[Bio] / FigWebPages / ask_cg_all.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_cg_all.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Afum_Aa_|_CG-01
2 :     MLNSCICKAACSCHTRPSSMGDQVQSDSSPYTLSMTNGSSNWVVQKFGGTSVGKFALNII
3 :     DHVVLPSLRENKVAVVCSARSSSTKAEGTTNRLLRAARDAEDAQSHEYVSLVEAVRLEHV
4 :     QVVEIQIKSEPLRTQLISEINGECERVLKVLEAAQTLGEISARCVDKVISTGEKLSCRLM
5 :     AAFLQDRGVDSQYVDLAEVIDFPIGSQGLDQDFYNNLATVLGRKIRDCEGRVPVVTGFFG
6 :     TVPGGLLDQVGRGYTDLCAALVAVGVHAKELQVWKEVDGIFTADPRKVPTARLLPAITPA
7 :     EAAELTFYGSEVIHPFTMEQVIRARIPIRIKNVMNPKGDGTVIFPDSTYELERTTPGHDP
8 :     RLFRTRSPSLMQRPKRPTAVTIKHKILVINVHSNKRSLSHGFFAGIFSVLDRWRLSIDLI
9 :     STSEVHVSMALHSEMPLLNGVGRDEYQIIDEDLKGALNDLQKYGTVDIIPEMAILSLVGK
10 :     QMKNMIGVAGRMFTTLGENNVNIEMISQGRCPYLVLLD
11 :     >Psti_Aa_|_CG-01
12 :     MSVSPPLSAKSYNSIVDLRFTASKPQGWVVQKFGGTSVGKFPENIVDDIVLVFSKTNRVA
13 :     VVCSARSSQTKSEGTTSRLLKAADIAAESGDFQYMLDVIEDDHVKNAEARVKNKTIQQKL
14 :     VADTKREIAHAAELLRACQVIGEISARSLDSVMSIGEKLSCLFMAALMNDHGLKAVYIDL
15 :     SDVIPLDYDFTNGFDDNFYKFLSQQLSSRALALSEDTVPVLTGYFGTVPGGLLNGVGRGY
16 :     TDLCAALVAVGVQADELQVWKEVDGIFTADPRKVPTARLLDSVTPEEAAELTYYGSEVIH
17 :     PFTMEQVIKAKIPIRIKNVVNPKGSGTIIFPDNVGRRGEETPPHPPEAYETLSSSFVLSH
18 :     KKRSATAITAKQDIVVINIHSNKKTLSHGFLAHIFTTLDNFKLVVDLISTSEVHVSMALQ
19 :     ILQDQELQLKNALKDLRRMGTVDITRNMTIISLVGKQMVNFIGIAGNMFKVLADNRINIE
20 :     MISQGANEINISAVINEKDTIRALQSIHAKLLEGTFGFDDHVESAVDLRLESLKFQ
21 :     >Scer_Aa_|_CG-01
22 :     MPMDFQPTSSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYT
23 :     KAEGTTSRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELEL
24 :     VKKYLNASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA
25 :     SALDNSFYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALI
26 :     AVAVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVI
27 :     RAKIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKN
28 :     DIFVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQ
29 :     AEEKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINI
30 :     SCVINESDSIKALQCIHAKLLSERTNTSNQFEHAIDERLEQLKRLGI
