFGGPEETVVK
GGAHPERIAGVAMQKGLALLGFPAARLGDVLAILERHGAVALEIAVPGERAGVALDLENV
HDWPVLRAQLAAEVPGLAAEDEAIGAVSVVGTGISAGHRVLRAVTATLAELGARPRALFT
SPLRVTAYCDAAVLKDAARRLHEQLVG
>Mxan_Aa_|_CG-27
MPIVVQKYGGSSVAGVEKLRKVAQRVKDKREAGYQVVVVVSAMGDTTDELLALAKGVSVD
PPRRELDMLLTCGERISMALLSMALQEMDVPAISFTGSQSGIITTDAHAQARIVEVRPYR
IHDELARGKVVIVAGYQGVSFKKEVTTLGRGGSDTTAVALAAALDAEACEIYSDVDGVFS
ADPRVVPDARKLESLSYDEMQELASAGATVLNAQAVEWAKARGITILARTAHGQGTGTAV
QELAVPTDHRLKGVTADAEMAVLSASEPIRLAELLEFLDARAVRGRTLDCEGSVGGVRRT
VITVPLADIHGADALRRELATRFGDAVSWREDLGTVTCVGVGLNADWAPLRRALAAAEEL
GAHVHAAHTSPLQLTLLVDKAHLKALTARLHRELLGG
>Cbot_Ba_|_CG-28
MATIVQKYGGTSVATVEKIKNVAKFIVKRKREGNDIVIVVSAMGHTTDNLINLAKDISNV
PDKRELDALISTGEMVSSSLLSMAIKELGEDAISYTAYQINISTNGQHGKSLINDIDKKK
IDKSLKEGKVVVVAGFQGINCDGNITTLGRGGSDTSAVAIAAKLNNAICEIYTDVDGIYS
VDPRVYDRAKKLDYIDYEEMLELSSLGAQVMHSRSIELAEKYNIPIYVGLSNSNIKGTVI
RRMNNMNMEMKSVTGLATSDDDVAITMEDINENINIVADIFSKLAEKQINVDMISQTAPI
NSRISLSFTIPKEDLQEGMKIIRNYASKDKIKIDENLTKFSIVGIGMKNTSGVAAKMLKI
FSDNNIKVKMITTSEIRITCAINVRDKINAINLVVKEFNL
>Cdif_Aa_|_CG-28
MSIIVQKYGGSSVADTEKIKSIAENIIERRKENPQMVIVVSAMGKSTDEYITLAKELSNE
PSKRELDALMSTGEMISASLLSIALNALGCKAISYNAYQLNIKTSGLHGKSQIDDINVNR
IKNSLDEGNVVIVTGFQGINEDGDVTTLGRGGSDTSAVALAVKLNGKCEIYTDVDGIYFT
DPRKYSKASKLDEIEYEEMLELASLGAQVMHSRSIELAQKYGVEIYVGRTCGTEKGTYIR
GGKDMKLEDKVITGLATSDDDSSITIKDFKAENISSLFEDIATIGISVDMISQTAPILDK
ISVSFTVPKEELGECKKIVSKYTDEEHVVIDNNITKFSLVGLGMKNTSGVAAKVFKIFNE
NGIMIKLITTSEIRITCAINSDDKQVAIEKIAEVFNI
>Tmar_Aa_|_CG-29
MNVVVQKYGGSSVATPERIKNVAQRIKKKVDEGYKVVVVVSAMGKTTDNLIKLAKEISPR
PDSRELDMLLATGEQVSAALLSMALKDLGVKAKSLNAFQVKIKTTPHHTSARIVDIDDSV
IRENLKDYDVLVVTGFQGVNEHGDLTTLGRGGSDTSAVALAAKLRVPCEIYSDVDGIYTC
DPRVHPRAKKLAYITYDEALELTALGAKVLHSRSVEIAKKYGIPIYCASSFTEEEGTMVV
ERLPEWLEEPVVTGATISHGQIKVSISFLPKDVKYITAIFEEVGKRALNVDMISLVPSNG
KVFLSFTILEDHKEDLDEALKEALRDVEGWKSTYEGGFAKLSIVGVGMRTSPGVAARFFE
ALERAGVTPELVTTSEIKISCLVPEEKAEEALKSVIEEFEL
>Tpet_Aa_|_CG-29
MNVVVQKYGGSSVATPERIKNVAQRIKKKVDEGYKVVVVVSAMGKTTDNLIKLAKEISPK
PDSRELDMLLATGEQVSAALLSMALKDLGIKAKSLNAFQVKIKTTSHHTSARIVDIDDSV
IWENLKDYDVLVVTGFQGVNEHGDLTTLGRGGSDTSAVALAAKLRVPCEIYSDVDGIYTC
DPRVHPRAKKLAYITYDEALELTALGAKVLHSRSVEIAKKYGIPIYCASSFTEEEGTMVV
ERLPEWLEEPVVTGATISHGQIKVSISFLPKDVKYITAIFEEVGKKALNVDMISLVPSNG
KIFLSFTILEDHKEDLDEALKEALRDVEGWKSTYEGGFAKLSIVGVGMRTSPGVAARFFE
ALERAGVTPELVTTSEIKISCLVPEEKAEEALKSVIEEFEL
>Saur_Aa_|_CG-30
MVTRSVLKFGGSSVSDFTKLKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTK
APKQQELALLLTTGEQQTVSYLSMVLNDIGMNAKAMTGYQAGIKTIGHHLKSKIAQINPQ
TFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYA
TDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWI
MSNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLD
GLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFL
TLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI
>Sepi_Aa_|_CG-30
MNRSVLKFGGSSVSDFKKIKNIAEMLKTRIEDGEELIVVVSAMGKTTDQLMNNVSSLTST
PKDQELALLLTTGEQQTVSYLSMVLNDIGVNAKAMTGYQAGIKTVGHHLKSKIAEINPNI
FDEAFKDHDILVVAGFQGINDDFELTTLGRGGSDTTAVALAASNQIPCEIYTDVDGVYAT
DPRILNEAKRLEYVSYEEMMEMSALGAGVLETRSVELAKNYDIPLYLGRTLSNMKGTWIM
SKSDLLEKKAVTGVALDTHMMHVTISYPLPDNQLLTQLFTALEEESVNVDMISQIVNLEG
LQLSFSIKDSDAHQISSILENLSIHFSALDYKINEAYVKISLIGSGMRDMSGVASKAFMT
LINSDIPFYQTTTSEISISYVIDEENGEKAVEELYHAFEI
>Shae_Aa_|_CG-30
MKRSVLKFGGSSVADFTKIKNIAEMLKNRVDDGEQLIVVVSAMGKTTDQLMDNVSNLTAT
PKDEELALLLTTGEQQTVSYLSMVLNDIGVNARAMTGYQAGIKTIGHHLKSRIAEINPET
FDKAFTDKDVLVVAGFQGINDAFELTTLGRGGSDTTAVAIAASNQIPCEIYTDVDGVYAT
DPRILSKAKRLDYFSYEEMMEMSALGAGVLETRSVELAKNYDIPLYLGRTLSNEKGTWIM
SRTDLLEKKAVTGVALDKHMMHVTISYPLPDNRLLTQLFTALEEGSVNVDMISQIVNIEG
LQLSFSIKDSDVQQISTILSNLSSSFNALDYKINEEYVKISLIGSGMRDMSGVASKAFIT
LINANIPFYQTTTSEISISYVIDADNGEKAVEVLYNAFDI
>Ssap_Aa_|_CG-30
MNLERSVLKFGGSSVSDFTKIKNIAEMLSLRIAQGEQLIVVVSAMGKTTDELMANVSTLT
TSPKDQELALLLTTGEQQTVSYLSMVLNDIGVRAKAMTGYQAGIKTVGHHLKSRIAEINP
ETFEQAFEENDVLVVAGFQGINDDLEVTTLGRGGSDTTAVALAASNHTPCEIYTDVDGVY
ATDPRLYKDAKRLDYVSYEEMMEMSALGAGVLETRSVELANNYNIPLYLGRTLSNVKGTW
IMPQTEILEKKAVTGVALDTHMMHVTISYPLPDNKLLTKLFSQLEDGSVNVDMISQIVNL
EGLQMSFTIKDTDVAQISSILETLKEDFSALDFRINEEYVKISLIGSGMRDMSGVASKAF
ITLIENDISFYQTTTSEISISCVIDAENGERAVQTLYQAFDI
>Lbor_Ba_|_CG-31
MPNIIVQKYGGTSVGTPERIQNVARRIKSYHDKGQQIAVVVSAMGHTTDDLVELAAKISA
NPPKREMDMLLSTGEQISTALLAMALWEIGVPATSFTGSQIKLLTDGNFSNAKIKMIDRS
RIDAALNEGKVAIIAGFQGIDEEENITTLGRGGSDTSAVAVAAVLGAKECEIYTDVDGVY
TADPRIVPNAKKHTQITYEEMLELASLGAGVLHSRSVELGMNYDVVIHVRSSFNENQGTL
VMSEDKIMEKLKVSGVTAKSDQARITIAEVPDKPGLAARLFGELNSKHILVDMIVQSSPH
NGINTISFTISKKDVLQAKPILQGFSKTHNAKEPEINESIAIVSAVGVGMKSHVGVAAGM
FQALADNGINIEMISTSEIKISCVIPEDQAKIAINKIHDVFGLSG
>Lint_Aa_|_CG-31
MTNIIVQKYGGTSVGTPERIQNVAKRIKSYHDKGQQVAVIVSAMGHTTDELVDLAAKISS
NPPKREMDMLLSTGEQISTALLAMALWEIGVPATSFTGSQIKLLTDGNFSNAKIKMIDRS
RIDSALNEGKVVIIAGFQGIDAEENITTLGRGGSDTSAVAVAAILGAKECEIYTDVDGVY
TADPRVVPSAKKHKQITYEEMLELASLGAGVLHSRSVELGMNYDVVIHVRSSFNDNIGTL
VVSEDKIMEKLKVSGVTAKNDQARITIAGVPDKPGLAAGLFGELSSKHILVDMIVQSSPH
NGINTISFTIPKKDVHEAKPILEGFSKSHNAKEPEINENIAIVSAVGVGMKSHVGVAAGM
FKALADNGINIEMISTSEIKISCVIAESQAKIAVNKIHDVFGLSS
>Avar_Aa_|_CG-32
MALIVQKFGGSSVGSVERIQAVAQRVYKTVKAGNSLVVVVSAMGKTTDGLVKLANEISRN
PNRREMDMLLSTGEQVTIALLSMALQELGQPAISMTGAQVGIVTEAEHTRARILHIETER
VEGHIQEGKVVVVAGFQGISSNGSLEITTLGRGGSDTSAVALAAALQADFCEIYTDVPGI
LTTDPRIVPEAQLMGEITCNEMLELASLGAKVLHPRAVEIARNYGMPLVVKSSWTDDPGT
WVTTPKPQGRSLINLELARPVDDVELDTDQAKVALLRVPDKPGVAAKLFGEISRQKVDVD
LIIQSIHEGNSNDIAFTVTTPILKRAEAVAAAIAPSLRSPSHPKSDEAEVMVEQNIAKVS
IAGAGMIGRPGVAAKMFTTLAEAGVNIQMISTSEVKVSCVIDAQDGDRAIIALRKAFEIE
TPLHSPTPPTLSTHNSPPVRGVALDLNQARLAIRQVPDRPGMAAQLFGILAQNNISVDMI
IQSQRCRIVDGVPRRDIAFTVPRMDGETAQKLLCQVAPELGWGDVVLDSAIAKVSIVGAG
MVGQPGVAAKMFEALAKHQINIQMIATSEIKISCVVSQEQGVQALQVIHTAFELAGTEKF
VVPV
>NOST-3a_|_CG-32
MALIVQKFGGSSVGSVERIQAVAQRVYKTVKAGNSLVVVVSAMGKTTDGLVKLANEISRN
PNRREMDMLLSTGEQVTIALLSMALQELGQPAISMTGAQVGIVTEAEHTRARILHIETER
VEGHIKEGKVVVVAGFQGISSNGSLEITTLGRGGSDTSAVALAAALQADFCEIYTDVPGI
LTTDPRIVPEAQLMGEITCNEMLELASLGAKVLHPRAVEIARNYGMPLVVKSSWTDDPGT
WVTTPKPQGRSLINLELARPVDDVELDTDQAKVALLRVPDKPGVAAKLFGEISRQKVDVD
LIIQSIHEGNSNDIAFTVTTPILKRAEAVAAAIAPSLRSPSHPKSDEAEVMVEQNIAKVS
IAGAGMIGRPGVAAQMFATLAEAGVNIQMISTSEVKVSCVIDAQDGDRAIIALRKAFEIE
TPLHSQLPTPSSLSTHNSPPVRGVALDLNQARLAIRQVPDRPGMAAQLFGILSQHNISVD
MIIQSQRCRIVDGVPRRDIAFTVPRMDGETAQKLLCQVAPELGWGDVVLDSAIAKVSIVG
AGMVGQPGVAAKMFEALAKHQINIQMIATSEIKISCVVSQEQGVQALQVIHTAFELAGTE
KFVVPA
>Pmar_Aa_|_CG-32
MALLVQKFGGSSVGNVERIQAVAERIATSKDLGHDLVIVVSAMGQTTDELTALAKVISSN
PPQREMDMLLATGEQVSISLLSMALHELGIPAISMTGAQVGIVTESAYGRARILDVRTER
LQSLLSTGKVVVVAGFQGTSLSSVGTAEITTLGRGGSDTSAVAIAAALGADACEIYTDVP
GVLTSDPRQVSDAQLMQEVSCDEMLELASLGASVLHPRAVEIARNFGVALVVRSSWSNEA
GTKLTSKSKRPIGREGLELGRPVDGVELAEGQAVIALSHVPDQPGVAATLFENLSSDGVN
VDLIIQSTHEGNSNDIAFTVAEADLAKAHSLCEGLLKSVGGQLSAEAGMSKLSISGAGIM
GRPGIAASLFDTISRAGINLRLIATSEVKVSCVIDATLGSKALRAVSTAFELSDSQVRIN
PLGNGKGEPEVRGVALDQGQAQLSVRGVPNRPGTAAALCSAMAEAGISLDAIVQSERQHD
DGSRDISFTLKRDEREQANKTLAPLLAQWPGANLEDGPAIARVSAVGAGMPATAGTAGRM
FRALADAKINIAMIATSEIRTSCVVAEPDGVKALQSVHKGFGLGEEADHPVQSNS
>Pmar_Ba_|_CG-32
MALLVQKFGGTSLGSIERIKAVAQRIKSSKEKGDDLVVVVSAMGHQTDELTRLASEITVD
PPHREMDMLLSTGEQVSISLLTMALNELGTPAISLTGTQAGIITESAHGRARILEIRTER
IKNLLDQGQTIVIAGFQGTTLGIGGIAEITTLGRGGSDTSAVALAASLEAAKCEIYTDVP
GVLTTDPRIVKNAKLMKSISCDEMLELASLGAAVLHPRAVEIARNFGVTLVVKSSWDNLD
GTTLTSNKKPDFSQGGIEHRSPVDGLELLENQAVVALSNIPDRPGIAAELFESLSEGGVN
VDLIIQATHQIDSNDITFTVAENELHNALTQCKKLVNTIGGDISFQKDLTKLSIYGAGIM
GRPGIASSLFQILSDSGINIRLIATSEVKVSCVIDAELGKKALRNVSEVFKLTDKQITVN
PTIENNNEPEVRGIALDKDQIQISVKNVPDKPGTASTICSTLAEKNISLDTIVQSERKHK
DKTKDISFTLKKNDRSDAKYALKELIGNWKGSNLEEGESIVRISAVGSGMPFTKGTAGKI
FRALANQKINIEMIATSEIRTTCIISEKYGEKALNEIHSCFKLGKNES
>Pmar_Ca_|_CG-32
MALLIKKFGGTSVEDITKIKAIAQSIIQSKEAGNDIVVVVSAMGHSTDHLNKLAESISKN
PNSRELDMLLSTGEQVTMALLSMSLNEYGIPAISLTGSQVGIVTESIHGKARILDIKTER
IQNYINQGYVVVVAGFQGSTLSHTGSMEITTLGRGGSDTSAVALSTALGAETCEIYTDVP
GVLTTDPRIVPNAKLLDIISCEEMLELASVGASVLHPRAVEIARNYGIKLYVKSSQALSN
GTLLHSKIKPLALKRGGLELTKTVNSLEVLEKQTVFSISKLPDRPGIAAQIFETLSKANI
NVDLIIQATHDGKSNDIAFTVNDFELTKTIDQCKLITKQLGGEYDFKKNMTKLSIQGAGI
MGRPSVSADLFDTLFQANINVRLIATSEIKVSCVIDIENISKAIRFVSEKFKLSDKQIFI
NPVIESEDQPEVRGIALDKNQVQVSIRNLPDKPGVAASICLALAENNLIFDTIVQSERLT
SLKTKDISFTMSKQDRERANTIFHSLTKKLAGSFIEDGPAIAKVSTVGAGMAFKVGTAGK
IFRALANKNINIEMIATSEIRTSCIVLEQDCDQAVNAIHSYFQLDK
>Gvio_Aa_|_CG-32
MGLIVQKYGGTSVGSAERMRSVAERIARTHRQGHDLVVVVSAMGHTTDALVKMACEMHGE
PDPREMDMLLTTGEQQSVALLTMALHALGCKAISLTGAQVGVVTEPNHTRARIRRVQTGR
INELLAAGYVLVVAGFQGICHSRFWEITTLGRGGSDTSAVALAAVLKANRCEIYTDVPGV
LTTDPRLVGDAALLEEITSEEMLELASLGAQVLHPRAVEIARNYAVPLVVRSSWSDAPGT
IVLSPRLPVDRAIDNLETERPVDAVYIDNHQAKIALLRVPDRPGVAAALFGHLAKAGIDV
DLIIQSIHHPNAPEPTNDIAFTVQRSDLAAAVATSETAAAALGGCAVVVDPVPTKVSIRG
AGIIGRPGVVAQMFKALAEARINIQMISTSETSLSCVIAGEQAEKAGEVLCGQFGLRAPV
YEEPPVVSGARPVAQAVRGVALDTNQAQVAILQIPDRPGVAAEIFQCLAQEGIAVDMIVQ
SQRGADTNDIGFTVSRSAVRAAQRALASLCMGFAGCGGVVVRESVAKLSLVGAGIVGTPG
VAARMFETLASLGTNIEMISTSTIKVSCIVEAACCEASLQAVHRAFGLGSGAMVAVEGRS
>Selo_Aa_|_CG-32
MALIVQKYGGTSVGSVERITAVAQRIAQTVAAGNQVVVVVSAMGHSTDELLKLANGISAN
PSRRELDMLLATGEQVSIALLSMALHEQGCDAISMTGAQVGIITEAHHSRARILEIDPQR
LQSQLDAGRVVVVAGFQGIASSDRTALTEITTLGRGGSDTSAVALAAALNADRCEIYTDV
PGILTTDPRLVPEAHLLEEITCDEMLELASLGASVLHPRAVKIARNYGVRLVVRSSWTQE
PGTGVVAPPRRSDRSLQGLEIGRPVDGLALDTDQAKVALLHVPDRPGIAASLFGEMAQRG
VNVDLIIQSIHEGNSNDISFTVSQADLEKAEAGTTQLLADLGGEQQSEAAVAKVSISGVG
IVGRPGIAAQMFSALAQGGINIQMISTSEVKVSCVIAAADQQRAIAALQESFELEEAIAA
TATDACTTDLPAVRGVALDRDQARLAILNVPDLPGMAATIFQILADRQISVDMIIQSQRG
RIHNGQPCRDIACTLPPADAELAAAALQAFADQHGCSLEIQTEIAKVSIVGSGMVQQPGV
AAQMFAALANHGINIHMIATSEIKVSCIVDASQAVEALQTVHAAFGLASDRRIEVPA
>SYNE-11a_|_CG-32
MALLVQKYGGTSVGSVERIQAVAKRVAAARLDGHDLVVVVSAMGHTTDELTALARALNPD
PPQREMDMLLATGEQVSIALLSMALQAEGVAATSMTGPQVGIVTESAHGRARILEVRTER
VKRRLHDGHVVVVAGFQGTSTGSAGTPEITTLGRGGSDTSAVALAAALGADACEIYTDVP
GVLTTDPRKVPEAQLMTQVSCDEMLELASLGAAVLHPRAVEIARNYGVPLIVRSSWSDEP
GTRLFSQPSRRIGSEGLELGKPVDRAELLEGQAVVALAHVPDEPGVAARLFEGLGAAGLN
VDLIVQATHDGSSNDIAFTLAEAELPAAEAFCREHLGEGSQLQVQSGLAKLSIGGAGIMG
RPGVAAQLFDGLSKMGISLRMIATSEVKVSCLIQGEQAAKALRTAAQVFELDDHQLQHNP
LPGGEGEPDVRGVALDRDQAQLTVTAVPDRPGSAAALCRALADGGISLDTIVQSERQRQT
DLGLCRDIAFTLPRDDLSRASEALRPLLKLWPGAELVEGKAIARVSAVGAGMPSTPGSAA
KMFRALADAGINIEMIATSEIRISCVVPEDDGIGALQAVHQAFGLNGESQHQAQGSEWAG
>SYNE-4a_|_CG-32
MALIVQKFGGTSVGTVERIQAVAQRIKRTVQGGNSLVVVVSAMGKSTDVLVDLAQQISPN
PCRREMDMLLSTGEQVSIALLSLALQEIDQPAISLTGAQVGIVTEAEHSRARILEIRPDR
LEHHLREGKVVVVAGFQGISSVEHLEITTLGRGGSDTSAVALAAALKADFCEIYTDVPGI
LTTDPRLVPEAQLMAEITCDEMLELASLGAKVLHPRAVEIARNYGIPLVVRSSWSDEPGT
KVVAPPVQNRSLVGLEIAKAVDGVEYDADQAKVALLRVPDRPGVASKLFRDIAQQQVDID
LIIQSIHDGNSNDIAFTVVKDLLNTAEAVTSAIAPALRSYPEADQEAEIIVEKGIAKIAI
AGAGMIGRPGIAAKMFKTLADVGVNIEMISTSEVKVSCVIDQRDADRAIAALSNAFGVTL
SPPKNQTDTSHLPAVRGVALDQDQAQIAIRHVPDRPGMAAQLFTALAEANISVDMIIQSQ
RCRINQGTPCRDIAFMVAEGDSSQAEAILQPLIKDWLDAAIVVNKAIAKVSIVGSGMIGH
PGVAAHFFAALAQENINIEMIATSEIKISCVVPQDRGVDALKAAHSAFNLAGTKTVTVPA
>Telo_Aa_|_CG-32
MGLIVQKYGGTSVGSVERIQAVARRVKATVAAGHQVVVVVSAMGKTTDSLVQLAYAISDR
PSQREMDMLLSTGEQVSIALLTMALHALGEPAISLTGAQVGIVTEPAHTRARILHIETQR
LERHLKAGQVVVVAGFQGITAATDFEVTTLGRGGSDTSAVALAAALRADCCEIYTDVPGI
LTADPRLVPNAQLMSEITCDEMLELASLGAKVLHPRAVEIARNYGVDLVVRSSWTDDPGT
RVIAPARPPRPVENLELGKPVDGVALDTDQAKVALLRVADRPGVAAQLFGELARQNLDVD
LIIQSIHEGQTNDIAFTVQKSVLKQAEAIAVAFYPRLSPRVEETDVLVDADIAKVSITGA
GMIGRPGVAAQMFSALAAAGINLQMISTSEVNVSCTVAAADAGRAIAVLSQTFDVEAATT
VPQNPPAAPPVRGVALDPKQARIAIRDVPDRPGMAAAIFQTLADAAISVDMIIQSQRSRS
LGGVMTRDIAFTVASTDAEDATELLRKVQAQLGYGDVLVDTAIAKVSIVGVGMIHRPGIA
AQMFAALARENINIQMIATSEIRVSCVVAESEGVRALRAVHRAFGLDGEAPVAIPDVGK
>Tery_Aa_|_CG-32
MLIVQKYGGTSVGSVERIKAVAQRIAKTASDRSVVVVVSAMGKTTDTLVKLANDISPNPC
RREMDMLLSTGEQVTIALVSMALQELGVPAISLTGAQVGIVTEAQHSRARILHIQTERIE
EHLQLGEVVVVAGFQGISQTRHQEITTLGRGGSDTSAVALAAALQAQRCEIYTDVPGILT
TDPRIVPEAQLMSEITCDEMLELASLGAKVLHPRAVEIARNYGMPLVVLSSWSDAPGTRV