31 :     >Fneo_Aa_|_CG-01
32 :     MTRDFDSLFFTGPIFVDYSFTARHLESFLSSFPPQVSHAMSSASTPTAPYLEDLVRNSLD
33 :     QTLPWVVQKYGGTSVGKSLDNITKIVGSYIDNGSKVAIVCSARSTQTKSLGTTNLLLQAS
34 :     REALQPALSSSGDGRSGSMSGTATPFYPKRVGSGFFGKDQSTSMVSSVSSLSQLEPQLGR
35 :     SGSPSPFQSSSSRSPPRSPATPSQDSSVSQEPAFHATVDLIKKGHLEAARASLKEGPLRD
36 :     ELEEEIERDCESLRSFLYAAQIIDEISPRSQDSIVGTGERLACKIVAAALRDRGVDSELV
37 :     VLDNIVDASMSAASEAISVDAGDQGVAQLGQEFYDQLSFRLGERLRECGQRVPVVTGYFG
38 :     PVPGSLLAQIGRGYTDLCAALCAVGLKASELQVWKEVDGIFTADPRKVPSARLVPIITPD
39 :     EAAELTYYGSEVIHPFTMEQVIRARIPIRIKNVENPSGAGTVIYPDLGFPRGLDTEPPKA
40 :     ERIVEGVDERMPTAVTIKDEIIVLNIHSNRKTLSHGFLARIFGTLDRAGVVVDLISTSEV
41 :     HVSMAMQDFLNRKRLERLVKDLEKIGEVTVSKDMAILSLVGRNMRNAIGSAGLMFASLAR
42 :     AMINIEMISQGASEINISCVIENKDAIKALNVIHESCLSYPRSPATEMAGLQLQ
43 :     >Hnep_Aa_|_CG-02
44 :     MKRTVEKIGGTSISNTQVVLENVLIGGRKGADLYNRIFVVSAYSGMTNRLLEHKKSGEPG
45 :     VFSLFAGAGNKWAWTEALASVAEAMEAKNAEMFSGEPEQAVADNFVRERIEDVRNCLIDL
46 :     HRLCSYGQFRLDENLTTVKEVLSSLGEAHSAFNTALLLQKHGVNARAVDLTAWRDERDLT
47 :     MEERMEDALGGIDLSSELPIVTGYASSRDGLVRQFGRGYTEVTFSRLAAFVQADEAIIHK
48 :     EFHLSSADPNLVGQDRVRKIGLTNFDVADQLSNMGMEAVHPKAAKILRQAGIPLRVKNTF
49 :     DPKDGGTVISADYAPENPRAEIVTGLKGVFALEVFDQDMVGEKGYDSTILDALTRHSIRI
50 :     VSKCSNANTITHYIEGSRKALKRATADIETKLPGAEVSTSRVAIVSVIGADINVPGITAK
51 :     ALTALHEAEVPIIGLHQVSRKTDIQAVIQEDDFDKAICALHEALVEQVSVATPRAEALRP
52 :     AA
53 :     >SILI-1b_|_CG-02
54 :     MTHTVEKIGGTSMSRVNELVGTLFTGGRKPDDLYGRVFVVSAFGGITNLLLEHKKTGEPG
55 :     VYARFADAESDHGWHEALSRVGDEMRKAHEAVLENAGDVAQADAFVSERIEGARNCLIDL
56 :     QRLCSYGHFRLAEHMLQIRELLSGLGEAHSAYVTALLLQRAGVNARFVDLSGWRDEGDVT
57 :     LEERISSALNDVDPATEMPIVTGYAQCAEGLMREFDRGYSEVTFSCLAALTGASEAIIHK
58 :     EFHLSSADPKLVGEGVAQKLGHTNYDVADQMSNMGMEAIHPKAAKTLRQADVPLRVTNAF
59 :     EPEDPGTLIDDKPADQPAVEMITGLDIIALELFEQDMVGVKGYDAAILEVLTRHDVRIVS
60 :     KTSNANTITHYLDTSLTVLKRVEKDLAKIYPNADISARLLSMASAIGRDLKGLSVLTRGL
61 :     QAIADVGLASLGASQGPRNVDVQFIVEREDLKPVISALHKVLVEGRPAKQEKPIKAAA
62 :     >Acry_Ab_|_CG-02