VSAIPKRPALQDLELTKPVDAVEYDTNQAGISMLRLPDRPGVAAQLFSGIALQNIDVDLI
IQSIHESNTNDIAFTVSKDVLKQAAAVADAMLPALGKNAHPSLGEPEVKTEERPIAKVSL
VGAGMIGRPEVAAKMFEALAAAGVNIIMISTSEVKVSCVVDAEDCKKTVNSLCQAFDVDV
ADISSSSTAGESEEVPPPVRGVALDIKQARLAVRQVPDHPGMAAKIFGLLAQQNISVDMI
IQSQRCHSVDGVLTRDIAFTVSQPEGETAYQILANTAADFGWGEVVLESSIAKVSVVGSG
MISHPGVAAQMFEALAASQINILMITTSEIKISCVVEEEDGVKALQAIHKAFCLSANEVV
KVPA
>Bant_Aa_|_CG-33
METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVSVVSAMGKSTDELVALANAITEN
PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITEINTDR
IQSYLTKGTIVIVAGFQGVSEDLEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSMEQENGTIV
KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
VHLSFSIHSNDLRETLAVLEQNQEALHYESVEYENHLAKVSIVGSGMVSNPGVAANMFTT
LKEEDIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIEPLVQMS
>Bcer_Aa_|_CG-33
METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVSVVSAMGKSTDELVALANAITEN
PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITEINTDR
IQSYLTKGTIVIVAGFQGVSEDFEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSMEQENGTIV
KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
VHLSFSIHSNDLRETLEVLEQNQEALHYEAVEYENHLAKVSIVGSGMVSNPGVAANMFTT
LKEENIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIVPLVQMS
>Bhal-1_Aa_|_CG-33
MSIIVQKYGGTSVGSVQRIEHVANRIIATAASGKKVVVVVSAMGKTTDELVGLASEITDE
PRKREMDMLLATGEQVTIALLAMALHKRGQEATSLTGWQAGMITESHHGNARILEVERAR
MDELLDKVHVVIVAGFQGIDQQGEIMTLGRGGSDTSAVAIAAALKAERCEIYTDVTGVFT
TDPRVVKQARKLQTISYDEMLEMANLGASVLHPRAVEFAKNYEIPLLVASSMVDEPGTMI
EEEGTMEQNLLVRGIAFENDVTKVTVHGLPNEIHTLPTLFAHLSAAGINVDIIIQNQTDS
GMAISFSITQSSLKETLARLEELKGELSFQGIDYEEELAKVSIVGSGMVSNPGVAAKMFE
ILAANDIAIKMVSTSEIKVSAVIDEELMVLAVEMLHEQFKLHEEEPAVAVKV
>Blic_Ab_|_CG-33
MGLIVQKFGGTSVGSVEKILNVAYRVIEEKQRGHDVVVVVSAMGKSTDSLVALAKEITEQ
PSSREMDMLLTTGEQVTISLLTMALQNKGYDAVSYTGWQAGIETENIHGNARITNIDTAK
LKERLNEGKIAVVAGFQGVTAEGEITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFT
TDPRYVKTARKLAGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTEKEAGTLI
EEESSMEQNLIVRGIAFEDQITRVTVCGLASGLTTLSTIFTTLAKQNINVDIIIQSVTGT
SKTSISFSVKTEDLKRTVEVLEEYKDALDYEQIETENRLAKVSIVGSGMISNPGVAAEMF
AVLAEKNIQVKMVSTSEIKVSTVVNEGDMVKAVEALHDAFELSKQTAVI
>Bsub_Aa_|_CG-33
MGLIVQKFGGTSVGSVEKIQNAANRAIAEKQKGHQVVVVVSAMGKSTDELVSLAKAISDQ
PSKREMDMLLATGEQVTISLLSMALQEKGYDAVSYTGWQAGIRTEAIHGNARITDIDTSV
LADQLEKGKIVIVAGFQGMTEDCEITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFT
TDPRYVKSARKLEGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTETEAGTLI
EEESSMEQNLIVRGIAFEDQITRVTIYGLTSGLTTLSTIFTTLAKRNINVDIIIQTQAED
KTGISFSVKTEDADQTVAVLEEYKDALEFEKIETESKLAKVSIVGSGMVSNPGVAAEMFA
VLAQKNILIKMVSTSEIKVSTVVSENDMVKAVESLHDAFELSKHPSAV
>Bthu_Aa_|_CG-33
METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVTIVSAMGKSTDELVALANAITEN
PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITDIHTDR
IQSYLAEGTIVIVAGFQGVSENHEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSTEQENGTIV
KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
VHLSFSIHSNDLRETLKVLEQNQEALHYESVEYENHLAKVSIVGSGMVSNPGVAANMFTT
LKEEDIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIEPLVQLI
>Linn_Ab_|_CG-33
MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGKSTDKLVAMAEEISEA
PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIETEAVHSNARIADIDSAR
IESALEAGQIVIVAGFQGITTDGEITTLGRGGSDTTAVAIASALKAEKCAICTDVVGVFT
TDPRYVKKAQKLEQLTYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHELEPGTMI
EEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
GHGNLSFTIKTSELLATLAVLEESKELLQIEKLESEQELAKVSIVGSGMVSNPGVAAKMF
EALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQFELDK
>Lmon_Ab_|_CG-33
MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGKSTDKLVAMAEEISEA
PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIETEAVHSNARIADIDSAR
IESALDAGQIVVVAGFQGFTTDGEITTLGRGGSDTTAVAIASALNAVKCAICTDVVGVFT
TDPRYVKKAQKLEQITYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHEQVPGTMI
EEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
GHGNLSFTIKTSALLATLAVLEESKELLQIEKLESEQDLAKVSIVGSGMVSNPGVAAQMF
EALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQFELDK
>Lwel_Ab_|_CG-33
MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNRVIIVVSAMGKSTDKLVAMAEEISET
PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISLTGWQAGIETEAVHSNARIAEIDSSR
IESALDLGQIVVVAGFQGFTSDGEITTLGRGGSDTTAVAIASALNAEKCAICTDVVGVFT
TDPRYVKNAQKLEQITYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHEKEPGTMI
KEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
GHGNLSFTIKTSALLATLAVLEESKELLQIEKLESEQELAKVSIVGSGMVSNPGVAAQMF
EALTENNIPIKMISTSEIKVSTVVSARNMVEAAQALHDQFELDK
>Dole_Aa_|_CG-34
MGLVVQKFGGTSVADIEKIRNVANRVIRTATAGNRVVVVLSAMAGITDSLINLANQAAED
PDGRELDSLLSTGEQTTVALLAMMLTDMGYKARSLLGFQAGIRTNAAATKARIISIDAEK
IRTLLAGGYIVVVAGFQGIDDDGNITTLGRGGSDTSAVALAAAIKADVCEIYTDVDGVYT
TDPSICEKARKLSRISYDEMLEMASLGAKVLQIRSVEFAKKYNVPVHVRTSFGEEEGTMV
LQEDTGMEELVISGVTCSKGEARITFKKVADVPGVASEIFGPIAEARILVDMIIQNTRAG
GQTDLTFTVPRGDYKKALAIAQETGKAIGAEEVMGAENLAKVSIIGVGMKNHSGVASTMF
STLAAEGINIQMISTSEIRISCVVEEKYAELAVRVLHTAFGLDKKE
>Ddes_Aa_|_CG-34
MRILVQKFGGTSVANLECMQQVKQKVLHARENGYKVIAVLSAMSGETNRLLNMAGQWSQC
PDEAEVDALISTGEQVSVSLFAMLLQNEGIKARSVLGFQIPLKTNTAYSRARILDIRKDT
LVELLEAHDVLAVAGFQGINDDNRITTLGRGGSDTSAVALAAALGCECEIYTDVDGVYTT
DPNMCSAARKLDRISYDEMLEMASMGAKVLQIRSVEFAKKYKVPVRVRSTFTNDSGTLLT
QEDSQMEAVMVSGIAYDKDQARITLRGVPDTPGVAASLFCPLADAGIVVDMIVQNPSLDG
VTDMTFTVPRKDLTRALELVEKTRAEVGAKEVLHDLNVCKVSAIGVGMRNHSGVASKTFA
TLRRENINILMISTSEIKITCLIEEKYTELAVRTLHDAFGLDKDQSQAG
>Dvul_Aa_|_CG-34
MRILVQKFGGTSVANLECMKQVRAKVLAARERGYKVVVVLSAMSGETNRLLALADEWSSE
PDPAETDALVVTGEQVSIALFSMLLKDSGIKARSFLGFQIPIVTSDTFGSARILSIDDSR
LRAELETHDVLVVAGFQGCTADGRLTTLGRGGSDTSAVALAAALGSVECEIYTDVDGVYT
TDPNLCSTARKLDRITYDEMLEMASMGAKVLQIRSVEFAKKYNVPVHVRSTFTDTTGTLV
TQEDSSMEAVLVSGIAYDKDQARITLRSVPDRPGVAAAIFVPLSTNGVVVDMIVQNPSRE
GVTDMTFTVPRKDLKKTLTLMEGIREETEALEVLHDVSVAKVSAIGVGMRNHSGVAAKAF
AALRKENINILMISTSEIKITCLIEEKYTELAVRVLHDAFGLSSNTEH
>Lint_Aa_|_CG-34
MQILVQKFGGTSVATLECLKQVQQKVTNALNNGFKVVVVLSAKAGKTNTLLELAHSCAEN
PDPLELDSLLSTGEHASITLFSLLLNKQGIKTRSLLGWQIPILTNNDFGQARIISINGDM
LYKQLKNYDALIIAGFQGVTQEGQITTLGRGGSDTSAVAIAASLGSCKCEIYTDVEGVYT
TDPNLCTKARKLAYVSYDEMLEMASMGAKVLQIRSVEFAKKYNVPIKVLSTFSNASGTMV
TQENSIMEAVLVSSIAYDNDQARVTLCDIPHHIGTAASIFGPLAEQHILVDMIIQASSRN
NLTDITFTVSRKDLTRACNLMEELIKSIGGKSVECATNVAKVSLIGVGMRNHAGVAAKAF
NALKDENIDILLISTSEIKISCLIEEKYTELAVRTLHDVFELQNDVASLS
>Saci-5_Aa_|_CG-34
MALVVQKYGGTSVANLEKIENVARKVIKTKKEGNDVVVVLSAMAGETNRLIELARQAAED
YDVREYDTLISTGEQVTISLLAMVLNRMGYPARSFLGHQVRIMTDQAYTQARILDVEDRL
LRGELEKGKIAVVAGFQGVDQDNNITTLGRGGSDTSAVALAAALHADVCEIYTDVDGVYT
TDPNICSNARLLEKISYDEMLEMARAGAKVLQPRSVELAKKYEVPVYVKSSFKDEVGTLV
TKEDKDMEREVVSGVTYDRDQAKITVVHVPDKSGVAARLFTPLAEHNIVVDMIIQNASLE
GYTDLSFTVSRKDIKETKRLIEEAAKEVGASKVEVDEQVAKVSIIGVGMISHSGVAARMF
AALAQEGINIMMISTSEIKVSCVIQSKYTELAVMVLHEVFGLDKKS
>Cjej_Aa_|_CG-35
MLIVQKYGGTSVGTLERIEAVANRVIQSAQQGNQLVVVVSAMSGVTNTLIEQAEYFSKTP
NGKDMDMLLSSGERVTSALLSIALNEKGCPAISFSGRKAGIITDSVFTKARIHHIDTKAI
KSELQNGKIVVIAGFQGVDEEGNVTTLGRGGSDLSAVAVAGALNADLCEIYTDVDGVYTT
DPRIEPKAKKLDKISYEEMLELASLGAKVLQNRSVELAKKLNVNLVTRSSFNNNEGTMIT
KEDGMEQALVSGIALDKNQARVTLRNIEDKPGIAAEIFSVLANENINVDMIIQNVGVDGA
TNLGFTVPQNELELAKNAMQKILSSKTTIESDSAVLKVSIVGVGMKSHSGVASKAFKALA
DEGINIGMISTSEIKISMIVHEKYGELAVRALHECYGLDK
>Haci_Aa_|_CG-35
MLIVQKYGGTSMGSVERIHNVAQRVLESVKLGHQVVVIVSAMSGETDRLLEFGKNFSHNP
SKREMDRIVSVGELISSAALSMALERYGYKAISLSGKEAGILTNSHFQSAVIQSIDNKRI
RELLEKNYIVVIAGFQGADTHGETTTLGRGGSDLSAVALAGALKADLCEIYTDVDGVYTT
DPRIEEKAQKIAQISYDEMLELASMGAKVLLNRSVELAKKLSVKLVTRNSFNHSEGTLIV
AEKDFKGERMETPIVSGIALDKNQARVSMEGVEDRPGIAAEIFGALAEYRINVDMIVQTI
GRDGKTDLDFTIVKTQIEETKYALKPFLSQIDSIDYDENIAKVSIVGVGMKSHSGVASTA
FKALAKDNINIMMISTSEIKISVLIDIKYAELAVRTLHAVYELDK
>Hhep_Aa_|_CG-35
MLIVQKYGGTSMGDCDRIHNVAKRVIKSKAQGHKLVVVVSAMGGETDRLINFTQHFTPLP
NTREVDMALSAGERVSAALLAIALESMGVKAISLSGRGAGIITDEFHTKARISYIDTTKI
FHLLNEDYVVVVAGFQGISQQGEVTTLGRGGSDLSAVALAGALNATVCEIYSDVDGIYTT
DPRIVKNARKLEKISYDEMLELASMGAKVLLNRSVELAKKLNVNLICASSFSEAQGTLIT
KEEDIMEKPVVSGVALDKNQARVSLADVQDRPGIAADIFGLLADNNINVDMIVQTIGRDG
KTDIDFTIPKTEVTLTQQVLEKFKDDLGNIEYDNNIAKVSIVGVGMKSHSGVASTAFKAL
AQDDINIMMISTSEIKISMIINAQFAELAVCKLHSVYELDK
>Hpyl_Aa_|_CG-35
MLIVQKYGGTSMGSIERIHNVAQRVLESVKLGHQVVVVVSAMSGETDRLLEFGKNFSHNP
NKREMDRIVSAGEWISSAALSMALERYGHRAISLSGKEAGILTSSHFQNAVIQSIDTQRI
TELLEKNYIVVIAGFQGADIQGETTTLGRGGSDLSAVALAGALKAHLCEIYTDVDGVYTT
DPRIEEKAQKIAQISYDEMLELASMGAKVLLNRSVELAKKLSVKLVTRNSFNHSEGTLIV
AEKDFKGERMETPIVSGIALDKNQARVSMEGVEDRPGIAAEIFGALAEYRINVDMIVQTI
GRDGKTDLDFTIVKTQIEETKQALKPFLAQMDSIDYDENIAKVSIVGVGMKSHSGVASIA
FKALAKDNINIMMISTSEIKISVLIDIKYAELAVRTLHAVYQLDQ
>Sden-1_Aa_|_CG-35
MLIVQKFGGTSVGDLERIQNVASRVCETKKAGNDVVVVVSAMSGETNKLLAYAEHFSKNP
QRAEVDMLLSSGERVTASLLAIALSEMGCEAVSMTGRKAGIVTDNIHTKARIEEIDPTAM
NKAIKDGKIVVVAGFQGISQDGNVTTLGRGGSDLSAVAIAGAIKADLCEIYTDVSGIFTT
DPRIEPRAKKLDKISYDEMLELASLGAKVLQNRSVELAKKLNVNLVTRTSFSNEEGTLIT
KEENIMEKPLVSGIALDKNQARVSLVGVKDRPGIASDIFTKLSNNSVNIDMIIQNVGHDG
KANIDFTVPVNDLADAKKVMDSFVKESEVDEVSYDENICKVSIVGVGMKSHTGVAAKAFS
VMAAENININMISTSEIKISMIIAEKYAELAVRALHSAYELDK
>Wsuc_Aa_|_CG-35
MLIVQKYGGTSVGDLDRIQNVANKVAKTKKEGHRLVVVVSAMSGETDKLLGYAKHFSQIP
DPRELDMILSSGERVTSALLALALQAMGFKSISLSGRGAGMITDKSHSKARIDHIDTARI
DSLLEDDTIVVVAGFQGITPDGEVTTLGRGGSDLSAVALAGALKADLCEIYTDVEGVYTT
DPRIEPKAKKIDKISYDEMLELASMGAKVLLNRSVELAKKLNVNLITKSSFSDNPGTLIT
KEEEIMENPVVSGIALDKNQARVSITNVQDRPGIAAEIFGALAEANINVDMIVQTIGYDS
LTDMDFTIPKTELESAKLVLKRFEGSVGGIEFDDNIAKVSIVGVGMKSHTGVASKAFKAL
AQDNINIMMISTSEIKISMIINLKYAELSVRTLHATYELDK
>Gmet_Aa_|_CG-36
MALVVQKYGGTSMGSIERIRNVAKRVAKTYDAGNDMVVVVSAMSGETNKLVALANEVCEF
PDNREYDVLVASGEQVSIALLAMCLKSMGYKAKSYHGWQVPIITDSVFSKARIEEIPDAK
VRADLKDGTIVVVAGFQGIDKDGNVTTLGRGGSDTSAVAMAAAMKADVCEIYTDVDGVYT
TDPNICEDARKIDKISYDEMLELASLGAKVLQIRSVEFAKKYNVDIHVRSSFNDNQGTMV
TKEDKDMEAVLVSGIAYDKNEAKIAVLGVPDKPGIAAKILSSLSDANISVDMIVQNVSGG
DLTDFTFTVTKADFKKALAITKEIATEIKATGVSADESISKVSIVGVGMRSHAGVATKMF
QTLANEGINIQMISTSEIKVSVVIDAKYTELAVRVLHEAFGLSGK
>Gsul_Aa_|_CG-36
MALVVQKYGGTSMGSIERIRNVAKRVAKTYDAGNDMVVVVSAMSGETNKLVALANEICEF
PDTREYDVLVASGEQVSIALLAMCLKSMGYKAKSYHGWQIPIITDSAFSKARIESIDDTK
VRADLKDGSIVIVAGFQGVDKDGNITTLGRGGSDTSAVAVAAAFKADVCEIFTDVDGVYT
TDPNICQDARKIEKVSYDEMLELASLGAKVLQIRSVEFAKKYNVDVHVRSSFNENPGTMV
TKEDKDMEAVLVSGIAYDKNEAKIAVMGVPDKPGIAAKILSPLSDANISVDMIVQNVSGG
DLTDFTFTVTKADFKKALAITKEVAKEISAKEVAEDENISKISIVGVGMRSHAGVATKMF
QTLAKEGINIQMISTSEIKVSVIVDAKYTELAVRVLHEAFGLSGK
>Gura_Aa_|_CG-36
MALVVQKYGGTSMGSVERIRNVAKRVAKTYDAGNDMVVVVSAMSGETNKLVALANDICEF
PDNREYDVLVASGEQVSIALLAICLKSMGYKAKSYHGWQIPIITDNAYSKARIESIDDTK
IRADIKDGTILVVAGFQGVDKDGNITTLGRGGSDTSAVAMAAALKADVCEIFTDVDGVYT
TDPNICEDAKKIEKISYDEMLELASLGAKVLQIRSVEFAKKYDVDVHVRSSFNDNPGTMV
TKEDKDMEAVLVSGIAYDKNETKIAVMQVPDKPGIAAKILSPLSDANISVDMIVQNVSEA
GFTDFTFTVTKADFKKALAITKEVARDIDAKEVLTDENISKVSVVGVGMRSHAGVATKMF
QALAKEGINIQMISTSEIKVSVVVDAKYTELAVRVLHDAFGLSGKAA
>Pcar_Aa_|_CG-36
MALVVQKYGGTSVGDVDRIRNVARRVAKTYDDGNDVVVVVSAMSGETNKLVALANELCDF
PSEREYDVLVSTGEQVTIALLSMCLQSMGYKAKSYLGHQIPIFTDSTFSKARIESIDDKN
IREDLNNGTIIVVAGFQGIDHDGNLTTLGRGGSDTSAVAVAAALKADVCEIYTDVDGVYT
TDPRIVADATKIEKISYDEMLEMASLGAKVLQIRSVEFAKKYGVIVHVRSSFNDNPGTLV
TKEDEDMETVLVSGVTYNKDEAKISVMGVPDKPGVAAKLFTPLTTSNITVDMIIQNVSND
GLTDLTFTVPRGDFKKALKAVEETAREIGAAGVRSDENIAKVSIVGVGMRSHSGIASKMF
RVLSQEGINIQMISTSEIKVSCVIDAKYTELAIRVLHQAFGLDKKDSKAE
>Ppro_Aa_|_CG-36
MALVVQKYGGTSVGNPDRIRNVAKRVARTCDAGNELIVVLSAMSGETNRLVSLANEMCEL
PHGREYDTLVSTGEQVTIALLAMHLKSMGYKAKSYLGWQVPIITDDTATKARIERIEDAR
IRADLNEGTIVIVAGFQGIDANGNITTLGRGGSDTSAVALAAALKADVCEIYTDVDGVYT
TDPNICKEARKMESISYDEMLELASLGAKVLQIRSVEFAKKYNVNVHVRSSLNDNTGTMV
TRENKDMEGILVSGVAYDKNEAKIVVMGVADKPGTAARILSALSDASIPVDMIVQNVSQA
GLADFTFTVNKTDLKQAMQITNQVAGELQAREVISDEKISKISIVGLGMRSHAGVATTMF
SALAAANINIQTISTSEIKISVIIDDKYTELAVRVLHEAFNLQG
>Ccre_Aa_|_CG-37
MSRLVMKFGGTSVADLERIRRVARLVAAEVATGKQVAVVVSAMSGKTNELVAWTDGAGRA
AAGLPESDDEYDAVVASGEQVTAGLLAMTLRNMGHKARSFLGWQVPILTDEAHGRARIEE
IPPENLEECFANGEIAVIAGFQGVTPNRRITTLGRGGSDTSAVAIAAAVKGDCDIYTDVD
GVYTTDPRIESKARRLAKISYEEMLEMASLGAKVLQTRSVEMAMAHRVPVRVLSSFVEPG
EAPGQGTIVCDEEEIMEKRIVSGVAYSRDEAKITLLGLPDHPGVSSQIFGRLAEANVNVD
MIVQSRARSADTANMEFTVGKRDATRAVEIVQAAQKEIGFEAVAVNEDVAKVSVIGVGMR
SHAGVAQSMFQALAEKNINIQVISTSEIKISVLIDAAYTELAVRALHAVYGLDQL
>Bhen_Aa_|_CG-37
MARIVMKFGGTSVANIERIYNVAQHVKREVDAGNEVAVVVSAMAGKTNELVQWTCDASPI
HKDAYEYDVVVASGEQVTAGLLALTLQEMGVNARSWLGWQIPIHTDSAHGSARITDIDGS
FLIQRFQEGQVAVIAGFQGLAPDNRISTLGRGGSDTSAVAMAAAIQADRCDIYTDVDGVY
TTDPRVEPKARRLPKVAFEEMLEMASLGAKVLQVRSVELAMVHNVRTFVRSSFEDPNALG
MGDPMNSSGTLICDEDEIVEQQNVTGIAFAKDEAQISLRRLADRPGISAAIFGPLAEARI
NVDMIVQNISEDGSKTDMTFTVPSADVDKAVALLEKNRKEIGFDVIQSESGLAKISVIGV
GMRSHAGVAATAFRALAEKGINIQAITTSEIKISILIDSVYTELAVRTLHAVYGLDKG
>Bqui_Aa_|_CG-37
MARIVMKFGGTSVANIERIHNVARHIKREVDAGNEVAVVVSAMAGKTNELVQWTRDASPM
HKDADEYDVVVASGEQITAGLLALKLQAMGVNARSWLGWQIPIHTDNVHGSARITDINGS
FLIQRFQEGQVAVIAGFQGLAPDNRISTLGRGGSDTSAVAIAAAVQADRCDIYTDVDGVY
TTDPRIEPKARLLPKVAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFEDPDALG
MDDPINSSGTLICDEDEILEQQNVTGIAFAKDEAQISLRRLADRPGISAAIFGPLAEERI
NVDMIVQNISEDGSKTDMTFTVPSVDVEKAVTLLEKNRKEIGFDVLQFERNLAKVSVIGI
GMRSHAGVAATAFKALSEKGINIQAITTSEIKISILIDHAYTELAVRTLHALYGLDKG
>Bjap_Aa_|_CG-37
MSRLVMKFGGTSVANIERIRNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPM
HDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKTSDAHASARIEDIDGSE
IIKRFRDRKEVAVIAGFQGINPETNRITTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGV
YTTDPRIVPKAKRLGKIAFEDMLELASQGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
DPHANQPPGTLICSEEEIMESHVVTGIAFSKDEAQISVRQIEDKPGVAASIFGPLADANI
NVDMIVQGVSEDGKTTDLTFTVPAADFTRARDTITAAKGKIGYARLDTATDVAKISVIGS
GMRSHAGVAAQAFSALAGRNINIRAITTSEIKFSVLIDTAYTELAVRTLHTLYGLDQA
>BRAD-1a_|_CG-37
MGRLVLKFGGTSVANIDRIRNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPM
HDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKTSDAHASARIVDIDGSE
LIQRFQERKEVAVIAGFQGINPATNRITTLGRGGSDTSAVAIAAAIKADRCDIYTDVDGV
YTTDPRVVPKAKRLDKIAFEDMLELASQGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
DPHAKQPPGTLICSEEQIMENHVVTGIAFSKDEAQISVRQIEDKPGIAASIFGPLADANI
NVDMIVQNVSEDGKTTDLTFTVPATDYNRARETIAAAKDKIGYQRLDTATDVAKVSVIGS
GMRSHAGVAAKGFAALAARNINIRAITTSEIKFSVLIDAVYTELAVRTLHTLYGLDQA
>Nham_Aa_|_CG-37
MSRLVMKFGGTSVANLDRIRNVARHVKREVDAGHDVAVVVSAMAGKTNDLVAWCRDASPM
HDAREYDAVVASGEQITSGLLAIALQALGIQARSWQGWQIPIRTSDAHASARILGIDGSE
LVNRFTERKEVAVIAGFQGINPQTGRITTLGRGGSDTSAVAIAAAIHADRCDIYTDVDGV
YTTDPRVVPKARRLDRIAFEEMLELASQGAKVLQVRSVELGMTQNMPIFVRSSFDKPEDI
DPHGTPPGTLICGEEEIMESHVVTGIAFSKDEAQISLRQIEDKPGVAASIFVPLADANIN
VDMIVQSVSEDGKTTDLTFTVPAADYARARETITRAKDKIGYARLDSATDLAKISVIGSG
MRSHAGVAAQAFKALSEKSINIRAITTSEIKFSLLIDTAYTELAVRTLHTLYGLDHT
>Nwin_Aa_|_CG-37
MSRLVMKFGGTSVANLDRIRNVARHVKREVDAGHDVAVVVSAMAGKTNELVAWCRDASSM
HDAREYDAVVASGEQITSGLLAIALQALGIQARSWQGWQIPIRTSDAHASARILEIDGSE
LISRFTERKEVAVIAGFQGISPQTGRITTLGRGGSDTSAVAIAAAIRADRCDIYTDVDGV
YTTDPRVVSKARRLDRIAFEDMLELASQGAKVLQVRSVELGMTQNMPIFVRSSFDAPEEI
DPHGTPPGTLICGEEDIMESHVVTGIAFSKDEAQISVRQIEDKPGVAASIFVPLADANIN
VDMIVQNVSEDGKTTDLTFTVPASDHARAKETITRAKDMIGYARLDSATDVAKISVIGSG
MRSHAGVAAQAFKALSDKGINIRAITTSEIKFSLLIDTAYTELAVRTLHTLYGLDQT
>Rpal_Aa_|_CG-37
MGRLVMKFGGTSVANIERIQNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPL
HDAREYDAVVASGEQVTSGLLAIALQSLGIQARSWQGWQIPILTSDAHASARIVGIDGSE
IIKRFSERKEVAVIAGFQGIHAETGRITTLGRGGSDTSAVAIAAALKADRCDIYTDVDGV
YTTDPRVVPKARRLDKVSFEEMLELASLGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
DPHGTPPGTLISSEENSMENHVVTGIAFSKDEAQISVRRIEDKPGVAASIFGPLADANIN
VDMIVQNVSEDGKTTDLTFTVPASDFARAKQTITSAQDKIGYARFDSETDVAKVSVIGSG
MRSHAGVAAQAFAALAARNINIRAITTSEIKFSVLIDAAYTELAVRTLHTLYGLDQV
>Babo_Aa_|_CG-37
MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFT
DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
LDK
>Bmel_Aa_|_CG-37
MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFT
DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
LDK
>Bsui_Aa_|_CG-37
MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVFQVRSVELAMVHKVRTFVRSSFT
DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
LDK
>Mlot_Aa_|_CG-37
MARIVMKFGGTSVADIARIRNVARHVKREVDAGHEVAVVVSAMAGKTNELVGWTREASPM
HDAREYDAVVASGEQVTAGLLAITLQNMGVHARSWQGWQIPIKTDNAHGAARILDIDGAF
LIKRFGEGQVAVIAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYTDVDGVYT
TDPRIEPKARRLAKISFEEMLEMASLGAKVLQVRSVELAMVHRVRTFVRSSFDDPDAPGM
GDLLNPPGTLICDEEEIVEQQVVTGIAYAKDEAQISLRRVGDRPGVAAGIFGPLAEANIN
VDMIVQNISEDGKFTDMTFTVPSGDVDKALAVLDRLKAEVGYDVVQSEAGMSKVSVIGIG
MRSHAGVAATAFKALADKAINIRAITTSEIKISILIDGPYTELAVRTLHSVYGLDKQ
>MESO-1a_|_CG-37
MARIVMKFGGTSVADLDRIHNVARHVKREVEAGHQVAVVVSAMSGKTNELVGWVQGMPKA
AGAKSPFYDAREYDTVVASGEQVTSGLLAIALQSIGIDARSWQGWQIPIRTDNAHGAARI
TDIDGSDIIERMERGQVAVVAGFQGLAPDNRVATLGRGGSDTSAVAVAAALRADRCDIYT
DVDGVYTTDPRIEPRARRLAKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDFDNPPGTLICDEEEIVEQQVVTGIAYAKDEAQISLRRVADRPGVSAGIFGP
LAEANINVDMIVQNVSEDGSKTDITFTVPTGDVEKALSVLEKVRGTVGFDAIQSEAGLVK
VSVIGIGMRSHAGVAATAFSALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHSVYG
LDKH
>Atum_Aa_|_CG-37
MVLVKAMARIVMKFGGTSVANLERIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVDWV
QNAAKVAGTNAASFYDAREYDAVVASGEQVTSGLLAITLQSMGINARSWQGWQIPIRTDN
AHGAARILEIDGSDIVHRMGEGQVAVVAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKA
DRCDIYTDVDGVYTTDPRIEPKARRMKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRT
FVRSSFEDPDAPGMGDLINPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRVADRPGV
SAAIFGPLAEAHINVDMIVQNISEDGSRTDMTFTVPSGDVAKALRVLDENKGQIGFDVAQ
NETGLAKVSVIGIGMRSHAGVAASAFKALAEKNINIKAITTSEIKISILIDGAYAELAVR
TLHSAYGLDKA
>Retl_Aa_|_CG-37
MARIVMKFGGTSVADLDRIKNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVQGTPKV
IGANSPFYDAREYDAVVASGEQVTSGLLAIALQAMDINARSWQGWQIPIRTDNAHGAARI
LEIDGSDIIKRMGEGQVAVIAGFQGLGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYT
DVDGVYTTDPRIVPQARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDLLNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
LAESHINVDMIVQNISEDGSKTDMTFTVPSGDVEKAIKVLGDHKEKIGYDVVQNESGLVK
VSVIGIGMRSHAGVAATAFRALAEKGINIKAITTSEIKISILIDGPYAELAVRTLHSCYG
LDKN
>Rleg_Aa_|_CG-37
MARIVMKFGGTSVADLDRIKNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVQGTPKV
IGANSPFYDAREYDAVVASGEQVTSGLLAIALQAMDINARSWQGWQIPIRTDNAHGAARI
MEIDGSDIVKRMGEGQVAVISGFQGLGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYT
DVDGVYTTDPRIVPKARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDLLNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
LAESHINVDMIVQNISEDGSKTDMTFTVPSGDVEKAIKVLGDHKEKIGYDVVQNESGLVK
VSVIGIGMRSHAGVAATAFRALAEKGINIKAITTSEIKISILIDGPYAELAVRTLHSCYG
LDKN
>Smel_Aa_|_CG-37
MARIVMKFGGTSVADLNRIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVENMPKV
AGSNAPFYDAREYDAVVASGEQVTSGLLAIALQSMGINARSWQGWQLPIKTDNAHGAARI
LEIDGADVIRRMGEGQVAVVAGFQGLGPDNRLATLGRGGSDTSAVAIAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDLMNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
LAEAHINVDMIVQNISEDGSKTDMTFTVPSGDVDKALRVLGDNKEKIGYDVIQSESGLVK
VSVIGIGMRSHAGVAASAFRALADKGINIKAITTSEIKISILIDGPYAELAVRTLHSVYG
LDKS
>Hnep_Ab_|_CG-37
MARTVLKFGGTSVGDLDRIANVAEIVAARAAKGEKMAVIVSAMSGETNKLVALADGAAGK
DLPRSLYDDEYDVVVASGEQVTAGLLALALRRRGLKARSWLGWQLRLKTDNSHGRARIMG
FDDSSLPDSIDSGEIAVVAGFQGVTDDFRVTTLGRGGSDTSAVAVAAALGAQVCDIYTDV
DGVYTTDPRIVPKARRIDKISYEEMLEMASLGAKVLQTRSVELAMNHGVPVRVLSSFVKP
GEESPGTLVCSEEEIVEKQVVSGVAYSRDEAKVTLYGVPDKPGSSAKIFSALARAGVNVD
MIVQASSREASKANLVFTCTDRDSPFARETLEGLQAEVGYDRIEVIRDVSKISIIGVGMK
SHTGVAEKMFTALSEKSINIDVIATSEIKISVLIAAPYTELAVRALHTAFGLDAD
>JANN-1a_|_CG-37
MPLLVMKFGGTSVATLDRIRRAAKRVGREVANGYDVIVIVSAMSGETNKLVGFVEETGPF
YDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPLLTTDAHASARIEEIPTDN
LNAKFGEGMKVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAASFGAERCDIYTDVDGVY
TTDPRITTKARKLDKISFEEMLELASLGAKVLQTRSVELAMRYRVRLRVLSSFEEMSDNA
GTLVCAEEDIVEKNVVAGVAYSRDEAKMTLQSVEDRPGIAAAIFGPLAEAGVNVDMIVQN
ISDGGITDMTFSCPVGEVARAEKAMGDAKASGDIGFASLIADTDVAKVSIVGIGMRSHAG
VAAKMFQTLRDEGVNIKVITTSEIKVSVLIDRKYMELAVQALHDAFGLEKAA
>Pden_Aa_|_CG-37
MPLLVMKFGGTSVADLDRIKNAALKVQREVERGYDVIVIVSAMSGKTNELVGWVEATSPL
FDAREYDAVVASGENITAGLMALTLQELGVPARSWQGWQVPINTTSQHSAARFVSIPRDN
IDQKFAEGMRVAVVAGFQGLGSDNRITTLGRGGSDTTAVAFAAAFGAERCDIYTDVDGVY
TTDPRITSKARKLKKIAFEEMLELASLGAKVLQTRSVELAMRYKVRLRVLSSFEETDENS
GTLVCDEDEIMESKVVNGVAYSREEAKITLVTVEDRPGISAAIFAPLAEAGVNVDMIVQN
ISEKDYEDHPGSVTDMTFSCPVNQVARARKAMEDAKAAGHIAYDDLVVDTEVAKVSVVGI
GMRSHAGVAARMFKALADENINIKVISTSEIKISVLIDRKYMELAVQALHDAFELEKP
>Rsph_Aa_|_CG-37
MPLLVMKFGGTSVADLARIKNAAQKVKREVERGYDVIVIVSAMSGKTNELVGWVEQTSPL
FDAREYDAVVSSGENVTAGLMALTLQEMEVPARSWQGWQVPIRTTSQHSAARFLEIPREN
LDAKFAEGFKVAVVAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFAAERCDIYTDVDGVY
TTDPRIASKARKLEKIAYEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEDTDETS
GTLVCDEEDIMESKVVSGVAYSRDEAKMTLVTVEDRPGVAAAIFGPLAEAGVNVDMIVQN
ISEKDYGSHPGSVTDMTFSCPINQVARARKALEDAKAEGTIVYDDLVVDTEVAKVSVVGI
GMRSHAGVAATMFKALAADGVNIKVIATSEIKISVLIDRKYMELAVQALHDAFALETAN
>Rden_Aa_|_CG-37
MPVLVMKFGGTSVATLDRIRRVAKRVGVEVAKGYDVIVIVSAMSGKTNELVGWVNEISPL
HDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPVRTTNAHSSARIEEIPTEN
IRAKFAEGMRVAVVAGFQGLSPEGRITTLGRGGSDTTAVAFAAAFEAERCDIYTDVDGVY
TTDPRVSAKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDTA
GTLVCDEEEIMESNVVAGVAFSRDEAKMTLLSVADRPGIAANIFTALSDAGVNVDMIVQN
IAEEGRTDMTWSCPTDHVARAQKAVENAKSEGVINYHEVIADLDVAKVSVVGIGMRSHTG
VAAKMFQVLSAEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELEKAA
>Spom_Aa_|_CG-37
MPTLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYDVIVIVSAMAGKTNELVGWVNETSPL
FDAREYDAVVSSGENITAGLMALTLQEMDIPARSWQGWQVPLMTNSAHSQARIEEIPPHN
INQKFAEGMKVAVIAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFEADRCDIYTDVDGVY
TTDPRICTKARKLEKISFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDTA
GTLVVDEEEIMESNVVSGVAYSRDEAKMTVVSVQDRPGVAATIFNALSEGGVNVDMIVQN
VSEEGITDMTFSCPTDQVARAEKAMNAVKDAGELEFEDLLVDYDVCKVSVVGIGMRSQSG
VAAKMFKILSDEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELDKAA
>SILI-1a_|_CG-37
MPLLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYDVIVIVSAMSGKTNELVGWVGETSPL
YDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPLKTNSAHSQARIEEIGTEN
INQKFGEGMKVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAAAFGAERCDIYTDVDGVY
TTDPRICEKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDEA
GTLVCDEEEIMESNVVNGVAYSRDEAKLTCLSVADRPGIAATIFGCLSDAGVNVDMIVQN
ISEDGRTDMTFSCPTDQVQRAEMALNAYKEKGELNFAELVADTGVAKISVVGIGMRSQSG
VAAKMFKVLSDEGINIKVITTSEIKISVLVDRKYMELAVQALHDAFELDKAS
>Acry_Aa_|_CG-37
MARIVMKFGGTSVADLDRIRNVAARVKRVVDEGHEVAVVTSAMAGATNQLVAWCQELSPL
YDAREYDTVVATGEQVTIGLLAVALQTIGVDARSWTGWQIPIRTDGQHGKARIDAIDGAE
LIRRMQMGQVPVIAGFQGIGPDNRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVPKARKLPAIAYEEMLELASVGAKVLQTRSVELAMKERVRVQVLSSFTDAPGTLV
VDEDEIVEQEIVAGIAYSRDEAKVTVRRVPDRPGVAASVFGPLAEAGINVDMIVQNVSAD
GTTDMTFTLNKTELPRARLVLDEKRDEIGFAELATDPDVAKISVVGVGMRSHAGVAGTMF
RSLAARGINIQVISTSEIKVSVLIDAEYTELAVRALHTAYGLDVA
>Goxy_Aa_|_CG-37
MSLPYPMPDPSAQRQTRTGALSAMSMPDTPVHDQVSGRADPHAAIKGESGKRKTVVMKFG
GTSVGNIERIRNVAKRVKAEHDRGRRVAVVVSAMAGVTNRMVGYCAELDPLADPKEYDAV
VAAGEQVTSGLVSIALQALGVKARSFQGWQIPLVTDDAHGKAAIESVDGTALLACLDDDV
VPVVAGFQGVGPDGRIATLGRGGSDTSAVAVAAAINADQCDIYTDVDGIYTTDPRIVKRA
KKLDRITYEEMLELASVGAKVLQTRSVGLAMREGVRVRVLSSFAETDDDSGSIVVDEDEI
MEKELVAGIANSHDEAKISVRNIPDRPGIAAAIFDPLAAANINVDMIVQSVGVDNMTNMT
FTVSKADEAAARAVLEKAREYVQYGELITSHNVVKISVVGIGMRSNAGLAARMFRTLADR
GINVQVISTSEIKISVLIDSEYTELAMRALHTAYGLDAKEGADA
>Gbet_Aa_|_CG-37