63 :     MSMAPSVEKIGGTSIAATDAVVGNVLIAGRAGRDLYRRIFVVSAYGGITDLLLEPKKKTD
64 :     AAKPPGLYASFAADGEKGDWRDALDAVAAAMRARNEEVFGTSPERAVADDFVAARIGETR
65 :     ACLDDLDRLRGHGHFRLDEPLATLRELLAGLGEAHSAHNTALLLRARGVNAAFVDLTGWQ
66 :     DGRNLDLDERIRTGLDGIDSATTLPIVTGYVKCSDGMVRKYDRGYTEMTFARLAVLTGAR
67 :     EAIIHKEFHLSSADPKVVGVGKARKIGRTNYDVADQLANLGVEVIHPGAARGLRQAGIPL
68 :     RVRNTFDRHDEGTLICADYVSAAPRIEIVTGIRELRALQFFEQDMVGKKGYDAAILDTLT
69 :     KHRARIVSKSSNANAITHYLAAGGPTVRRVIADLEARFPNAEVSAPRLAMVALIGSDLSA
70 :     EGCVGRALDALGAAGIGVKAMQHQMRNVDIQFILDTDRFDDAIRALHAALVECRATQDGK
71 :     GGTLRTAA
72 :     >Sala_Ab_|_CG-02
73 :     MSGQHSVEKIGGTSMAATATLFDNVLIAGRSGADLYNRIFVVSAYAGMTDLLLENKKTGA
74 :     PGVYGHFVDDDDADAWRRAMAAVRAAMHARNADMFARGDSRAEADRFVDARIDAVTACLD
75 :     DLARLRSHGRFGLKDQLATVRELLAGIGEAHSAHSTALLLRDRDVNALFVDLTLWDQDDL
76 :     RSLDERIGEAFAAIDLRDTLPIVTGYAGCEGGMVRRYARGYTEMTFSRLAVLTGAREAII
77 :     HKEFHLSSADPKLVGEDKARKIGRTNYDVADQLANLGMEAIHPGAGRGLRQSGIPLRVRN
78 :     TFDREDEGTLVTGDYVSDVPRVEIVTGLRQVQALQFFEQDMVGVKGYDAAILDALARHKL
79 :     WIVSKSSNANTITHYLSASAAAVNKAIADLQGHYPDAAISAQPVAMVSVIGSDISRPGLV
80 :     PDALRALDAAGVTMIAMQHQIRNVDVQFLVDPRDFEAAVRALHKALVERDARTEEKRRAA
81 :     >Dole_Ab_|_CG-02
82 :     MGNHTVEKIGGTAMSQFDKVLDNIIVGDRKEKDLYNRIIVVSAYGGITNELLEHKKTSDS
83 :     GVYSLFSKDDDSWAWGEAITRVGQRMCTINKGFEHLGLDVQLADRFVKERIEGVRSCLID
84 :     LTRLCSFGHFKLDEHLMTVREMLSAIGEAHSAHNSYLILKSMGINARLMDLSGWMDTDQL
85 :     SLDETIKKAFESVDVAEELPIVTGYTQCKEGIMGSYDRGYTEITFSRIAVLTGAREGIIH
86 :     KEYHLSSGDPKIIGEDRVETIGSTNYDVADQLSDLGMEAIHPGAARGLRKTDIPLRVKNV
87 :     FEPDHPGTLITNDYRSTDARVEIIAGRKGVTGIEVWDQDMVGRWDHDLEMLKHLAAAKIR
88 :     YLAKDTNANTLTHYIAAPLAKIKRLTDNIKQDFPSADILVKKVALVSAIGTNMADTWVLP
89 :     TAVHSLTNAGVEILGLHKCMRQVDIQFVVDEKDFQNAICALHRDLVETGR
90 :     >Dpsy_Aa_|_CG-02
91 :     MMVRIMKPLRIEKIGGTTMSRFGEVLDNVIFYDSEDIFNRIYVVSAYSGVTNALLEHKKT
92 :     HQPGIYQTFVQNEACDMAMERLKTTLCEINRGFADIGLDLEVANNFICKRIQDAVEVLHS
93 :     MANVLSSGYVNRSEMLLAARELLASIGEMHSAFNSANILQNRGYKASYVDLSGWQDSRDM
94 :     TIDQRILETFTKFDPSDTICIATGYAKGREGIMREFDRGYSEVTFSKIAVLLKASEAIIH