MARIVMKFGGTSVGDLDRIRNVARLVKREVDAGNEVSVVVSAMSGVTNQLVGYCQSLSPL
HDAREYDTVVATGEQVTTGLLSIALQEAGVDARSWLGWQLPIRTDNAHGKARIESIEGGE
LINRMQAGQVPVVAGFQGIGPDHRITTLGRGGSDTSAVAVAAAVRADRCDIYTDVDGVYT
TDPRIVARARKLDRISYEEMLELASVGSKVLQTRSVELAMKERVRVRVLSSFADPEGENV
GTLVVDEDEIVEKEIVSGIAYSRDEAKITVRRVPDRPGVAAHVLGPLTEANVNVDMIVQN
VAEDGTTDMTFTVGTSDLPRAQAALSAAQVEIGFAEMSADPQVCKISVVGVGMRSHVGVA
TTMFRTLAEKGINIQVISTSEIKVSVLIAEEYAELAVRALHTAYGLDAA
>Mmag_Aa_|_CG-37
MARIVMKFGGTSVADIERIKNVANRVKREFDAGNQVAVVVSAMSGATNQLVAWCNQVAPL
HDAREYDAVVATGEQVTTGLLAIALQELGVNARSWCGWQLPIRTDGVHGKARIMSIETDE
MIARMGKGEVAVVAGFQGLGPDNRIATLGRGGSDTSAVALAAALHADRCDIYTDVDGVYT
TDPRIVSVAKKLDKITYEEMLELASVGAKVLQTRSVEMAMKHRVRVQVLSSFEDKPGTLV
CDEDEIVEKELVSGIAYSRDEAKITLVRVADRPGVAASIFGPLAEAAVNVDMIVQNVSED
GKSTDLTFTVGNADLERAKKVLEDAKGNLGFEKLLADPNVVKVSVIGVGMRSHAGIAQKM
FQTLASEGINIQVISTSEIKISVLIEEKYTELALRALHTAYGLDAA
>Rrub_Aa_|_CG-37
MARIVMKFGGTSVGDVDRIRNVARRVKAEVDAGNEVAVVVSAMSGETNRLVGFCDSMTNM
YDAREYDAVVATGEQVTIGLLAIALQDIGVEARSWMGWQIPIHTDEAHGKARILSIDTTV
LEQRLASGQVAVVAGFQGLGPNNRVTTLGRGGSDTSAVALAAALKADRCDIYTDVDGVYT
TDPRIVPKARKLDRITYEEMLEQASLGAKVLQTRSVEMAMKHRVRVRVLSSFSDAPGTLV
CDEDEIVEKELVSGIAYSRDEAKITLVKVSDRPGVAARIFGPLADANINVDMIVQNVSED
GHSTDLTFTLPRSDLARALKVLEGARDDINYRELTTSSAVVKVSVIGVGMRSHAGVAQTM
FRALSEKGINIHVISTSEIKVSVLIAEEYMELAVRALHSAYGLDAA
>Elit_Aa_|_CG-37
MKFGGTSMAGTERIRRVANIVRKQAAGGDEVAVVVSAMAGETDRLVNFCREANALYDPAE
YDVVVASGEQVTSGLLALTLQSLGCKARSWLGWQLPVHTVEAHAKARIEDIENDALLESM
RGGTIAVIPGFQGLSDDGRITTLGRGGSDTSAVAVAAAIDADRCDIYTDVDGVYTTDPRI
VARARKQKAVTYEEMLELASVGAKVLQTRSVGLAMKEGVRVQVLSSFVDDDATPADDLPG
TMIVSEEEMDRILEEGDMERQLVTGIAHDKNEAKIILTRVPDKPGAVAHIFEPLAAASIN
VDMIIQNVGRDKGETDVTFTVPQADLARAQALLEDRREEIGFNRIITDSQIAKISVVGVG
MKSHAGVASTMFRALSDRGINIQAISTSEIKVSVMIDEDETELAVRVLHTAYGLDAEDAA
>Naro_Aa_|_CG-37
MARIVMKFGGTSMAGTERIRRVARIVQRQQAAGHEVAVVVSAMAGETDRLVNFCREANPL
YDPAEYDVVVASGEQVTSGLLAMHLQALGCKARSWLGWQLPIHTDDAHSKARIEGIDSEA
LLASMGAGEIAVIPGFQGLTADNRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVAKARKLKNVTYEEMLELASVGSKVLQTRSVSLAMKEGVRVQVLSSFIDDDAPAA
DTIPGTMIVSDEELEGLDMERQLITGIAADKNEAKVTLTRIADRPGAVAAIFGPLAAANI
NVDMIIQNIAKDKGETDVTFTVPISDLARTQALLEERKDTIGYYRMLANSKVAKISVVGV
GMRSHAGVASTMFRALADRGINIQAITTSEIKVSVLIDEDETELAVRVLHTAYGLDGE
>Swit_Aa_|_CG-37
MARIVMKFGGTSMAGIERIRNVANRVKHEVELGNEVAVVVSAMSGETDRLVNFCREASPL
YDPREYDVVVASGEQVTSGLLAIVLQSLGVKARSWLGWQLPIRTSDAHASARIETINSEA
IGKAMAAGEVAVIPGFQGMTGDDRVTTLGRGGSDTSAVAVAAAMKADRCDIYTDVDGVYT
TDPRIVPKARKLAKVTYEEMLELASVGAKVLQTRSVGLAMKEKVRLQVLSSFDQPTDNPT
PGTMIVGEEEIEGTTMERQLITGIAYDKNETKVTLTAVPDRPGAVASIFAPLADANINVD
MIVQNVAHDTGSTDVTFTVPTAELARSLDVLERERGTIGYEKLIHDTNVAKISVVGVGMR
SHAGVASKMFDALAARGINVLAITTSEIKVSVLINEDYTELAVRVLHTAYGLDAEDAA
>Sala_Aa_|_CG-37
MARIVMKFGGTSMAGTERIRTVARLVAREVADGNEVAVVVSAMAGETDRLVGFCREANPR
YDPAEYDVVVASGEQVTSGLLALTLQAMGVPARSWLGWQLPIRTEEAHARARIADIDTGA
LGAAMAKGEVAVIPGFQGMMDDGRISTLGRGGSDTSAVAVAAAIKADRCDIYTDVDGVYT
TDPRIVARARKLDYVTYEEMLELASVGAKVLQTRSVGLAMKMGVRVQVLSSFVEGDEAPK
KGTMIVSDEEIEEHQMERQLITGIAHDKNEAKIIVTRVPDRPGAVANIFGPLAAAGINVD
MIIQNVGREKGETDVTFTVPGADLLRSIDLLESAKDKIGFNRVISDDKVAKVSVVGVGMK
SHAGVASTMFRALADRGINIQAISTSEIKVSVLIDEDETELAVRVLHTAYGLDAE
>Zmob_Aa_|_CG-37
MARIVMKFGGTSVAGLERIRNVARRVQKEVEDGNEVAVVVSAMSGETDRLVGFCREAAPL
YDPAEYDAVVSSGEQVTSGLLAIVLKSMGVKARSWFGWQIPIHTTDAYANSRIESIDTER
LIKAMSSKEVAVVAGFQGVSDEGRVTTLGRGGSDTSAVALAAALDADRCDIYTDVDGVYT
TDPRIVSRARRLDRVTYEEMLELASVGAKVLQTRSVGLAMKAKTRLRVLSSFGDPDLSPE
GGTLIVSEDEIKENTMERQIITGIAYDKSEAKVTLTGVPDKPGAVAQIFSLLADANIHVD
MIVQIAYEGHITDVTFTVPKAQLSQVLDILEKGKEKIGFQKALKNDNVCKVSIVGVGMRS
HPGVAATMFDALAKRGINILAITTSEIKVSVLIDDAYTELAVRVLHTAYGLDADNKPVEE
AIA
>Amar_Aa_|_CG-38
MGRILVKKFGGTSLKDVECILRVANIVRQSVERGHKLVVVVSAMGRFTDEAVTTAQEVSE
LASEAQLSEYDVVVSSGEQVSCGLLALALQRIDIKATSIMGWQIPINTTGEHSRARIIEI
KPDRILSLLNEHDVVIVAGFQGIHNARITTLGRGGSDISAVAIAAALRLDACYMYTDVAG
VYTANPCLVPSARKLDHVTYNDMVEISASGRAILNVRSVEMAMRCGVRIHVMSSSQEAKG
TLVSFGCEREMESRIITGIAISKKIASVSLGGVPAVPGIAAALLPIAEGNIDVDMIMQTV
DGELRNITFTVQEEDLQKTQDILLQHKHNILYESLAVTDSLAKVSLVGACMISRPGVASR
VFSALASGGIAVLAVSTSEIKITVLMHEQSAAPALSLLHEEFALDRESVLCT
>Ecan_Aa_|_CG-38
MERILVKKFGGTSLQDIKCINKVVEIIKQDINNNYKVVVIVSAMGKFTDNIISQIKQISD
VKSPSERSEYDLIISSGEQISCGLLSLALQKVGINAQSWLGWQLPIVTTEDHTKARIIDI
NVNSLQDSLANNDVAIVAGFQGMHKNNRVTTLGRGGSDTSAVAIAVALGVDLCYIYTDVD
GIYTADPNLVPKAHKLDYITYDEMIEMSSLGAKVLQVRSVEIAMKYNIKLCILSTFNPGK
GTMLCKKGESHMESQLITGVTCNNKTASITLKQVKTLSGITTVFNAIAEKNINVDMIIQN
MNDNNANDITFTISEEDLPTTKKFLTEIQSELMYQDLIINSEVAKVSIIGVGMISHSGIA
YKMFDTLTSNNIKILAVTTSEIKISVLIYRKDSQLATVALHSAFELDSTESNLYTIS
>Echa_Aa_|_CG-38
MKRILVKKFGGTSLQDIECINRVAEIIKQDVNNNYKVVVVVSAMGKFTDNIISQIKQISD
VKSQSERSEYDLIISSGEQISCGLLSLALQKIGINAQSWLGWQLPIVTTEDHTKARIIDI
NTCSLQDSLANNDVAIVAGFQGMHKNNRVTTLGRGGSDTSAVAIAAALKVDLCYIYTDVD
GIYTADPNVVPKARKLDYITYDEMIEMSSLGAKVLQVRSVEIAMKYNIKLCILSTFNPGK
GTILRKKGESDMESQLITGVTCNNKTASITLKEVKAISGVTTVFNAIAEKNINVDMIIQS
VNDNNANDITFTISEEDLPTTTKFLTEIQTELMYQDLIINSEVAKVSIIGVGMISHSGVA
YKMFDTLTSNNIKILAVTTSEIKISVLISRKDSQLATIALHSTFGLDNTESDLHIIS
>Erum_Aa_|_CG-38
MTKILVKKFGGTSLQNIKCINQVTEIIKQDVCSNHKVVVIVSAMGKFTDNIISQIKKISD
VKSYNELSEYDLIISSGEQISCGMLSLALQKLGIKAQSWLGWQLPIVTTDDHTKARIMEI
NTSALQDFLANNDVAIIAGFQGMHKENRVTTLGRGGSDTSAVAIAAALGIDLCYIYTDVD
GIYTSDPNIVPKARKLDYIAYDEMIEMASLGAKVLQVRSVELAMKYNIKLHVLSTFNSIK
GTILCKKGEIKMESQLITGITYNSNTASITLKKVRALFGITTLFSIIADNGINVDMIIQN
MDNNANDITFTIPEEDLSITETLLIKTKDKLMYEELIINPDVAKVSVIGVGMISHPGIAY
KMFDTLTSNNITILAVTTSEIKISVLVLRKDGQLATQYLHSSFKLDSQSNLHTTS
>Otsu_Aa_|_CG-38
MNIIVQKFGGACVSDTAKIANLVTKVQREIDASNKVIVVVSAMAGITKKLISFCYNLNSE
LYTPETLAEYDSALSSGEIMTASLFALALQQKSIKSRSLHSWQIPIKTNNYHSKAIIIDI
NTNLIHDMLLQGIVPVISGFQGITNHNRITTLGRGGSDITAVAIAAALQAKRCDIYTTVD
GVFSADPELIPQACKHDKITYTEMLELASLGSRVVHYRAVQMGMRYNVPIKVIHAFGKGQ
GTIIQEITTMEQPQITGITYNKDIILVTICINDNKQFFLVINHMLKYSVSIEQITNYQLN
KVSIIIPLSDLTASKKAFDELQNQCIINSYQINNVASVSVVGYAIKYNPSIFQQITMVLS
KFEVQILGILALEARISIILNKIDVEPIVAELHHHLISTASSAI
>Rbel_Aa_|_CG-38
MALIIQKFGGTSVTTIDRIKKIIPIIKAEIAKNNQVIIVVSAMAGVTNQLVTLCNEVSSL
NKSSQLAEYDVALSSGEIVTASLLALALQEENINARSFLAWQLPILTDDNHSKALVESVD
TNLLNECLQQNIIPIIAGFQGINKHNRLATLGRGGSDTTAALIAAAMKADRCDIYTDVEG
VFAADPRIIPKAKKIDEIDFSEMLELALSGAKVLHSRAAEIVMRYQIDMRILSTFAPEAG
CTLITSKDKIMEKRIISGITSNKNLLYITIESSSLNFIQVASIIAQNNNHIEVMQEIEPN
KRYSFITNLTDKNSLHILLTNLKNNNQISNFTFDTEIATVSIIGHGIKNDLKLLEVILSK
LAKDNINVQMVQISEIKIILLINDKQVEKTVLDLYDLLKISETGHC
>Rcon_Aa_|_CG-38
MALIIQKFGGTSVANIDRIKKIVPIIKTEIAKNNQVIVVVSAMAGVTNQLVTLCNELSSL
NNISQFAEYDVALSSGEIVTASLLALALQEEDIKARSFLAWQLPMLTDNNHSKALVESIT
TDLLEKYLQLNTIPIIAGFQGINKSNRLTTLGRGGSDTTAALIAAAMKADRCDIYTDVEG
IFTADPRIIPNAKKIKEIDFLEMLELASSGAQVLHPRAGELVMRYKIDMRVLSTFSPDTE
GTLITSKDKNMENGIINSITSNKNLLKISVKSMSLSFLQVANMITQNNNHIEFMQEIKNN
EEYSFITNLTDKNNLQALLTNLKDDKQIQYFTFDTEIATISLIGYGIKNDCKLLETILSK
LTNDNINVHMIQLSEVKITLFINDQDTEKTIFNLYNLFKIS
>Rfel_Aa_|_CG-38
MALIIQKFGGTSVANIDRIKKIAPIIKAEIAKNNQVIVVVSAMAGVTNQLVTLCNEVSSL
NNISQFAEYDVALSSGEIVTASLLALALQEEDIKAQSFLAWQLPILTDNNHSKALVESIT
TDLLEKYLQLNTVPIIAGFQGTNKSNRLTTLGRGGSDTTAALIAAAMKAKRCDIYTDVEG
IFTADPRIIPNAKKIKEIDFLEMLELASSGAKVLHPRAVELVMRYKIDMRVLSTFSPNTE
GTLITSKDKNMENGIINSITSNKNLLKISVKSISLSFLQVANMITQNNNHIEFMQEIKNN
EEYSFITNLTDENNLQALLTNLKNDKQIQDFTFDAEIATISLIGYGIKNDCKVLEMILSK
LTKDNINVNMIQLSEVKITLLINDQDAEKTIFNLYNLFKIS
>Rpro_Aa_|_CG-38
MALIIQKFGGTSVANVERIKKLVPIIKAEIAKNNQVIVVVSAMAGVTNQLVTLCNEVSSL
NKRSQFAEYDVALSSGEIVTASLLALALQEEEIKAQSLLAWQLPIRTNNNYSKALVEFIT
TDLLEKYLQLKIIPIIAGFQGINKSNRVTTLGRGGSDTTAALIAAAMKADRCDIYTDVDG
IFTADPRIIPNAKRIKEIDFLEMLELASSGAKVLHPRAVELVMRYKIDMRVLSTFSPNTE
GTLITSKDTIPLVKSTYMEESALNTKHSTKIDIPEDASGSTYKLPIELALQNRYNMENCV
VRCITSNKNLLKVSVNSISLSFLQVANMITYNNNCIEFMQEIENNIEYNFITNLTDKNNL
QTLLTKCKNNKQIQDFTFDTEIATISLIGYGIKNDCKLLTMILSQLTQDNINVHMMQLSE
VKITLLINDKDVEKTIFNLYNLFKIS
>Rtyp_Aa_|_CG-38
MALIIQKFGGTSVANIERIKKLVPIIKAEITKNNQVIVVVSAMAGVTNQLVTLCSEVSSL
NKISQFAEYDVALSSGEIVTAALLALALQEEEIQAQSLLAWQLPILTNNNHSKALVEFIT
TDLLEKCLQLKIIPIIAGFQGINKSNRITTFGRGGSDTTAALIAAAMKADRCDIYTDVDG
IFTADPRIIPNAKRIKEIDFLEMLELASSGAKVLHPRAVELVMRYKIDMRVLSTFLPNTE
GTLITSKDTTPLVKSTYMDMEESAKNIKRSTKINIPDDTSGLTYKLPIELALQNRYNMEN
CIIRGITSNKNLLKVSVNTITLSFLQVANMITYNNNCIEFMQEIKNNIEYNFITNLTDKN
NLQTLLTNCKNNKQIQNFTFDTEIATISLIGYGIKNDCKLLEMILSQLTQDNINVNMMQL
SEVKITLLINDKDVEKTISNLYNLFKIS
>Wend_a_|_CG-38
MDKIIIKKFGGTSLTDLNRVANLIKNDIEKGCNVIVVVSAVAGFTDQMVFQARQISNLSY
RQELSEYDVMLSAGEQISCGLLAITLQSIGVNAKSWLAWQLPIVTDDFYSESKIKTIKIE
RVKRSFAEGYTAAIIAGFQGINDDRITTFGRGGSDISAVAFAVAFGVRTCEIFTDIDGIY
TADPRIVPKARKLKFISYDEMLEMSSSGAKILHNRSVQLAMKHNIKVQVLSTFKEVEGTT
VLHKRDVLERYLITGITYSTNEALVTFTNLANNLRTLRDIAGANVKIDMIHGSSFVISKF
DIDLMEKLLNKNENYAINDNVAKISIIGIGVMSNTEVMHRTLKVLSEKKIEILAITTSEI
KISIIVQKECAVALVKDLHTEYELDMQH
>Sama_Aa_|_CG-39
MTKIYVKKFGGTSVGTFERIEAVADAIAKAHFEGERQVLVLSAMAGETNRLYAMAANIDP
LAPARELDMLVSAGEQVSIALMSIALARRGVNARSLLGSQVKVRTNSQFGRASIESVDTG
LLMQLLDEGAVPVIAGFQGVNEQGDVTTLGRGGSDTTAVAIAAALEAAECQIFTDVTGVF
TTDPNIDPDAQKLDSISFEAMYEMARQGAKVLHPDSVACARRHGVVLRVLSSFESGSGTL
IRFDEPEHSGSGIVGIAVTRGQGLVSVAGLVDQPQAEVALFQALANASVDTDLVVQLAEE
KALAFTLAQGALDKVLTLIDRLALEQPLADVRHESPLAKVSLVSTGKAVMAEVGARVTEL
LEAQNIRVKLLSTSEIKLSVVIDEVHLQHAVRSLHRAFDLNKV
>Sbal_Aa_|_CG-39
MPQKRKLSGSKLFVKKFGGTSVGSIERIEAVAEQITKSAHNGEQQVLVLSAMAGETNRLF
ALAAQINPRASARELDMLVSTGEQVSIALMSMALQRRGIKAKSLTGDQVQIHTNSQFGRA
SIERVDTEYLQSLLADGVVPIVAGFQGIDPQGEVTTLGRGGSDTTAVALAAALEADECQI
FTDVAGVFTTDPNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAERFRVPLRVLSS
FEAGQGTLIQFGDESELTIASLVQGIAINKALATLTIEGLFTTSERYQALLGCLTRLEID
VEFISPLRIHEDDPSGRVSFMLAEAKVDTLLNELEGLSESLALGPLIIERQRAKVSLVGK
GLQAKMGLLTKMLEVLGNETIHAKLLTTSESKLSTVIDERDLHKAVRALHHAFELNKV
>Sone_Aa_|_CG-39
MLEKRKLSGSKLFVKKFGGTSVGSIERIEVVAEQIAKSAHSGEQQVLVLSAMAGETNRLF
ALAAQIDPRASARELDMLVSTGEQISIALMAMALQRRGIKARSLTGDQVQIHTNSQFGRA
SIESVDTAYLTSLLEQGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALRADECQI
FTDVSGVFTTDPNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAQRFKVPLRVLSS
FEAGQGTLIQFGDESELAMAASVQGIAINKALATLTIEGLFTSSERYQALLACLARLEVD
VEFITPLKLNEISPVESVSFMLAEAKVDILLHELEVLSESLDLGQLIVERQRAKVSLVGK
GLQAKVGLLTKMLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELNKV
>Sput_Aa_|_CG-39
MPEKRKLSRSKLFVKKFGGTSVGSIERIEVVAEQIAKSARSGEQQVLVLSAMAGETNRLF
ALAAQVDPRASARELDMLVSTGEQVSIALMAIALQRRGIKAKSLTGDQVQIHTNSHFGRA
SIENVDTGYLESLLDDGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALNADECQI
FTDVAGVFTTDPNIDSNARCLDVIGFDVMLEMAKLGAKVLHPDSVEYAERFRVPLRVLSS
FEVGQGTLIQFGTESDVISASLVQGIAINKALATLTIDGLLTTSEHYQALLACLSRLEID
VEFITPLRLNEDAPAGCVSFMLAEAKVDILLHELEALSTSLELGQLIVERQRAKVSLVGK
GLQAKMGLLTKMLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELNKV
>SHEW-3a_|_CG-39
MLEKRKLSGSKLFVKKFGGTSVGSIERIEVVAEQIAKSAHNGELQVLVLSAMAGETNRLF
ALAAQIDPRASARELDMLVSTGEQISIALMAMALQRRGINARSLTGDQVQIHTNSQFGRA
SIERVDTAYLTSLLNDGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALKADECQI
FTDVPGVFTTDPNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAQRFKVPLRVLSS
FEAGHGTLIQFGDESELAMAASVQGIAINKALATLTIKGLFTSSEHYQALLACLARLEID
VEFITPLKLNETSAAECVSFMLAEAKVDILLHELELLSESLDLGQLIVERQRAKVSLVGK
GLQAKVGLLTKMLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELNKV
>Ppro_Bb_|_CG-39
MTLLVQKFGGTSVGSIDRIEAVADRVMKTYQQGHQIVVVLSAMAGETNRLLGLAKQIDEI
PTARELDVLLSAGEQVSIALLAMALNRRGIKAQSLIADQVTIRTDNVFNNASITDVETER
LTALLEQDNVVVVAGFQGRDSDNNITTLGRGGSDMTAVAIASALNATECQIFTDVDGVYS
TDPRLVPDAKRLDVVHFEHMRTMASKGAKVLQLQSVEYALQHSVPLRVLSSFDDGEGTLV
TFDIASTSSIVGIAILGNQVLLDVELSKEELQRQLSLFGVNVWSVTAKADSTQIVASNDD
LARLRLVLDEKMRHIGDVSTLSMIGNDILEYSDEIRIFLSEAGIIVHNNQQQTDCLSFLI
DKDNHKLAVNIIHKRFVVDQQRLDNPPLLAIY
>Vcho_Fe_|_CG-39
MKKPLIVQKFGGTSVGSIERMQTVAEHIIKAKNDGNQVVVVVSAMAGETNRLVGLAQQVD
SVPNARELDVLLSAGEQVSMALVAMTLHKMGYAARSLTGAQANIVTDNQHNDATIKHIDT
RTITELLEQDFIVIVAGFQGINENGDITTLGRGGSDTSAVALAGALNADECQIFTDVDGI
YTCDPRIVPSARKLDVIDFPSMEEMARKGAKVLHLPCVQYAWKHAVPLRVLSTFEVNQGS
LIKGSAATHAVCGIALQRDMALIRVESESFPSIIKQCQMLGIEVCTTIDEPTHSAFVIKR
DAYAKLQLVGADKIRGSEPVSLITKVGIQAGALVAHARQTLAQHGIDVRYVSASEQSSML
MLDPANVDRAANILHETYVTSEIPQEFGLKQTFLG
>Vfis_Aa_|_CG-39
MALIVQKYGGTSVGSVERIQSVSERIISTLQQGHDVVVAVSAMAGETNRLLHLANQISEV
PEPRELDMLLSAGEQVSIALLAMSLNQKGIKAISLTADQAGIHTNNSFNDATIKHIETDL
ITQWVDKGYVVIVAGFQGRDDQGNITTLGRGGSDTTAVALAAALDADECQIFTDVDGVYT
SDPRFVSNTRRLEEVSFSDMHALAKSGAKVLQEHSVAHAWNSSVALRVLSSFEDGEGTLI
CENPKQPLAVTGLALKQDLSLVECENISSEEQAELYKQYRVLNERCDCFQIVVPKATFLQ
LKLAFDTKIRNISSLSILTLVGDNVEGMAESACNQLLANDIDVHQYDIEPKSVSVIVNQA
DLHRAAEILHKTFVITEQSQDNDLLVAVS
>Vpar_Aa_|_CG-39
MKKPLIVQKFGGTSVGSIERIHQVAEHIIKAKNDGNQVVVVVSAMSGETNRLMDLAKQVD
SVPTARELDVLLSAGEQVSMALLAMTLNKLGYVARSLTGAQANIVTDNQHNDATIKHIDT
STITDLLEQDQIVIVAGFQGVNENGDITTLGRGGSDTSAVTLAGALRADECQIFTDVDGI
YTCDPRVVKNAQKMAVIDFPSMEAMASRGAKVLHLPSVQFAWKNNVPLRVLSTFEVNEGS
LVKGESGHQAVSGIAIQRDLAIIEVDKEHLSSATKQCQMLGIDIWNVIEETERTGIMIKQ
EACAKFDLVFSDKIRNSEAVSLLTAVGLEANGMVEHACGLLAQQDIAINFCATNALTMML
VLPPESVDTAANILHDAYITSSEALNIQQKHAFLG
>Vvul_Ad_|_CG-39
MKKSLIVQKFGGTSMGSIERIHTVAEHIIKAKNDGNQVVVVVSAMAGETNRLLDLAKQVD
SVPTARELDVLLSAGEQVSMALLAMTLNKLGYAARSLTGAQANIVTDTQHNDATIKHIDT
TPINELLEQDQIVIVAGFQGVNENGDITTLGRGGSDTSAVTLAGALAADECQIFTDVDGI
YTCDPRVVKTAQKLDIIDFPSMEEMARKGAKVLHLPCVQFAWENEVPLRVLSTFEINEGS
LVKGETGTQAVCGIALQRDLAMIKVSKESLSSLTKQCQMLGIEIWNVIEEADWAGIMIKQ
DACAKLDLVFSDKIRNSEAVSLLTVVGLEANSLMQHACDALTTQGIAIRHQCVTPLSSML
VVSPESVDQAANYCTMLILVLTKP
>Bbro_Aa_|_CG-40
MRACQPEYEMSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLL
SLAREISPQPDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKA
RIKSIDDKRVLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLI
FTDVDGVYTTDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSS
LTDPLIPLEEEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILG
PVAAANIDVDMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVA
KVSIVGIGMRSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAF
GLDQVPGDQV
>Bpar_Aa_|_CG-40
MRACQPEYEMSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLL
SLAREISPQPDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKA
RIKSIDDKRVLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLI
FTDVDGVYTTDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSS
LTDPLIPLEEEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILG
PVAAANIDVDMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVA
KVSIVGIGMRSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAF
GLDQVPGDQV
>Bper_Aa_|_CG-40
MSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLLSLAREISPQ
PDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKARIKSIDDKR
VLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLIFTDVDGVYT
TDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSSLTDPLIPLE
EEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILGPVAAANIDV
DMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVAKVSIVGIGM
RSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAFGLDQVPGDQ
>Bcen_Da_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
VKDDLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVQGHVSAERVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKVFELDQAS
>Bamb_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDNAYTKARIHSIDDER
VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALDAAECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVSAERVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQAA
>Bmal_Ca_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQDIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>Bpse_Ga_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQDIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>BURK-1a_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKFQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVQGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQAS
>Btha_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIAMQEIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>Bvie_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAERVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQAP
>Bxen_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVARRVAKWHKAGHKMVVVPSAMSGETNRLLGLAKEITAQ
PSPRELDMIAATGEQVSSGLLAIALQEAGVDAVSYAGWQVPVKTDSAFTKARISEIDGER
VLRDLDAGKVVVITGFQGIDPDGNITTLGRGGSDTSAVAVAAALKADECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIPLD
AEMKSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVDGKTAFTFTVGRGDYQRAMDILTGQVKGHVQAEQVLGDPKVSKVSVVGVGM
RSHVGIASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>POLY-1a_|_CG-40
MALIVHKYGGTSMGSVERIANVAKRVAKWMRAGHQVVVVPSAMSGETNRLLGLAKEINPE
AKPRELDQIASTGEQVSSGLLALALMREGIDAVSYAGWQVTVHTDSAFTKARIKSIDDQK
ILNDLNAGRAVVVTGFQGVDPDGNITTLGRGGSDTSAVAMAAALKADECLIYTDVDGVYT
TDPRVCEDARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYKVKTRVLSSLTDPLMPLD
QEMKSGTLITFEEDSTMEAAVISGIAFARDEAKITVLGVPDRPGIAYQILGPIADANIDV
DIIIQNQSVEGKTDFTFTVPRADYQKALDILRNNVQAHIEAKEISGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIVMISTSEIKISVVIDEKYMELAVRALHKAFELDQK
>Cnec_Ba_|_CG-40
MALIVHKYGGTSMGSTERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLAKEISPQ
PNPRELDMLASTGEQASVALLAIALHGEDIDAVSYTGWQVPVKTDSAYTKARIESIDDER
ILADLDAGRVVVITGFQGIDDDGNITTLGRGGSDTSAVAIAAAIEADECLIYTDVDGVYT
TDPRVVEDARRLDQITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
QEMHSGTLITFEEDSTMEAAVISGIAFARDEAKITVLGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVDGKTDFTFTVPRGEYQRALAILNDGVKSHIGAGSVSGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQA
>Rmet_Aa_|_CG-40
MALIVHKYGGTSMGSTERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLAKEISAQ
PDPRELDMLASTGEQASVALLAIALHGEGIDAVSYTGWQVPVKTDSSYTKARIESIDDER
ILGDLDAGKVVVVTGFQGIDGDGNITTLGRGGSDTSAVAIAAAIEADECLIYTDVDGVYT
TDPRVVEDARRLDQITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
QEMHSGTLITFEEESEMEAAVISGIAFARDEAKITVLGVPDKPGIAYQILGPIADANIDV
DMIIQNQSVDGKTDFTFTVPRGDYQRALTILNDNVKGHIGAESVSGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKVFELDQA
>Rsol_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHRAGHQIVVVPSAMSGETNRLLGMAKEISAQ
PDPRELDMIASTGEQVSVGLLAIALHAEGIDAISYTGWQVPVQTDSAYTKARIQSIDDER
VRADLEAGRVVVITGFQGIDGEGHITTLGRGGSDTSAVAVAAALEAEECLIYTDVDGVYT
TDPRVVDDARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
VEMHSGTLITFEEDSNMEAAAISGIAFARDEAKITVIGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVDGKTDFTFTVPRGDYQRALGILNDSVKGHIGAANVSGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>Aave_Aa_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKDLAPS
RASSAYHRELDMLAATGEQASSALLAIALQAEGMESVSYAGWQVPIRTDSSYTKARIESI
DDQRVRADLAAGKVVIVTGFQGIDEHGHITTLGRGGSDTSAVAVAAAMKAAECLIYTDVD
GVYTTDPRVVAEARRLHTVSFEEMLEMASLGSKVLQIRSVEFAGKYKVPLRVLSSFTPWD
IDIEEEARSGTLITFEEDEKMEQAVVSGIAFNRDEAKISVLGVPDKPGIAYQILGAVADA
NIEVDVIIQNLSKDGKTDFSFTVNRNDFARTVDLLKEKVVPALGAQEVVGDAKICKVSIV
GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYVELAVRTLHKAFELDQP
SAA
>ACID-3a_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELTPS
RITSAYHRELDMLAATGEQASSALLAIALQAEGMESVSYAGWQVPVRTDSSYTKARIESI
DDKRVRADLDAGKVVIVTGFQGIDEGGNITTLGRGGSDTSAVAIAAAMKAHECLIYTDVD
GVYTTDPRVVPEARRLTTLSFEEMLEMASLGSKVLQIRSVEFAGKYKVPLRVLSSFTSWD
IDINEEAKSGTLITFEEDEQMEKAVVSGIAFTRDEAKISVIGVPDTPGIAYQILGAVADA
NIDVDVIIQNMGKEGKTDFSFTVNRNDYQRTIDLLKDKVLPQLGAEEIVGDAKIAKVSIV
GIGMRSHVGVASKMFRALSEEGINIKMISTSEIKTSVVIDEKYVELAVRTLHKAFELDQA
AA
>Pnap_Aa_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELAPA
QSDDTYSRELDALAATGEQASSALLAIALQAEGMPAVSYAGWQVTIKTNSAYTKARIESI
DDEKVRADLDAGKVVIITGFQGMDEGGNVTTLGRGGSDTSAVAIAAALKAHECLIYTDVD
GVYTTDPRVVPEARRLQTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVPLRVLSSFTDWN
IDINEEARSGTLISFEEDEKMEKAIVSGIAFNRDEAKISVLGVPDTPGIAYQILGAVADA
NIEVDVIIQNISKDGKTDFSFTVHRNDFAKTLDLLKSKVVPALGAQEVTGDARICKVSIV
GIGMRSHVGIASKMFRVLAEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDQP
VA
>POLA-1a_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELAPA
RPGDDYHRELDALAATGEQASSALLAIALQSEGMQAVSYAGWQVTIKTNNAYTKARIESI
DDERVRADLDAGKVVIITGFQGVDEGGNVTTLGRGGSDTSAVAIAAALKAHECLIYTDVD
GVYTTDPRVVPEARRLHTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVPLRVLSSFTDWD
IDINEEARSGTLISFEEDENMEQAIVSGIAFNRDEAKISVLGVPDTPGIAYQILGAVADA
NIEVDVIIQNISKDGKTDFSFTVHRNDYSKAVDLLKTQVLPKLGAQEVTGDAKICKVSIV
GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDQP
AA
>Rfer_Aa_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLALAKELAPA
KATESYSRELDMLAATGEQASSALLAIALQAEGLESVSYAGWQVPIRTNSAYTKARIESI
EDTKVRADLDAGRVVIVTGFQGLDELGNITTLGRGGSDTSAVAVAAAMKADECLIYTDVD
GVYTTDPRVVPEARRLQTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVKLRVLSSFTPWD
IDINEEAASGTLITFEEDEHMEQAIVSGIAFSRDEAKISVLGVPDKPGIAYQILGAVADA
NIDVDVIIQNISKDGKTDFSFTVNRGEYAKTVDLLKEKVLPKLGAQEVVGDTKICKVSIV
GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFELEQA
PA
>Veis_Aa_|_CG-40
MALIVHKYGGTSMGSPERIRCVAKRVAKWARAGHQMVVVPSAMSGETNRLLALAKELAPA
RATDAYHRELDMLAATGEQASSALLAIALQAEGLGSVSYAGWQLPIRTDSSYTKARIESI
DDQRVRADLAHGKVVIVTGFQGIDDEGNITTLGRGGSDTSAVAVAAAMKAHECLIYTDVD
GVYTTDPRVVPQARRLQTVSFEEMLEMASLGSKVLQIRSVEFAGKYRVRLRVLSSFTPWD
MDIDEEARSGTLITFEEDEKMEQAVVSGIAFNRDEAKLSVLGVPDKPGIAYLILGAVADA
NIDVDMIIQNLSKDGKTDFSFTVHRNDYARAIDLIKEKVLPVLGAHEVVGDTNICKVSIV
GIGMRSHVGVASKMFRVLSEESINIQMISTSEIKTSVVIDEKYMELAVRSLHQAFGLDQE
AA
>Hars_a_|_CG-40
MALIVHKYGGTSMGSTERIKNVARRVAKWHDAGYQIVVVPSAMSGETNRLIGLAKELMPH
PNPRELDMLASTGEQVSVALLAMALHSIGKEAVSYTGWQAGIKTDSAFTKARIQSIDDVK
VKKDLDAGRIVIITGFQGVDEDGNIATLGRGGSDTSAVAVAVALEAKECLIYTDVDGVYT
TDPRVVSEARRLNTVTFEEMLEMASLGSKVLQIRSVEFAGNYKMPTRVLSSLTDPMMSLE
EEAKSGTLISFEEDTKMEQAAITGIAFSRDEAKITVLGVPDRPGIAYQILGPIAAANIEV
DMIIQNQSVDGKTDFTFTVPRADYAKAVDVLNDSVKAHIGAASIQGDTKVSKVSVVGVGM
RSHVGIASQMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKTFDLEKSN
>Mpet_Aa_|_CG-40
MPRRPAKMPGSRRRAPRPTDFPAAAFLMALIVHKYGGTSMGSTERIRNVAKRVAKWARAG
HQMVVVPSAMSGETNRLLGLAKELSPASHTPQLARELDMIAATGEQVSVGLLAIALQAEG
LQAVSYTGWQVPVRTDSAYTKARIESIDDVRVRADLAAGKVVVITGFQGIDGDGHITTLG
RGGSDTSAVAVAAAMKAAECLIYTDVDGVYTTDPRVVPEARRLSAISFEEMLEMASLGSK
VLQIRSVEFAGKYRVPLRVLSSFTPWDIPLDEEAKSGTLITFEEDENMEQAVVSGIAFNR
DEAKITVMGVPDKPGIAFQILGPVAEANIDIDVIIQNVSHDGKTDFSFTVHRNDYARTME
LLKGTVQPVINAAQVLGDPKICKVSIVGIGMRSHVGVASRMFRVLSEEGINIQMISTSEI
KTSVVIDEKYMELAVRALHKAFDLDAPAAVPAA
>Tden_Aa_|_CG-40
MALIVQKYGGTSVANVERIRAVAERVAKFKMLGHQVVVVLSAMSGETNRLIGLAKQIQAE
PDPRELDMMVSTGEQVTIALLAMALKDLGLKAKSYTGAQVRILTDDAFTKARILSIDEAK
MRRDLDSGHVVVVAGFQGVDEGGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRIVPEARRLKTVTFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFQDEGDGTL
ITFEENDNMEQAIISGIAFSRDEAKITVVGVPDHPGIAYQILGPVADANVDVDMIVQNVG
HANTTDFTFTVHRNDFAKAMSLVKATAATVGAREVTGDDKIAKVSIVGVGMRSHVGIAKK
MFETLSKENINLQMISTSEIKISVVVEDKYLELAVRALHQAFELDKATA
>Mfla_Aa_|_CG-40
MALIVQKYGGTSVANPERIGNVARRVARHKALGQQVVVVVSAMSGETNRLISLAKEVMPN
PDPRELDVLVSTGEQVTIALLSMALMELGVKAKSYTGGQVSIVTDSAHTKARILKIDEER
IRKDLDAGYVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRIVPEARRLRSVTFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEEGEGTL
ITFEDDKDMEQPVISGIAFNRDEAKITVLGVPDRPGIAYQILGPVADANIDVDIIIQNVG
ADGTTDFTFTVHKNDLQKALNILREKVQPHTGAREIIGDDKTAKVSVVGVGMRSHVGIAS
QMFRTLAEEGINIQMISTSEIKISVVIDEKYMELAVRVLHKAFGLEEV
>Cvio_Aa_|_CG-40
MALIVQKYGGTSVGTTERIKNVARRVAKWKAQGHDVVVVVSAMSGETNRLIALAKEIQDY
PDPRELDVVVSTGEQVTIGLLAMALKEIGVPAKSYCGWQVKVVTDQAHTKARIQSIDDEA
MRGDLKEGRVVIVAGFQGVDEEGSITTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRLKTVTFEEMIEMASLGSKVLQIRSVEFAGKYKVRLRVLSSFEDEGEGTL
ITFEEDESMEKAVVAGIAFDRNEARINVKGVPDKPGIAYQILGPIADANIEVDMIIQNVG
ENGTTDFSFTVPRGEFNRALTILREVQTHIGAAKIDADDKVAKISIVGVGMRSHCGIAST
MFRTLAEEGINIQMISTSEIKVSVLVDEKYLELAVRVLHKAFGLDQAA
>Ngon_Aa_|_CG-40