95 :     KEYHLCSGDPLIIGEDKVHPICNTNYDVADQLADVGMEAIHPKASKQIEIAGISIRIKNS
96 :     FDPSHSGTLFTKEYICPQSKTEVITGSDKVTCLEVHDTRMVGEVGFDMKIMEVLSAHQVS
97 :     YINKATNANTIGVIVYDNDCTEELLRDLRAEFELVTDMHTAIVCAIGSNIAKPGILAKAT
98 :     NALATSHINILAVSQTSRQTNMQFIINREHFKEAQRVLHAALCEEGES
99 :     >Adeh_Ab_|_CG-02
100 :     MWRTFGYHRGPSSPGPESRTATQSPGTFRMISVEKIGGTSMSRFDEVLRNIMLRDPSRVY
101 :     GRVYVVSAYAGVTNQLLEHKKTGEPGVYARFANGGDFTTAIEALTGKLKAINAGLAPLGL
102 :     DLARADGFIEKRMKELRALLDSMRHVLASGYVRRDSVLLAAREMLAAVGEAHSAFNSVEL
103 :     LRAKGVEASLMDLSGFDDDDPLTIDERIHKCFTGVDVTRQVVVVTGYTKGVEGIMREFDR
104 :     GYSEVTFSKVAVELRADEAVIHKEYHLSSADPELVGAQNTVVVGMTNYDVADQLADVGME
105 :     AIHPKAAKPMELAGIAIRLKNTFEPEHPGTLITKDYVGSQARIEVIAGSPKVSAVEIHDP
106 :     SMVGTVGFDLGVMEIFQRHGISYILKATNANSITHVVWEKSVSSAFVEELENQYQKVTVV
107 :     PSAIVCVIGSNIAFPGVLARATQALADNGINVNAFSQSLRQTNMQFVIDRKDYKQAVIAL
108 :     NRALCLNPPTQAVA
109 :     >Mhyd_Ab_|_CG-02
110 :     MTTAQHTVEKIGGTSMSNYEAVRDNIIIGKRKKSDLYQRIFVVSAYGGVTNELLEHKKTG
111 :     EPGVYALFADAESDWAWGDDLTKLIQLLTDINGELFADPMLKQQADQFITDRIEGVRGCL
112 :     IDLQRLCSYGQFQLEEHLLTVREMLAGIGEAHSAFNTALKLQQEGINARFVDLTGWRDSE
113 :     LLPLDEKLKQAFDAIDLSRELPIVTGYAQCKEGLMRTFDRGYSEMTFSRTAVITNAREAI
114 :     IHKEYHLSSADPNIVGEDKVVPLGRTNYDVADQLANLGMEAIHPRAGKGLRQNEIPLRVM
115 :     NTFEPEHTGTLITGDYVSEKPQVEIVAGAKGVFAIEVFDQDMQGEPGSDRRILDVLSRFK
116 :     VRFMSKDTNANTITHYVDTTLKHVKRVVKALEEEFPNAEISTRKVALVSAIGSDMKVPGI
117 :     LARSVKSLADNDISVLAIHQCMRQVDIQFVVDEDKYDQAIVALHGALIEPHNHEYAIVAA
118 :     STTAG
119 :     >Sdeg_Ab_|_CG-02
120 :     MLTVEKIGGTSMSDYLTVRDNVVLGPNGENPTTGRILVVSAYGGMTDQLLEHKKSGKAGV
121 :     FAYFSSDEDAGSWREALNNVRQNMFQKNAELFNSADAISKANVFIGERLDTAERCLEDLQ
122 :     RLCGHGHFSLEAHLSTVREMLASLGEAHSARNMAELLKEEGVNARFVDLTGWNADKSLGM
123 :     DEHILEQFKDVDLGNELPVVTGYAHCESGIMSTFDRGYSEMTFSRIAVLVQADEALIHKE
124 :     YHLSSADPKVVGVDAAVPIGRTNYDVADQLANLGMEAIHPKAAKGLRQSNIPLRVKNTFE
125 :     PDHNGTLITTDYVSEKPCVEIIAGKQAVYAVECFNQDMVGDLLNFEQKIMQICQRFRCTH
126 :     VTKDVNANTVTHYLSSNMKKIKRVQRELEEMFPESEINVKKVSIVSAIGSDMQVPGILAK
127 :     TVGALADAGISVLAVHQSMRQVDMQFIVEEAAYEAAVRALHKCLVEVHDHGIAICAA