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLATGEQVTIGLLAMALKDIGVDAKSYTGWQVSLKTDTAHTKARIESIDDEK
MRADLAAGKVVIVAGFQGISSEGNISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERKDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFDLG
>Nmen_Aa_|_CG-40
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLSTGEQVTIGLLAMALKDIGVEAKSYTGWQVALKTDTAHTKARIESIDDEK
MRADLAAGKVVIVAGFQGISSEGDISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNLG
>Neur_Aa_|_CG-40
MAFLVQKYGGTSVGSTERIKQVAHRVAEFRAQGHELVVVVSAMSGETNRLISLAKEIQPN
PDPRELDVILSTGEQVTIGLLAMALRELGIKAKSYTGPQVSITTDSAHTKARILKIDEDP
IRADLAAGYVIIVAGFQGVDETGDITTLGRGGSDTTAVALAAALKADECQIYTDVNGIYT
TDPRVVPEARKLDTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEGEGTLI
TFEEDNKMEQPIISGIAFNRDESKITVVGVPDHPGIAYQILGPVADANIDVDMIIQNVGH
DDTTDFSFTVHRNEYARTMDVLKQQVLPHIGAREVIGGDKIAKVSVIGVGMRSYAGIASK
MFRVLAEEGINIRMIATSEIKISVVVDEKYMELAVRVLHKAFDLDQVNNTSTKTC
>Neut_Aa_|_CG-40
MAFLVQKYGGTSVGSVERIKQVARRVAEFWAQGHKLVIVVSAMSGETNRLISLAKEIQTN
PNPRELDVVLATGEQVTIGLLAMALRELGIKAKSYTGSQVSITTDSAHTKARILKIDEDH
IRADLTAGNVIIVAGFQGRDEAGDITTLGRGGSDTTAVALAAALKADECQIYTDVNGIYT
TDPRVVPEARKLNTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEGEGTLI
TFEEDNKMEQPIISGIAFNRDESKITVVGVPDHPGIAYQILGPVADANIDVDMIIQNIGR
DGTTDFSFTVNRNEYTRTMDILKEQVLPHIGARDVIGGEKIAKISVIGVGMRSYAGIASK
MFRVLAEEGINIRMIATSEIKISVVVDEKYMELAVRVLHKAFDLDQANNIDVKSC
>Nmul_Aa_|_CG-40
MTFIVQKYGGTSVGSTERIKNVARRVARFQARGDRVVVVVSAMSGETNRLIALAREFQAH
PDPRELDVMVSTGEQVSVALLSMALMDLGIKAKSYTGAQVRIHTDSAYTKARILKIDEDR
IRADLDAGYVVAVAGFQGVDEAGSITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
TDPRIVPEARKLKTVTFEEMLEMASLGSKVLQIRAVEFAGKYKVKLRVLSSFEEEGEGTL
ITFEEEKNMERAIISGIAFNRDEAKITVLGVPDRPGIAYQILGPVAEANIDVDMIIQNVG
HDGMTDFSFTVNRNEFARTMDILKNQVQPHIGARGVIGGDRIAKVSVVGVGMRSHVGIAS
RMFRTLAEEGINIQMISTSEIKISVVVDEKYMELAVRVLHKVFELDQIS
>AZOA-1a_|_CG-40
MALIVQKYGGTSVGNPERIKNVARKVAKFQAQGHKVVVVVSAMSGETNRLIALTKEVATH
PDARELDVVVSTGEQVTIGLLCMALHDIGVKAKSYTGGQVRILTDSAHTKARILNIDEAP
IKKDLDEGNIVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVPEARKLDTITFEEMLELASLGSKVLQIRSVEFAGKYKVKLRVLSSFQEEGEGTL
ITVEEDQNMEQPVISGIAFTRDEAKLTVLGVPDKPGIAYQILGPVADANIDVDMIIQNIG
HDGTTDFSFTIPRGELDKTAKVLEGVKAHIGARAIEADKAMAKVSVVGVGMRSHPGVASK
MFRTLAEEGINIQMISTSEIKISVVIEDKYLELAVRVLHKAFGLESA
>Daro_Aa_|_CG-40
MALIVQKYGGTSVGNPERIKNVAKRVAKFQAQGHQVVVVVSAMSGETNKLIALAKEVQAN
PDPRELDAIMSTGEQVTTGLLSMALMDIGCKAKSYTGGQVKVLTDSTHTKARILSIDEAN
MRRDLDAGYVIVVAGFQGVDANGNITTLGRGGSDTSGVALAAALKADECQIYTDVDGVYT
TDPRVVPEAKKLDTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFQDEGEGTL
ITVEEDKNMEQPIISGIAFNRDEAKLTMLGVPDTPGIAYQILGAIADANIDVDMIIQNVG
HDGTTDFSFTVNRGEFAKAKEILEGVKAKLGAREITGDNKICKVSAVGVGMRSHPGVASQ
MFKALADEGINIQMISTSEIKISVVLDEKYLELAVRVLHRTFGLDQ
>ACIN-1a_|_CG-41
MALIVQKYGGTSMGTPERILNVARRVKRWHDHGHKVVVVVSAMSGETNRLLALAKAITDT
PDPRELDQMVSTGEQVTISMLAMALNSIGVEAKSYTGRQVGIKTDSAYNKARIEAIDTDV
MTKDLDAGRVLVVAGFQGVDEEGNTTTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVAPKAKKVDRISFEEMLEMASLGSKVLQIRSVEFAGKYQVPLRVLSSFDNDNDGAF
DEEFKQNVGTLITTEAEDTMEQPIISGIAFNRDEAKLTILGVPDEPGIAAKILVPISAAN
IEVDMIVQNVEEDGTTDFTFTVNRGDLAKAKKILEETASNIGAREVSTRDDIVKVSIVGV
GMRSHAGVASKMFMALAEESINILMISTSEIKVSVLIEENYLELAVRTLHTAFGLDREHG
ESSARA
>Parc_Aa_|_CG-41
MALIVQKYGGTSMGSIDRIKNVAKRVKRWHDNGHQVVVVVSAMSGETNRLIDLARQISSQ
PDPREYDQMVSTGEQVSISLLAMAIKELGIGARSFTGRQVAIKTDNAHNKARIESIDDKN
IRQQLDAGNIVIVAGFQGIDEEGNATTLGRGGSDTTGVAIAAALGADECQIYTDVDGVYT
TDPRVTSKAKKLEKITFEEMLEMASLGSKILQIRSVEFAGKYGVPLRVLSSFDENNDGSF
DQDFQDNVGTLITIDEGDNMEQAIISGIAFNRDEAKIVVRGVPDHPGIASAILSPIGRAN
IEIDMIVQNLSTNGMTDFTFTVNRTDMEKTMKVLENEVKDEIGAKEILANDEVVKVSLVG
VGMRSHAGVASLMFQTLAENNINIQMISTSEIKVSVLIQEQYLEKAVRSLHTAFGLDRED
GESKVAGL
>Pcry_Aa_|_CG-41
MALIVQKYGGTSMGSIDRIKNVAKRVKRWHDNGHQVVVVVSAMSGETNRLIDLARQISSQ
PDPREYDQMVSTGEQVSISLLAMAIKELGIGARSFTGRQVAIKTDNAHNKARIESIDDKN
IREQLDAGNVVIVAGFQGIDEEGNATTLGRGGSDTTGVAIAAALGADECQIYTDVDGVYT
TDPRVTSKAKKLEKITFEEMLEMASLGSKILQIRSVEFAGKYGVPLRVLSSFDENNDGSF
DQEFQDNVGTLITIDEGDNMEQAIISGIAFNRDEAKIVVRGVPDHPGIASAILSPIGRAN
IEIDMIVQNLSTNGMTDFTFTVNRTDMEKTMKVLESEVKDEIGAKEILANDEVVKVSLVG
VGMRSHAGVASLMFQTLAENNINIQMISTSEIKVSVLIQEQYLEKAVRSLHTAFGLDRED
GESKIAGL
>PSYC-4a_|_CG-41
MALIVQKYGGTSMGSIDRIKNVAKRVKRWHDHGHQVIVVVSAMSGETNRLIDLATQISKY
PDPREYDQMVSTGEQVSISLLSMAIKELGIGARSFTGGQVAIKTDNKHNKARIESIDAEK
IQAQLDDGNVVVVAGFQGIDAEGNITTLGRGGSDTTGVALAAALGADECQIYTDVDGVYT
TDPRVTSKARKLDKITFEEMLEMASLGSKVLQIRAVEFAGKYQVPLRVLSSFDEGQDGSF
DEEFRQNVGTLITVDEGDDMEQPVISGIAFNRDEAKIVVRGVPDHPGIASGILTPISNAN
IEIDMILQNLSDQGLTDFSFTVNRPDFDKAITILESIKGDIEAKEIHGNTDVVKVSLVGV
GMRSHAGVASKMFQVLAENNINIQMISTSEIKISVLIKEQHLEKAVKSLHTAFGLDRADG
ESKVAGL
>Voku_Aa_|_CG-42
MALIVQKYGGTSVASVERIQAVAQKIKAFKEKGHQLVVSVSAMSGETSRMTALAQTIQDI
PSLREMDVLLTTGEQVTIALLTMALQQLGCDAVSYTGPQVCIMTDSEHGKARIKSIDNHR
IFHSLDQGKVVVVAGFQGVDENGHITTLGRGGSDTTAVALVTALKADECQIYTDVDGVFT
TDPRIEINARRINVVSYEEMLEMASLGSKVLQIRSVEFASKYKVPLRVLSSLIDNPLGTL
ITREENIVEQVVISGIAHNKDEAKLSLIGVLDEPGIAFKILNPISSANIEVDMIVQSVSA
REGLTNFAFTVHRNNFKTASKILNNVCKEIGAIAVQSDDKVVKVSLVGIGIRSHAGIATQ
MFEVLHNEGINIQMISTSEIKISVVIDEKYLELAVRSLHAVFELDKE
>Rmag_Aa_|_CG-42
MALIVQKYGGTSVVSAERIQAVAQKIKAFKETGNQLVVSVSAMSGETNRMTALAQTIQNT
PSLREMDVLLTTGEQVTIALLTMALQQLGCDAISYTGSQVRIMTDSEHSKARIKSIDDHR
ICQSLAQGKVVVVAGFQGVDENGHITTLGRGGSDTTAVALAAVLKANECQIYTDVDGVFT
TDPRIEPNARKMNVVSYEEMLEMASLGSKVLQIRSVELASKYKVPLRVLSSLIDNPVGTL
ITSEENIVEQAVISGIAYNKDEAKLSLIGVPDKPGIAFKILSQISAANIEVDMIVQSVSA
REGLTNFAFTVHRNDFKIASKILDRLCQELSAIAVQSDNKVVKVSLVGIGMCSHVGIASK
MFEVLHNEGVNIQMISTSEIKISVVIDEKYLELAVRSLHVVFELDKE
>Mhyd_Aa_|_CG-43
MALLVQKFGGTSVGTTERIEAVADKVCRFRKEGHDVVVVVSAMSGETNRLIALANDIMDE
PTPREMDVLVSTGEQVTIALLSMALQKRGCDARSYTGSQVRILTDSSHTKARIKQIDEQR
MREDLDAGRVVVVAGFQGIDDNGNITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
TDPRVVDSARRLERITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSSFQEGEGTLI
TFEDENAMEQPVVSGIAFNRDEAKLTISGVPDTPGSALRILKPVSDANIEVDMIVQNVGE
DNKTAFTFTVHRNDFKRAQEVLRGVTAELGAGEVGGDTKIAKVSIVGVGMRSHAGVATKM
FEALSNEGINIQMISTSEIKISVVIDEKYLELAVRALHSAFELDKAGVEESA
>Sdeg_Aa_|_CG-43
MSLFVQKFGGTSVGTVERIKAVAKKVAGFRDQGHDIVVAVSAMSGETNRLIALAKEMQAT
PDPREMDVLVSTGEQVTIALMCMALKDLGYDARSYTGTQVKILTDSSHMKARIQDIDVAP
MKADLAAGRVVVVAGFQGVDENGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVSSAKRLERITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSTFDDGPGTLI
TLDEEYSTMEQPVVSGIAFNRDEAKVSILGIPDAPGVASKILAPIGDANIEIDVIVQNVA
ADNTNDLTFTVNRADVDKARAVVERVATELGAREVVTDDKIAKISIVGVGMRSHAGVAST
MFKSLAADAINIQMITTSEIKISVIIDERYLELAVRGLHTAFGLDKDQ
>Abor_Aa_|_CG-43
MALIVQKYGGTSVGTVERIQAVAEKVAGFHKRGDQVVVVVSAMSGETNRLIELANGVTDK
PSPREMDVLVSTGEQVTIALLSMALQKQGLNARSYTGSQIPLRTDNTYSKARIEEIDDKK
VRADLDGGSVVVVAGFQGVDNDGNITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
TDPRVVDNARRLDSITFEEMLEMASQGSKVLQIRSVEFAGKYNVPLRVLSSFQDGPGTLI
TVEDEVDMEKPVISGIAFTRDEAKIIVRGAPDTPGIAYKILGPVSAENIEVDMIVQNVGK
DGAADFTFTVHRNDFARAQEALRNASEELGNPEIIGDDKIAKVSLVGVGMRSHAGVASKM
FQALATEGVNIEMISTSEIKVSVVIAEKYLELAVRALHSAFELDQPGV
>Hche_Aa_|_CG-43
MALLVQKFGGTSVGSVERIEKVADKVKKFRDEGHDLVVVVSAMSGETNRLIGLAKDIMDE
PTPRELDVLVSTGEQVTIALLCMALHKRGCEARSYTGGQVRILTDNAHTKARILEIDENN
IRADLDAGRVVVVAGFQGEDESGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVDSARRLDSITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSSFEDGPGTLI
TTEDDENMEQPIVSGIAFNRDEAKLTVSGVPDIPGVASKILKPISDANIEVDMIVQNVGE
DNHTDFTFTVHRNDFNKAKAILEKLCKELEAREVKGDSKIAKVSIVGVGMRSHAGVATTM
FEALSKEGINIQMISTSEIKISVVIDEKYLELAVRSLHGAFELSEKPA
>MARI_Aa_|_CG-43
MALLVQKYGGTSVGTIERIEAVADRVLKHKQQGDDIVVVVSAMSGETNRLIDLAKSINPS
PSAREMDVLLSTGEQVTIALLSMALMKRGLDARSYTGSQIRITTDSAHGKARIQKIDTEA
MRADLDAGRVIVAAGFQGADELGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVDSARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYQVPLRVLSSFVEGEGTLI
TTEGSKGMEQPAVSGIAFNRDEAKLTLKGVPDIPGIASRILGPISDANIEVDMIVQNVSV
DGTTDFTFTVHRNEYDQALSTLNIIAKELGASAVLSDAKIAKVSIVGVGMRSHAGVASTM
FKALAAESINIQLISTSEIKVSVIIDEKYMELAVRALHSAFKLNETASGVREA
>Avin_Aa_|_CG-43
MALIVQKFGGTSVGSIERIEQVAEKVKKFRDNGDDIVVVVSAMSGETNRLIGLAKQISEQ
PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSSFTKARILQIDDRK
LRTDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
SDPRVVPKAQRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFQEGPGTLI
TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDNPGVAFKILGPISEANIEVDMIVQNIAH
DNTTDFTFTVHRNDYLNAMRVLENTAREIGAREVIGDTDIAKVSIVGVGMRSHAGVASRM
FGALAKEGINIQMISTSEIKVSVVIEEKYLELAVRSLHTAFELDAPARQGE
>Paer_Aa_|_CG-43
MALIVQKFGGTSVGTVERIEQVAEKVKKFREAGDDVVVVVSAMSGETNRLIGLANQIMEQ
PVPRELDVMVSTGEQVTIALLSMALIKRGVPAVSYTGNQVRILTDSAHTKARILHIDDTH
IRADLKAGRVVVVAGFQGVDGNGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVPQARRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFQEGPGTLI
TIDDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVA
HDNTTDFTFTVHRNDYLNALEILKQTAANIGAREAIGDTNIAKVSIVGVGMRSHAGVASR
MFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPARQGE
>Pent_Aa_|_CG-43
MALIVQKFGGTSVGSIERIEQVADKVKKFREQGTDLVVVLSAMSGETNRLIDLAKQITDQ
PEPRELDVIVSTGEQVTIALLSMALMKRGVPAVSYTGNQVRILTDSAHNKARILQIDDQK
IRADLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVPQAQRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKEGPGTLI
TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANIEVDMIVQNVSH
DNTTDFTFTVHRNEYEKALAVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASRM
FEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPARQGE
>Pflu_Aa_|_CG-43
MALIVQKFGGTSVGSVERIEQVADKVKKFREAGDDLVIVLSAMSGETNRLIDLAKQISGE
AKPVPRELDVIVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHNKARILQIDD
QKIRGDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGV
YTTDPRVVPKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFQEGPGT
LITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDNPGVAFKILGPISAANIEVDMIVQNV
SHDNTTDFTFTVHRNDYLAAQTVLENTAREIGAREVVGDTDIAKVSIVGVGMRSHAGVAS
RMFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPARQGE
>Pmen_Aa_|_CG-43
MGALRGIRRLFEMALIVQKFGGTSVGTVERIQQVAEKVKKFREKGDDIVVVVSAMSGETN
RLIDLAKQISDGEPVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSA
YNKARILQIDDQKIRADLKAGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKAD
ECQIYTDVDGVYTTDPRVVPKAQRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLR
VLHSFQEGPGTLITLDEEESMEQPIISGIAFNRDEAKLTIRGVPDIPGIAFKILGPISAA
NIEVDMIVQNVSHDNTTDFTFTVHRNDYNNALGVLQKTADELGAREVVGDTNIAKVSIVG
VGMRSHAGVASRMFEALAKETINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPS
RQGE
>Pput_Aa_|_CG-43
MALIVQKFGGTSVGSIERIEQVAEKVKKHREAGDDLVVVLSAMSGETNRLIDLAKQITDQ
PVPRELDVIVSTGEQVTIALLTMALIKRGVPAVSYTGNQVRILTDSSHNKARILQIDDQK
IRADLKEGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVPQARRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKEGPGTLI
TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISASNIEVDMIVQNVAH
DNTTDFTFTVHRNEYEKAQSVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASCM
FEALAKESINIQMISTSEIKVSVVLEEKYLELAVRALHTAFDLDAPARQGE
>Pstu_Aa_|_CG-43
MALIVQKFGGTSVGTVERIEQVAEKVKKFRDGGDDIVVVVSAMSGETNRLIDLAKQISEQ
PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDAQR
IQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLI
TLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAH
DNTTDFTFTVHRNDYNNALQVLQGIAAEMGAREAIGDTNIAKVSIVGVGMRSHAGVASRM
FEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPAGNTAE
>Psyr_Aa_|_CG-43
MALIVQKFGGTSVGSVERIEQVADKVKKFREAGDDLVVVLSAMSGETNRLIELARQISDQ
PVPRELDVIVSTGEQVTIALLAMALMKRGVPAVSYTGNQVRILTDSAHNKARILQIDDQK
IRSDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVSQAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGTLI
TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANIEVDMIVQNVSH
DNTTDFTFTIHRNDYQAALQVLEATAREISAREVSGDTKIAKVSIVGVGMRSHAGVASRM
FEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPRQGE
>Deth_Aa_|_CG-44
MAVVVHKYGGTSVGDAERIKHVAKRIIAARQKGSDVVAVVSAMGDTTDDLIALAHKLNDC
PEPREMDVLLSTGEIVSSTLLAMALKNMGQDAISLSGQQAGIRTDSAHSKARITGIDPKR
IHDELAKGRVVIVAGFQGVSDCQDVTTLGRGGSDTTAVALAASLGASICERYTDVDGVYT
ADPRLIPDARRLAEISYEEMLELSSYGAKIMHPRAVEIGQVYNIPILVASSFNENPGTLI
HGGENMEIRNRVSGIAHDFEVAKITILGVPDKPGIAAGLFAPLAKAGVSVDTIVQNSSQD
HITDLTFTVTKSDLGKALEVIGPIAKDIQAREVLSDSRIGKVSIIGTGMLNAPGYAARMF
KALSDAGINILLISTSEIRITCIIEEDKVKDAVKAIHKAFEMEKD
>DEHA-1a_|_CG-44
MAVVVHKYGGTSVGDAERIKHVAKRIIAARQKGNDVVAVVSAMGDTTDDLIELAHKLNDC
PEPREMDVLLSTGEIVSSTLLAMALKNMGQDAISLSGQQAGIRTDSVHSKARITGIDPKR
IHDELDKGRVVIVAGFQGISDCQDVTTLGRGGSDTTAVALAASLGASICERYTDVDGVYT
ADPRLIPDARRLSEISYEEMLELSSYGAKIMHPRAVEIGQVYNIPILVASSFNENPGTLI
HGGEKMEIRNKVSGIAHDFEVAKITILGVPDKPGIAAGLFAPLAKAGVSVDTIVQNSSQD
HITDLTFTVTKSDLGKALEVIGPIAKELQAREVLSDSKIGKVSIIGTGMLNAPGYAARMF
KALSDAGINILLISTSEIRITCIIEEDKVKDAVRAIHKAFEMEKD
>Dred_Ab_|_CG-45
MLVVKKFGGSSVADPERIKRVARRVVEEHQKGNQVVVTVSAMGDTTDDLVSLAKQVTNDP
SEREMDMLLSTGEQISIALLSMAIRDLGSDVISLTGGQVGIYTDDVHSKAKILKIETSRV
KEELEQGRVVVVAGFQGIKSNHDITTLGRGGSDTTAVALAAALKADICEIFTDVDGVYTT
DPRLVPEASKLKNISFDEMLELASLGAQVLHPRSVELAKQYGIPIHVRTSFDHREGTIVE
EAPNMENAPVVSGVAHDYNVAKIGLFDVPDQPGVAKKIFKALSKHNLNVDMIIQSAMRNN
MNDIGFTTTQDDLRKALQTIEAIQQEVGFRGYNHDEDVAKVSIVGAGMISHPGVAADMFE
ALADEGINLEMITTSEIKVSCVIKRSETEKAVKALHKKFKLDNLAEASIYNR
>Pthe_Aa_|_CG-45
MLIVQKYGGSSVADAGRIRQVARRVAGARADGHRVVVVVSAMGDTTDELIQLVKEVTDSP
PEREMDVILSTGEQVSIALLAMAIKDLGEPVISLTGAQVGILTDNVHTKAKILHVNTARL
MDELNRGNIVVVAGFQGINSANDITTLGRGGSDTTAVALAAALKADLCEIYTDVDGVYTA
DPRLVPEARKLDVVSYEEMLELANLGAVVLHPRSVELAMQYGIPLHVRSSFNHNSGTVVK
EAENMEKALVVTGVAYDMNVAKVGLYNVFDRPGIAYKLFKALADENINVDMIVQSAMRGD
RNDISFTCTQGDLKKALQVVERLLPELGASGYTSDDSVAKVSIVGAGMVSNPGVAARMFE
AIYEEGINLEMISTSEIKISCIIKAHEAGKAVKALHKKFNLAQEHDQ
>Csac_Aa_|_CG-45
MGIVVQKYGGTSVADKERIFRAARRAVAEYEKGNKVVVVVSAQGDTTDELIEKAKEINEN
PSKREMDMLLSTGEQISIALMAMAIEKLGYPVISLTGWQAGIKTDSNYSNARIKEIDTER
LQRELDKRNIVVVAGFQGINKYDDITTLGRGGSDTTAVALAAALKADKCEIYTDVDGVYT
ADPRIVPNASKLKEISYDEMLELATLGAKVLHNRSVELAKKYNIPIVVRSSFNDNEGTVV
KEVSSVEKLLVSGVACDKDIARVAVIGVENVPGKAFQIFSLLAKENINVDIILQSIGREK
TKDISFTVSKSNLKQTLDVLTKNLHVIGAKDITYADNVAKVSIVGAGMVNNPGVAAMMFE
ALYDAGINIEMISTSEIKISVLIDEKDAEKAVRAIHDKFKLHLLNSNGK
>Noce_Aa_|_CG-46
MTLIVQKFGGTSVGTLERIEAIADKLVAFQRRGDSLVAVVSAMSGETNRLLALAHEIHSQ
PNPRELDVLLSTGEQVTIALLSIAIEKRGIPARSYTGSQVYIRTDSAHNKARIQEIDAKR
IHDDLRQGRIVVVAGFQGADEKGNITTLGRGGSDTTAVALTAALEAGECQIYTDVDGVYT
TDPRVVPEARRLARLTYEEMLELASLGAKVLQIRAVEFASKHHVPLRVLSSFEKGEGTLI
TSEVEGMEEPLISGIAFNIDEAKLTILGVPDKPGVAYHILGPVADANIGVDMIIQNVGRD
GTTDFTFTVHRNDYLKALEILRESASTLGAREVRGDDKIAKISVVGVGMRSHAGIASTMF
HTLAQEGINIQTISTSEIKISVVIEEKYLELGVRALHSAFELEKAPSRISSSL
>Aehr_Aa_|_CG-46
MALIVQKYGGTSVGTTERIKNVARRVQASRERGDDVVVVVSAMSGETNRLLALAEEIGPN
PPAREVDVLVSTGEQVTIALLTMALESIGTPARCYTGPQVRILTDSAHSRARILDIDAKQ
INDDLRLGRVVVVAGFQGVDESGAITTLGRGGSDTTAVAIAAALKADECQIYTDVDGVYT
TDPRVVPKARRLERITVEEMLELASLGSKVLQIRSVEFAGKYKVPLRVLSSFKEGPGTLI
TYEENPMEEPLISGIAFNRDEAKLTVLGAPDVPGIAASILGPISDAGIEVDMIIQNVSTS
GATDFTFTVHKRDYEQALKILQDNKDKLGAREIYGDPKIVKLSLVGVGMRSHAGVASTMF
KALSAEGINIQMISTSEIKISVVVDEKYLELGVRTLHTAFGLDDENAQVEVEGDNA
>Hhal_Aa_|_CG-46
MGLVVKKFGGTSVGTTERIQAVAEQVKASREAGDDVVVVVSAMSGETNRLVELAESIHPN
PPAREVDVLLSTGEQVTIALLTMALEQIDCPARCYTGAQVRILTDSSFSRARILDIDAEP
LQEDLQRGRVVVVAGFQGVDEEGALTTLGRGGSDTTAVALAAALEASECQIYTDVDGVYT
TDPRVVPEARRLDRITVDEMLELSSLGSKVLQIRAVEFAGKYRVPLRVLSSFEEGPGTLI
TYEEEGMEEPLISGIAFNRDEAKISVIGVPDTPGIAAKILGAVAEANIEVDMIIQNISQQ
GLTDFTFTVHKRDYQATLDLVRDNAEQLGAREVYGDDKIVKLSLVGVGMRSHAGVANTMF
RALSNEGINIQMISTSEIKISVVVEEKYLELGVRALHKAFELDVQPVAELEGLSDE
>Srub_Ab_|_CG-47
MPDRSFSSTECASRPVRVLKFGGTSVGSADGIKNAVRLVHAATETCRPVVVVSAAAGVTD
ALVQAAEESRADRGSVEAWTRRVGRRYRALAANTLADEALRARYDTALRTELSELRRALQ
EMAGPNAAAARDVVLAAGERLMVPLLAAALDASGCTSQAVDAATLIRTDAAHGDATVQWA
PTRRQVRDWHRTRAAGLPVVTGFVGETADGKTTTLGRGGSDLSAAVLAWALAAERMERWT
DVEGLYTRDPDAHSDAQPLQRIDFEQARAWTKAGRLGMHPCTLDPLMDAGIPLRVRCTHR
PAAPGTRIVPAPTLAQG
>Srub_Aa_|_CG-47
MVFKFGGTSVGRPDRFRTVVQLIREAAAEGRVVAVVSALSGVSRQLASALEAVSTRADGA
TAVETLTDTLRTRHAEQAEAVLCADRKRTYEAILDERLEALRCAFERVEQDIDVPAARDA
VLAVGEQLSVPMVTLALRDAGLHAPRCDATDLVVTDDTFGAAQVQHDDTSERVRAWYRSL
DPAAVPVVAGFIGATEDGRPTTLGFEGSDYSAALFAKLLGAQGLTRYTDVDGIYTDDPDA
NEDAERVDHLSMEEALARSASGGLGMHPKTLRPLADAGIPMQVRSIVAPECPGTPIVPAE
RTADALWPAP
>Ahyd_Aa_|_CG-48
MALYVQKYGGTSVGTLERIEAVAERVEQTRAQGHDVVVVVSAMSGETNRLLGMAQQLDPD
ANRREMDVLVSTGEQVTIALLAIALNKRGCPAVSMTGDQVRIHTDSAYGKARITHIDTEQ
VQAELGAGKVVVIAGFQGRDEHNAITTLGRGGSDTTAVAVAAAIKADECQIFTDVDGVYT
TDPRIEPKARRLDTITFEEMLEMASLGAKVLQIRSVEFAGKYRVPLRVLSSFVDGEGTLI
TYGGERMEAPLVSGIAFNRNEASLTILGVPDRPTVAAQILNPISDANIDVDMIVQNTLGD
GTADFTFTVNRDDYRRARALLEETASELGAACVQGNGEIAKVSIVGVGMWNHPGVARTMF
KVLGEEGINMQLISTSEIKISVVIDEKYLELAVRALHSAFGLDQEPHEQPLGNNP
>Asal_Aa_|_CG-48
MALYVQKYGGTSVGTLERIEAVAERVQLTRAQGHDVVVVVSAMSGETNRLLGMAQRLDPD
ANRREMDVLVSTGEQVTIALLAIALNKRGCAAVSMTGDQVRIHTDSAYGKARISHIDTEQ
VQAELGAGKVVVIAGFQGRDEHNAITTLGRGGSDTTAVAVAAAIKADECQIFTDVDGVYT
TDPRIEPKARRLSTITFEEMLEMASLGAKVLQIRSVEFAGKYRVPLRVLSSFVDGEGTLI
TYGGERMEAPLVSGIAFNRNEASLTILGVPDRPTVAAQILNPISDANIDVDMIVQNTLGD
GTADFTFTVNRDDYRRARALLEETASELGAACVQGNGEIAKVSIVGVGMWNHPGVARTMF
KVLGEEGINMQLISTSEIKISVVIDEKYLELAVRALHAAFGLDNEPHEQPLGNNP
>Nmar_Aa_|_CG-49
MTKLVVAKFGGSAIGPNGVSIPEIIQRITNLKQDSKVIAVFSAPLTLDNGKKRSLTDVML
EQGRNAENGVTPSLDIIKSTYEKILELVDDENKGKCENVIEQNLEKAKKALDEAFESKEF
VDEVRSRALAFSGEILMSHVMNYILRSNKIKAETVDFEDWPIITDNNIESTNFLTSESRT
KMDKTAELVEQNEVVTIGGFIGKTVDNVTTTYERGGSDRTAADLGILFHKSYETSIDFEK
DSAVVSADPKIVESGLREVHQLSYNEARLAGMFGMKILDPIAIKEIVENGVDMPITVTNM
KNPDKITTIKRILDEQKGHPIKIVTGKENCAIFRIETNSIQKLLTSLDKDKRYSEFVILS
PFTKDGIEFSRILFLDGDYVKRNEKYLLGFDSLATITYNRGVITLIGDEMWRVQQVASRT
SAKIGEAGLNILNMDAQEETSRIIIVVEDTKDNIRKAISAIHQEISEINFI
>Csym_Aa_|_CG-49
MERLVVTKFGSSAMGPDGSNMPVILDRIAELGKDAKVVCVFSAPLTQDGGAARSITDVML
DMGESAASGGGFDLSGVKSAYGRVAEHATGQGRAECADIIDKSLRRAGEALGAAEAAGSF
VHEARADALAFSGELLMSYLMDAILRSRGTRSAAVPFDSWPIITDDNPETTNFLHAESEA
RAGALLELVGSHDVVTMGGFIGRTPNGATTTYERGGSDRTAADLGILLHSRYDARIDLAK
DSAVVSADPRVVREGLSPVEELSYNEARQAGMFGMKILDPIAIKEIFENGVDIPIVITDL
ADPRNRTVIRSGPVASNGHPLKIVTGKRNCAMFRAEADSADRLLASLEGEKRYSEFVVLS
PFTKNETEFSRVLFLDGDFVRRNERYLRGFDPLAAVTYNRGVITMIGDEMWRVQQVASRA
SAGLGSAGLNILDMDAQEETSRIIIVIEDSGDNMERAIRAVHAERETIGFV
>Nmar_Ab_|_CG-50
MRLVIKYGGTSISSAKDIRAVANHLNSLSKKNQIVVVCSATSGTTDDLIEISQSIKKENK
SKAEQLASKITNRHKQLAKQTIKKADLRKKLLKNFDDDFAELVALIDGMVLLGEVTPRTM
DYLFSFGERLSIKLVSMAVNDSGKKSVPLTGKEVGIVTDSNFGESKPLIDTTRLRVSKNV
ENLFSKKTVPVVGGFVGADQHGHVTTFGRGGSDYSATIIGTCIKADEIWLMSDVDGLMTA
DPKIVKNAKLLKEVSYIEAIEMALFGAKQIHPRTFEPLLSKKIPMKIRSSFNLKNEGTLV
TASPSPSVKNTVKCVSNVRNNGLIDIQGGSMVGTPGTAAKIFATLAKAGINVMMISQNPS
ESSITIVVKNADLDKAVSSLEMELLGKIIKKLEVTTNVAIIALIGSGMRGTVGVASKVFG
AAEKNKVNVSMITQGSSELNLAFVVKNSDTNAAVRALHNAFALDKIN
>Csym_Ab_|_CG-50
MRLVIKYGGTSMDEPGKIRDAAAFVASQGGEVVAVCSAASGTTDNLMGISGLIRKGDGKG
ARAAADGIMRYTRELAEGAVSVEEDRERLSAALDGALAELNGLIDGMALLGEVTPRSSDY
LLSFGERLSSEILASAISERDRKAEALAGNEAGIVTDSNFGGARPLMDTTGLRVSKKIGG
LLLEGVIPVVGGFVGADQYGRITTLGRGGTDYTATTVGASIKADEIWLMSDMDGLMTANP
RVVGGARVLDEVSYAEAVEMAMFGAKQIHPRTFEPLMGTRIPMRIRSAVNTGNPGTLVTA
SPGPESGRTIKCVSALRHNALIDIRGGGMVGEAGTAAGIFSTLAGAGVNVMMISQNPSES
SITVVIKKSDMDRAVDALEIGLAGKVIKKLEVTPDVAIVALIGSGMRGTVGIASRVFGAA
ASKGLNVVMITQGSSELNLAFVVGDDDCWEAVRALHDEFGLGAPGGRAAG
>Mmar_Aa_|_CG-51
MTRVVAKFGGTSVGTIERIRHAAGLVADAARRGETMTVVVSAMAGETDRILGLAGAFGSG
LGDRETDVALAAGEQVSSALMALALREAGLEAQSFLGWQLPVITDGPPGASRIAGMDVAV
LEAAIDAGIIPVVAGFQGITETGEVRTLGRGGTDLSAAALAAALQARCDIYTDVDGVYTT
DPRVEPDARRLDTISHDEMLELAAQGAKVLQTRSVEFAKARGVPMRVLSSFLEAGASRGT
DVVSEQAIAERRLVSGVAYARDQARIALHGASNRSDMAARCFASLAEAEVGVDMIVQAHA
RQPGTVTLEFSIAHRDLDRAQAVLEDAMTGVRISAETGLAKVSVVGAGLRQRADVARSLF
AVLGDQDIAVKVLATSEIKISALIENDAVERAVRALHAAYGLDQV
>Oale_Aa_|_CG-51
MTAPRLVLKFGGTSMANPERIAHSASIVAAEARAGKQVAVVVSAMAGETDRLLGAAEALG
GGLGETETDTVLAAGEQASAALMALALKREGFQSQAVMGWSLPILVEGPPGGAKITDIHG
EQLDAMLSAGVIPVVAGYQGLNAEGRLATLGRGGTDLSAAAVAAAVGAECDIYTDVDGVF
TTDPRIAPEAVRVERISHDAMLELAAMGAKVLQTRSVEYAKAKGVTLRVKSSFLPAGQSA
GTEVTPEFEIGEKRIVSGVAYVRDQARLSIHGGEGPQAAELLFAALGEADVDVDMIVQAR
ARSGGSVVECSVAGRDLPRALAAAEAAARPNGLEVRSETGLAKVSVVGTGLRGRADVART
LYGVLAREGIAVRMTATSEIKISALVDADYLEHAVRALHAAYRLGSAPSKA
>Oale_Ac_|_CG-52
MDPQLNVSSAPKGLCVLKFGGSVLTSEADYAAAGAEIYRHVRAGEKTIVIVSALKGETDQ
LLAQADANGGAPFPDITARLARLGEFRSAALMGLALSQLGLKAKVLDPHEIGLMAEGDPM
DANLSELDAGALAGALDEADAVVLPGFTACHAEHGAATLGRGGTDLTAVFFAVKAGANRV
RLIKDVDGVYTDDPAKDPHAQRYDALDYDQAMDASRGLIQPKAIEAAKAADLVVEVAAMG
AREATRIASGPAVIGRPRHRGPMKVALL
>Mmar_Ac_|_CG-52
MALPDQPQPDQADRPLKLCVLKFGSSVLFKPDDYARAAHEIYRHVRAGEKVVAVVSALDG
ETDALFGVGNDVGQGCSDALLARLVRCGELKSAALMGLALERSGIPSAVLDPHEMGLRAE
GEALDANLTGLDASRVLKRFASVDVIVAPGFFGEGADGPVTLGRGGTDLTAVEFAHWLGA
DRVRLIKDVDGVYTDDPAKVANAKRFDQLDYDEAARVSRGLVQDKAITRAKEQDVVIEVA
ALGRPYATRIAAVEQRAGDGLEMKPMRVAVLGHGAVGAGVCAHLLAHPGRFTLNPVLVRD
PAQHSAGAAAELSFTDDPARALG
>Mkan_Ab_|_Orp
MRVVMKFGGTSVGTGESIRKVAKIVTDAAEEHEVIVVVSAMSGVTDELVRAAESAPDWTE
EDVKNFVGKLRRRHGKAASEAISSDLIRREVMGYVDSLLEELEKVLLGLSYVGEVTPRSM
DLILSFGERMSAPIVAGALRDRGLEAEHLEGGEAGVITDDGFGEAEPILPACRRKAQKTL
IPMIESGKIPVITGFIGRTIDGEVTTLGRGGSDYSAAIIGCISEADEVQIWTDVDGVMTA
NPNLVPDARTVPRLSYEEAMELASFGAEVLHPKTVIPARSENIPIRVKNTFNPESEGTLI
TSESEPSEQVVKAVASSSDVGMIDIRGTTMIGRPGVAGRIFSRLGDEGINVIMISQSASE
SNISIVVSRPEVRRAARIIEREFVGERVVERVTTYEDVAVVAVVGEGMRGTPGVASRVFR
AVADAGVNIKTISQGASEVNISFVVAEEDEAAAVNAVHSEFELGEEA
>Susi_Ab_|_Orp
MKDLLVMKFGGTSVGSAERMKVAAQLAAQEQKKRPVAIVVSAMSKVTDLLLDTMRHAEAG
DRAGMERNLNLLRERHEQACRELLPASEQGAVLAKLHDVIDEFERIVNGMAMLGERPPRS
VDEAVAVGERLTVVLVSEHLRVSGTPSVAVNARDVVVTDAVFGNASPLMEPTRVKARATL
RPQLEQGLLPVITGFNGATADGRPTTLGRGGSDFSASIVAAALDASELWIWTDVDGIMSA
DPRLVPDAQVLEEITYAEAAELAYNGAKVLHPRTLAPLVEKAIPVWSKNSFAPEKPGTKI
VPSMAVEHGARAVASMRNVALVSLTPASPEVNGVQVLARALEAIARADVEVLVLTSSSYR
QNFCVLVREDELDRSVQALESALALELAHHYVHPIEVDRNVGLLAAVGEGMQGKPGLAGR
IFTAISRVQVNIIAIAQGSSELTIAVVVRREGLEKAVKAVHAECGLGMRPPVPVFPFGAS
EGRAQRPTKR
>FRAN-2a_|_Orp
MAIIVQKYGGSSLATIEKIRGVARRVVDTAAAGKQVVVVVSARGRTTDELLGEARALGGH
WRSRESDQLVSTGEVVSAATTALALRELGQPAVSMTGGQAGIQVSGEFGSAAVHSVTPDR
LRTSLEEGKVVVVAGFQGVDASGDVRTLGRGGSDTTAVALAAALGATCEIYTDVDGVYTA
DPRLVPRARLLPTVPAPLMHEMAHTGAGILHPRAVDLAATRRIPVQVRNSLGTNPGTVVE
VVPGNPLESDGVVAAVTQDEDTTLVMMRGRGEPLDSWAALARMASAKVAPADLFALADST
HGSTLGFTSSPARQIDLAHIARQAGGTVELRDDLGRLSLVGTRMNLCGAVIETLAEILST
HGIRSPWIAISERRISILVPRGGMRRLALTIHDALVLGRGLEAHSSDR
>Faln_Aa_|_Orp
MAGDVVVLKFGGAAFAAPGAHQGIARHVADRLRAGGSSASPGGARAIVVVSAVAGETDRL
GTALRAVSPAPDRDLLAAALMTGETVNVALMTAALRDAGLAAVALTAADTGFVGAGEPHC
ADLRRIDGSVLASLVEPAGTVLVVPGGQAVDGDGRPIMLGRNSSDLSAIAAAIAVGARAC
EIFSDSPGICTADPRLVPDARTLAAVDYDTMITMSRHGAKVLHHSAVAWAQRHGVEIRCR
SLLPDGAVYSVVRAGRTSAAAVLVHGTGTVWAGDPDLVRATLAELGSDAVAIPEAAAVPE
VAVTEVAAVPEVAAVPDVAVTDVAVTEVAVTEVAAAAATAGIAGTAAVGEPVGGTVAHLV
LADAARDLRPRGLRHRADLRLVTTLFPDGRLQHRLVPAAEAPTVARAQHDVVVA
>Twhi_Aa_|_Orp
MSLIVQKYGGSSLASANNLKRVAERVSRAYYGNNRLVVVVSAMGSTTDRLLTLAHEVSVE
PERRELDVLLSTGECVTASLLAMAINSIGLPARSFTAAQAGIVTDEHHCNARIITITPTL
IEDALNAGEIAVVAGFQGVNRKGQVTTLGRGGSDTTAVALAAALKADRCEIYSDVEGVFT
ADPRIVPKARLLESIPIDHMLELSTAGARILSLRSVVFAKRHNVSVKVGSTFSDTSGTIL
CNEGEAMEEPVITGIATDTSQARITIVGLPDIPGSAAEVFSALSVAEVAVDNIVQNFSSS
NTGFIDLSFTSPKAQGPAVTSALRENQTRIGYKDLQYDDEVGKITVVGSGIQHSADISAQ
LFRLLSDAKVNVEMISTSEMRISFVVRANVVAEVARLIHTSFGLDADLRAVVHSEGRV
>Sgri_Ab_|_Orp
MTTQGSRPTGDVVVQKYGGSSLATVSQVRQVADRVGALARSGRRVVVVVSAQGDTTDELV
GRAEAVNPRPAGHELDQLLATGETASAALMAMALQRGGLAATALSGARSGVLATGPHGAG
VIVAVDTDQLRTLLDAGRTVVLAGFQGVTAEGDIITLGRGGSDTTAVAVAAELRSGHCEI
YSDVPGVFTADPRVVPDARLMPDIDIDVMTEMAFAGARVMHARAVELAALYDVDILVGRS
TATRTGTRIHRRDGNDMLEDRTAVSAVVHDADIARITLRTHDTPDPSADVFRFLAKESIP
ADMTTVSSAPDGGFSLGFTVRRSHAADVGRSFSDLMAPRPHGVEVEDQVAKVSIVGQGLL
SRPEYASRMLASLVGSGISARSLTASQLRVSVTVPRSDAVRAVGLLHSEFGLGAEAGAVP
ASLTPRP
>Rxyl_Aa_|_Orp
MSSAEPLVIKFGGTSVGDGEGFARAARITAGAAAEGRPVAAVVSAMSGVTDALLAAAAGT
ATAGTRTARGLARDLRRALGERHLAAARCAVSGDLLPEVEARVLSLLDRLEEELARRALP
EAERRAEIAVCGERLSAEILAGALRAAGAPAAVAADPIATGPGGEEVLSEETRARCTRHV
RPLLEEGLVAVVPGYAGRSPDGAVTTLGRGGSDLSATALGRGIGAGEVWIMTDVDGVLDA
DPRLVPGAATLPRLSYREAGAFAALGAEVLHPRTMEPAAAAGIEVLVRNTFDPHSPGTRI
SARECGPGLRALALRRGLSVEPLEALDGRSGDVFCLLGADVYGIRALVERPSGSAAAVIG
VGSPGDEELAAGLRRLHRAGIRPLWAGNTAAGLAFVVAGSRAEEALRELHAALLRREALA
GEAVA
>Rxyl_Ab_|_Orp
MERRHRQRERPLGIVVQKYGGSSVATAEHIKAVAGKIQRARKAGLDLVVVASAMGKTTDR
LLRLAGEVSSDPSPREIDQLLATGEEQSVALLAMALHDRGVPAVSLTGPQAGMRATGRYG
SGVISEIRPGRIRRLLGEGRVVIVAGFQGMNALGDVMTLGRGGSDTTAVALAAALGADRC
EIYTDVDGVYTADPRIVPGARRIPVISYAEMSEMAWRGAKVMHPRAVELGALYGVEIHVL
SSFDEESPGTIITGGEKVEHLETRETVAGIVHDTDVARITLNGVRTGPGTLSKVFTPLAE
RGISVDVIVESGIKEGVADIAFTVSRADFAEARSAAGEVARALGGSVEGEEGLAKVSVVG
TGMLNRPGYAARMFSALGSEGIPIRMVSTSEIQVTCVIPAERVQEAVRRLHRDFELEERE
DV
>Aaeo_Aa_|_Orp
MKILVQKFGGTSVGTLERIELCAKRVIKALEKGYKPVVVSSAMAGETDSLIELAKKVHPR
PPEREMDTLLAVGEQKAIALFAMTLNKLGYPAVSLCGWQVPIITDNVHTKARIRKIGISR
LLSLIEEGYIPVVAGFQGVTEDWEITTLGRGGSDTTAVALAAALKADCEINTDVPGVFTA
DPRIVPNAKKIKKISYEEMLELASLGAKVMQIRSVEFAAKYNVRIHVRSTFSEEEGTWIV
PEDEVMEKVAVRGITVDTKETRFTVVRVPDKPGIAAEIFKALGDAHIVVDMIVQNVSHEG
YTDMSFTVNKTDADKAEEIVKKIAQKIGAKEVVRDDKVAKISIVGIGMKSAYGVAGRMFD
ILARNGINIKAISTSEIKISCLIDEKYAELAVRALHEEFIEEMEEFETINGKNKE
>ROSE-4a_|_Orp
MPLLVMKFGGTSVGDAAAIQAVAAITEAQRAAWGRVVLVVSAMSGVTDMLIRGATTAASG
DKHTFRDLDRMLREKHAAALAELVPDDQERTAIDDQIARLIDEFSILCHSVAVLGELSPR
AIDAISSLGERMSVRVVAAALRARGIPAEALDASEFVVTTAHFGDARPLQEVTRERTRAR
ILPLLGRGIVPVITGFIGATEQGVTTTLGRGGSDYSGAIIGAALDADEVDIYTDVDGVMT
TDPRLAPDARVIPVLSYAEMGELAYFGAKVLHPRTIRPIVERGIPLRVRNTFNPYHPGTL
VVQDVESNGQTVKAVTAIRNLSLVTVEGRGMIGVPGVAARTFGAVASVGANVLMISQASS
EQSICFVVPSSTIPQVTYALEHNLAMELARRDIDRIWAREDVAIVTAVGAGMRDTPGVAA
RVFGALADNHINVIAIAQGSSECSISTVVAAADCDAAVRAVHRLTGV
>ROSE-4b_|_Orp
MVVMKFGAVAVSDASRVNDLVRIVRHAIDEGEAVVVVCTAIADLTNLLIGAGRAAARGNL
TAAEQARRELWQRHRTLAERLVTDDWERETLYRAWADLLKSFDRIVRAIATLGEHSPRSS
DAVAAIGERFIGLLLAVALRRGGVAAQLIDGAELIVTDDHFGNARPLPEETTARARARLL
PLTQSRIVPVVTGYIGATRQKITTTLGRGGGDYSATLIAAALEADEVVIWTDVPGILTAD
PKLVPEARTLPELSYIEATEIATLGAEVLHPRSLTPLANRNIPLHIRSLEQPHIPGTRIV
AAPHISSDTARTIISAPSISLIEISMSPLAAAELGWAPDLAARILAELTGCGIEVLTFAQ
SFSERGLVLAVRATDAEYAYERIEACLQPERDSKALRAISLRAPVALVAVISAPESTRLA
PRALTALARVQGTVLAMVHGNTSRHLSFIVPEEELSAVVRALHRELMAG
>Tthe_Aa_|_Orp
MLTFSFKPPGGAGKEGSVALVVQKYGGTSVGDLERIHKVAQRIAHYREKGHRLAVVVSAM
GHTTDELIALAKRVNPRPPFRELDLLTTTGEQVSVALLSMQLWAMGIPAKGFVQHQIGIT
TDGRYGDARILEVNPARIREALEQGFVAVIAGFMGTTPEGEITTLGRGGSDTTAVAIAAA
LGAKECEIYTDTEGVYTTDPHLIPEARKLSVIGYDQMLEMAALGARVLHPRAVYYAKRYG
VVLHVRSSFSYNPGTLVKEVAMEMDKAVTGVALDLDHAQIGLIGIPDQPGIAAKVFQALA
ERGIAVDMIIQGVPGHDPSRQQMAFTVKKDFAQEALEALEPVLAEIGGEAILRPDIAKVS
IVGVGLASTPEVPAKMFQAVASTGANIEMIATSEVRISVIIPAEYAEAALRAVHQAFELD
KA
>Sthe-17_Ab_|_Orp
MGLVVQKFGGSSVATAEKYRRVARRIAWKKRQGNDVVVVVSAPGDMTDDLIERARSITDR
PSAREMDVLLATGEQISIALLTMALHELGVDAVSLTGPQAGFQTDDHHRAARIVNIDTAR
IRRELAAGRVVIVAGFQGMDDHGDITTLGRGGSDASAIALAAYLSADQCQIFTDVDGVYS
ADPRIVPTARRLDEISYDEVLELAAAGAQVMQLRSVELAKQYGVEFEVLSSLAPLPDEGG
EERGTKVVAKLSPNNHRIVSGVAVDSKVAHITLLGLPDRPGVAYRAFKALGDARINLDMI
VQSAGTGCGNGPTADISFTCARDDLETALEVCNRLLPEFPGARVVYDTDVAKVSIVGSGV
ASNYGVAARMFEALAEKDINIELITGSEIKISCLVRASRAMEAVRAVHDKFELGDVAPIV
>Chyd_Aa_|_Orp
MLVVQKYGGSSVANPERIKNVARRVAEYYRAGHRVAVVVSAMGDTTDELLDLMGEISPNP
PAREIDMLLSTGEQVSVALLAMALHELGVPARSFTGLQAGIYTDEVHTKARITEIKPERV
IACLNSGKVAVVAGFQGVNREGDITTLGRGGSDTTAVALAAALKADICEIYTDVDGVYTA
DPRIVPDARKIKEISYEEMLELASLGAVVLQPRSVDFARNYKVEVHVRSSFNYNEGTVLK
EERDLEKKGVVTGVAHDKNVVKIGVFGVPDQPGVAYRLFSELAAHNINVDMIIQSAGKEE
GQNDISFTIGKNDLAKTVEILEDVVKKLSARGYTYDEKVAKVSIVGAGMVTYPGVAAKMF
EALYEENINIQMISTSEIKVSCIIAEDAVERAVNAIHKKFELGNGV
>Swol_Aa_|_Orp
MSLIVAKFGGSSVASIDKIKHIAGRIKGMRDKGDDIVVVVSAMGDTTDELIELASLTGHD
LCKREMDMLLATGEQQSAALLALTLNNFACSSISLTGWQAGIKSDDSHSKARITGIETGR
IKNELKQGNVVIIAGFQGLSPQGDITTLGRGGSDTTAVALAACLDALRCMIFTDVEGVFT
ADPRIVKEAKKLPQISYEEMLEMASLGAGVLQPRAAEFAMLYNVDVEVLSSFSHNPGTII
TEVANMENHRAVSGIAHDLNCARFALFDVPDQPGIAKTLFKTLAAENINVDIIIQSAMRD
GRNDIAFTIEEKELSRAIPVVEGLVKKICASGMTYGNDVAKVSIVGAGMQSNIGVAAAMF
EALADEGINIHMISTSEIRVSCVIDECHIKAAIKALHRKFELDKIE
>Mthe-3_Aa_|_Orp
MALIVQKYGGTSVNGPERVKNVARRVVNTRRAGNDVVVIVSAPGDMTDDLIAMAHEISPN
PPAREMDMLLATGEQTSIALLAMAIHELGEPVISLTGPQVGILTDNVHSKARIMEVSCER
LRRELEQGKIVIVAGFQGKTCEGEITTLGRGGSDTTAVAVAAALKADVCQIYTDVDGVYT
ADPRVVPEARKLPVISYDEMLELASLGAQVLQPRSVEFGKLNHVVLEVRSSFNDHEGTLV
KEVTEMERKMVVSGVAGDRNVARIALHDVPDRPGIARTLFVALARESINVDMIVQSAMRD
GINDIAFTVGRDDLQKAVEVTERVRQEIGASKVTSNDRVAKVSIVGAGMITNPGVAADMF
ACLAEEGINIHMISTSEIKVSCIIDEEHLTRAMQALHRHFKLDRE
>Rbal_Aa_|_Orp
MSLIVQKFGGTSVADTEKIRAAARKAIRAQKAGHRVVMVVSAMGKNTDTLLDLASQISDE
PPAREMDMLLSTGEQVSVALVAMAIHSMGSKAVSLTGGQIGLKTDNSFSKARIQSIDTGR
IERLLDAGNIVVAAGFQGIDDDLNITTLGRGGSDTTAVALAAVLGADACEINTDVDGVYT
TDPRLLAEARRVDVISYDEMLELASLGAGVMHSRSIEFAKKFEVPIHVRSSFSDQDGTMI
VAQPESETAPVSGAALTRDEARVTVLGVPDVPGMSQKIFSAIAAQKVAVDMVVQNVGTSG
KADVSFTVAGGELKKTLAALEGILDSLGADGVTHDDQVSKVSVVGLGMAHQKAVAASMFR
ALAEANVNIHMITTSEIKISCLVPRDQANEALRAVHEAFSLDQRPSDAKTWNEIKASNAK
EADVADVVARLQNDALEALTLTDISIVPAQARVTLDGVPDQVGVAADMFEQIGEAGIFVD
MIVQGYDGEDGSTSVSFTVEQADLDAAQKVAREICGKHSMRDVRGASGITKLSVSGIGLR
SHTQVGTVLFEQLASAGINVEMIATSELQVNVVIQSDQAGDAATRLKQAFAEALH
>Pubi_Aa_|_Orp
MKTVVLKFGGTSVGSIDRIKSVAKIISSYKKKKMGVIVVSSAMSGTTNELIKKTKELSNT
FDAAEYDVLLATGEQATCALIAGRLKHLGFKARSWMSWQLPIITEGPYSSSRISKINKGK
ILSFMKSGGIPIITGFQGINLENRLTTLGRGGTDASAIMLAKFFNTDACDIYTDVDGVYT
TDPRNHSKAKKIHKISYDEMLEMASLGAKVMQPTSVQDAKLNNINFSVKSSFQKKKGTLI
TGTKKTFSNQIITGITSTKNDSKVTIVGVKDRPGVAAAVFKPLSLNQINVDMVVQNISLN
GKETDLTFTIKSEDVKKTEKIIKQNKRISFRKLTYDNNVSKVSIIGVGMITTPGITYRMF
QALASKKINIMVISTSEIKISVLISNKQIKKAVAVLHKEFKLD
>Mxan_Ab_|_Orp
MALIVQKYGGTSVGDVARIKSVALRCLAAQEAGHDVVVVVSAMSGETNRLMKLVAQITDR
PDEREQDVVVATGEQVSIGLLAMAIHAQQGKATSFLGQQVRIVTDSTFAKARIKSIDAQP
IRAALARGHIVVVAGFQGVDESGSVTTLGRGGSDTTAVALAAALNADACEIYTDVDGVYT
SDPNMVPSARKLDRITYEEMLELASVGAKVLQIRSVEFAMKYKVPLWVKSSFTDDPGTLV
CEEDSSMEDVLVRGVAYDRNEAKITVCGVPDVAGAAAKIFGPLDEKHIVVDLIVQNPSKD
GRTDVTFTVGKADFLTAQEVVRKVAEEIGASGIETDGDIAKVSIVGVGMRNHSGVAARMF
RALSAEGINIQMISTSEIKVSCVVQAKYTELAVRALHTAFGLDQPMPPEGVSAVSEMAAL
MGEKV
>Mxan_Ac_|_Orp
MRVMKFGGTSVGNAERMRGVADLAAAARKQTRVMMVASAVSGITNLLLEAARAAQEGQPV
ESLHGRFEDVHRGIIRELAPELGEARQRSLEEGLSTLASELRGLLQGVGLLRECSPSVLA
HLSGLGERAACLILGALMHARGLEPHAVEPRDVILCAGDPLQATPLQEETRARFTPLREA
GGPGLMLMPGFFGGDTRGKTMCLGRGGSDYSAALAAAALDAELLEIWTDVDGIFSADPRL
VPEAFPLPEVSFEEAMELAYFGAKVLHPKTIAPARERGIPVRVCNSFRPDHPGTRVTDDA
APPEHPVRGLSFLPGIALVNLGGAGLKGVPGTAARVFESMALANISVVLITQGSSECSIS
FCVQQADAERAVQALEVAFEMERAAGKVDTIEQQRGLAVLSIVGDGMRHRVGVAGTFFSA
LADVGCSIAAIAQGSSERSISAVIAETDGPRALAHVHGRCFGTTEVVELLLA
>Mxan_Ad_|_Orp
MMKFGGTSVGSPTRLRQVVELIGKHARQGPLAVVVSAMGDTTDWLLDAAHLATEGDLEGA
LAVATRIADLAKANAAALAPGQATALAERVDGLLAPLRQLLHGVSLTRECSAPTRDRVLS
FGELVSATLLAELLTAHRTPATFRDARQLLVTDDRFGAARVDLVRTRERLQAARETWGVE
VPVLPGFIAATPDGRTTTLGRNGSDYTAALVAQGLGASEVTVWTDVLGLHTADPELVTDA
YPVAHLTHGEGLELAAVGARMLHPRTMIPLIESGISLRIRNTMEPEHPGTLIDAIGSRDG
QRPACIATREDLALLGIEVRKLSDQFQLGERVLAALREARVTVWMTAQSANGQSLAVVVP
RPDAEHARSVLVTELAQELSRREVEPLEVRQPVTLLTLVAETMGHGVNVAGRFFSALGAV
GVNVRASAQGASSRSLSCVVDAADTAVAARTTHAAFNLAHQQVSLFVL
>Sfum_Aa_|_Orp
MALVVQKYGGTSVANPERIKAVAEKVVGRRRKGDDLVVVLSARAGETDRLIALAHEVSLS
PDAREMDVLLATGEQTTVALFSMAVRNLGVEAISMTGYQAGINTDRSYGQARISGIETRP
IMEKLHEGRIVVVAGFQGYDDEGNITTLGRGGSDTTAVALAAALGADVCEIYTDVEGVFT
ADPNVYSKARKLDRISYEEMFEMASMGAKVLHLRSVEFGMKYHVPIMVLSSFTDAPGTLV
TKEDEEMEKVVVSGITYNKNEGRITITNVPDQPGMAARVFRPISDAGINVDLIVQSGAGI
PGRADISFTVPKTAHKKAMEIVEAVAREIDAGPVHGNASIAKISIIGLGMRNHSGVAAKM
FDSLARENINLKMISTSEIKISCIIEEKYAELAVRVLHDAFELETAPHGRIEVQEET
>Phal_Aa_|_Orp
MALIVQKFGGTSVGSIERIEAVADLVVKTKQQGHQVVVVLSAMSGETNRLINLAKQIDTR
PSSRELDVLISTGEQVSVALLAMAIIKRGHSAVSLLADQVNILTDNMFGKARITDVAATR
LKHELEHNRIAIIAGFQGRDIEGNVTTLGRGGTDTSAVEIAGAIKADECQIYTDVNGVYT
TDPRVEPNARRMSQVTFAEMLELASLGAKVLHIRSVEAAGKHNVPLRVLSSFYPDAGTLI
SFEESDMPGNVVSGIAFNRDECLINVEGVLSGTQYLAKILKLFADNGIEIDMINQVNHNV
DKVDYAFTVHTNDYLHALDVLTEQQAQLTAQNIFGLTTVAKVSAVGMGMKSHSGVASLFF
DALAAENINVILVSTSEIKISVLIDEKYLELAVRALHKIFLTENE
>Ping_Aa_|_Orp
MALLVQKYGGTSVGNIERIKSVAEKIKATKADGHDVVVVLSAMSGETNRMIALAKEITAN
PSPREMDVLLTTGEQTTIALLSMALHSLGLDAVSMTGDQIRLKTDSCHSKARILDVETKN
IKEHLKLGRVVVVAGFQGRSETNEITTLGRGGSDTSAVAIAAALKADECQIYTDVDGVYT
TDPRVEPNARRLDRITFEEMLEMASLGAKVLQIRSVEFAGKYNVPLRVLSSFKDGGGTLI
CYEENKMESPVISGIAFNRDEARLTLSGVPDKPTVAAQILSPIGDANIDVDMIVQNTLGN
GKTDFTFTVHRDDYEQTKELLEKVCVLLHADNVQGNKEIAKVSVVGVGMWNHPGVAKTMF
ETLGQEGINMHQIATSEIKISVLVDSKYLELAVRALHKAFKLADDPTEEK
>Dnod_Aa_|_Orp
MALIVQKYGGTSMGSVERIETVADRIVRARQAGHDVVVTVSAMSGETNRLIALAQRFAAQ
PSPRELDVLMSSGEQVSMALLAIALEKRGCPALSLAGWQVGIFTDSQHTKARIQHIDDGA
IYRALSAGKVVIVAGFQGVDEAGDITTLGRGGSDTTAVALAAVLKADECQIYTDVDGVYT
TDPRIEPRARKLEQISFVEMLEMASLGSKVLQIRSVEFAGKYHVPVRVLSSFSDDETGTL
ISSVEGAIIEATHVTGIAFTRDEVMIQLMHLPDDMNTLYQILRPIGCADISLDMVAQTRN
DDGSINFSFIVPHQEKDRVIEFIVEQFSHIAALSVLQTEIAKISLVGLGLRSHTGIIGRI
LQALMQENIPVHCFATSETRVSLVTDLLYLERAVHCLHDAFQLEKADECRESF
>Cbur_Aa_|_Orp
MALIVQKFGGSSVANLEGIQNVARLISEARQEGHSVVAVVSAMYGETDRLIKLAQSISGS
NWREYDALISTGEQVSAALLSMALEARNCPAHSYTAAQIRLRTTNEHKKARIVDIDPEIL
HSDLKEGRVPVVAGFQGVSDAGDITTLGRGGSDLTAVALAAALEADECQIFTDVDGVYTS
DPKIVPQARRIPKITFDEMMEMSSLGAKVLQNRCLEFAGKFKVPVRVLSSLRKGPGTLIT
FEWDSAEQPLVSGIAFDRRQAKLTIQGIPERPGLASYILGPISKANIEVDMIVQNVPTID
ANIDFSFTLPRDDYKDAFSIMKQVANELAAGAVLGSDQVAKISLVGVGMRSHAGIASQMF
SALGQEGIHIHLITATEVKISAVIDEKYLELGARTLHSAFKLNQEIKFT
>Mcap_Aa_|_Orp
MALFVHKYGGTSVGSPERIKNVAKNVIRARSRGDDIIVVVSAMSGETNRLVALAHEMHER
PSTREMDVLLATGEQVTIALLSMALEAAGCPACSYTGGQVRILTDDAHTKARILDIDTDR
IRSDLAAGRVVVVAGFQGITEAGDITTLGRGGSDTTAVALAAALKADECLIYTDVDGVYT
TDPRIEPKARRLDRITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSSFAAGPGTLI
TYEEASVEKPLISGIAFNRDEAKLTVKGVPDKPGVAYQILGPVAHANIEVDMIVQNVAED
ATTDFTFTVHRNDYRKALDILQATCTALGAREVTGDDKIVKVSLVGVGMRSHAGIAARMF
EALAREGINIRMISTSEIKISIVVDEKYLELAVRTLHEAFNLDREPDAV
>Csal_Aa_|_Orp
MALYVQKFGGTSVGSVERIKAVAEKVKRFRDEGHQVVVVVSAMSGETNRLIDLASQINDE
PTPREMDMLVSTGEQVTISLLAMALHKLDVEATSYTGAQVGIRTDSAHTKARIQRIETDD
IQADLDDGQVVVVAGFQGVDDEGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVCSKAQRLSAITVEEMLELASLGSKVLQIRAVEFAGKYNVPLRVLSSFEDGPGTLI
VAEEEETTMEEPLISGIAFTASEAKLTLLNTPDVPGVASKILGPIADANIEIDMIVQNVA
PAGDYTDFTFTVAKSDYKQTKSILQDQVIPALGGGELRGDDNIAKVSLVGVGMRSHAGVA
SKMFRVLADENINIRMVSTSEIKISVVIDEKQMELAVRALHTAFGLDKDSIQGE
>Tcru_Aa_|_Orp
MALIVQKYGGTSVGNVERIQNVADKVAKFIDEGHQVVVTLSAMSGETNRLTALAKEVQEQ
PSRREMDVLLTTGEQVTIALLSMALQQKGYDSISYTGWQVPIKTNDIHSKARIEEIDSDK
IRNQLDQGKVVVVAGFQGVTPEGDITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
TDPRVVPEAKRLDVVTFDEMLELASLGAKVLQIRSVEFASKYKVPLRVLSSMKEGGGTLL
ISEEDFEDLDMEKPLISGIAFSRDEAKLMILGVPDKPGVAYQILGPISDANIEIDMIIQN
QSVDGTTDFTFTVARGDLHAAQKILEKTAESLGAREVICDDTIVKISMVGVGMKSHSGIA
STMFKTLADHNINIQMIGTTEIKISVVIEESYLEEAVQALHAAFELDK
>Crud_Aa_|_Orp
MIIIQKFGGTSVGTKKRIKSLKNIIKKYRNLNIRIVIILSAMSGETTKMLRLAKYFKYKK
LKSIDFMLCIGEQMSVSLFNLLLNSVKILSIPLISSQIGFITNNNYSNARIILIKNIVLI
KKILKKKQIPVLTGFQGITLNGNLTTLGRGGSDTSAVAISIYLKATECQIYSDVKSIFVS
DPRICLNYRINFLPFENMLELSSLGSKILFVRSIELARKYNVNIRLLSSFFKKKGTFISK
KKKFVNSMERVLISGISYTSNEVKITVANIPNVSGVLSKILGPIISNGICIDMVIQNSLN
HLKFTNFTFLIEEFFLKKVIFLIKKFFITKIGGRVEYEKHISKVSVIGIGLRSHNYIIGK
IFYSMSKLGINIILVSTSETKISILIKKKFTVLAIKNLYKIFNKQFFVKRNG
>MAGN-2a_|_Orp
MKRVDVALIVLKFGGTSVGSIERIRNVARMAMAEQQAGNQVVVAVSAMSGETNRLVGLVE
DLTQFYNKREYDVVVSAGEQISIGLLATAIESMGQKAKSYLGWQVRFITDGSHSKARIKE
VEAFRIQADLDAGAIVIVAGFQGVDSHNNITTLGRGGSDTSAVALAAALKADRCDIYTDV
DGVYTTDPRIVTKARKMDRISYDEMLELASLGAKVLQTRSVELAKKYSVPVRVLSSLEPG
SGTMLTKEEDTMESVVVSGLAYDKNEAKITILGVPDKPGVAANLLGRLGDANINIDMIVQ
NVSPAGDATDMTFTVPKADFPQAMKVMEDAVKDVGARQLQGNSDIAKISAVGVGMRSHSG
IAQKMFKALADEGINILMISTSEIKISVVIEEKYTELAVRALHDAFELEKDPSDRINA

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3