128 :     >Noce_Ab_|_CG-02
129 :     MNGHTVEKIGGTSMSRTQEVLDNILMGKRKEQELYNRIFVVSAYGGITDMLLEHKKSGAS
130 :     GVYALYAGAESDWAWGDLLNKVGERMCEINMEIFEDDLSCQKADQFVRERIEGVRSCLID
131 :     LHRLCSYGHFQLDEHLITVREMLAAIGEAHSAFNTALLLQQHGVNAHFIDLTGWRELDNL
132 :     TLEERIQQAFNSLDLARELPIVTGYPRCKEGTMMIYDRGYSEITFSKIAVLTEAREAIIH
133 :     KEYHLSSADPKVVDKDRVEPIGRTNYDVADQLSNLGMEAIHPKAAKGLRQCHIPLRVKNA
134 :     FDPDHAGTLIDGDYKSDTPCVEIIAGRKGVFAIEFFEQDMVGSSGYDTQLLALLERFKLK
135 :     IVAKDTNANTITHFVASSLKAIKRVTHAMEDAFPSAAVAVRKVALVSAIGSNMQVPGLLS
136 :     NAVSALAKADINILALHQSMRQVDMQFVVDEKDYEEAIIHLHEHLIESYSLPAPRSVGAA
137 :     >MARI_Ab_|_CG-02
138 :     MMGQHTVEKIGGTSMSDYRSVRDNIIFKPTLVNNMYQRVFVVSAYAGMTDKLLEHKKTGD
139 :     AGVFALFAQERKQNNWFPALQDVRAAMLEINHSLFEAGELRHKADAFLNSRLQEAQECLE
140 :     DLHRLCQHGHFSISEHLATVREMLASLGEAHSAWNTAHLLQRDGVNAVFVDLTGWNSPSH
141 :     MSLDERILDAFKDVDLSKELPIATGYAHSETGLMSTFDRGYSEMTFSRIAVLTQAHEAVI
142 :     HKEFHLSSADPRLVGESKAVPIGRTNYDVADQLANLGMEAIHPKAAKGLRQSGISLRVKN
143 :     TFEPEHTGTLITGDYVSDAPCVEIIAGCRGVFAVELFDQDMAGDIDKFDVDILKVLRQFH
144 :     AHIIAKDINANTITHYLAINLKTLKRVMRVLHERFADAEITQRKVAIVSAIGSDMKTTGM
145 :     LAKAVKAIAEQEVNVLAMHQSMRQVDMQFVVDEEDYEKAICSLHKELVEVHNHGRAICLA
146 :     >Pstu_Ab_|_CG-02
147 :     MHTVEKIGGTSMSRFEEVLDNIFIGRREGAALYQRIFVVSAYSGMTNLLLEHKKTGEPGV
148 :     YQRFADAQSEGAWREALEGVRQRMLAKNAELFSSEYELHAANQFINSRIDDASECMHSLQ
149 :     KLCAYGHFQLSEHLMKVREMLASLGEAHSAFNSVLALKQRGVNARLADLTGWQQEAPLPF
150 :     EEMISSHFAGFDFSRELVVATGYTHCAEGLMNTFDRGYSEITFAQIAAATGAREAIIHKE
151 :     FHLSSADPNLVGADKVVTIGRTNYDVADQLSNLGMEAIHPRAAKTLRRAGVELRIKNAFE
152 :     PEHGGTLISQDYKSEKPCVEIIAGRKDVFGIEVFDQDMLGDIGYDMEISKLLKQLKLYVV
153 :     NKDSDANSITYYASGSRKLINRAARLIEEQYPAAEVTVHNLAIVSAIGSDLKVKGILAKT
154 :     VAALAEAGISIQAIHQSIRQVEMQCVVNEEDYDAAIAALHRALIEPENHGDVIAAA
155 :     >Tcru_Ab_|_CG-02
156 :     MSNTQKTTLSVEKIGGTSMSDYQAVRDNIILYPENFYNRIFVVSAYGGITDDLLEHKKTD
157 :     QPGVYGLFANDDVDDDWRIALDQLSLKLNKINANLFSDDELRLKANDFIDERIAETKQLL
158 :     NHLQDLCRHGHFSLESHLLTVRELLASLGEAHSAWNLAHLLQTEGVNARFVDLTGWQADE
159 :     ALPLDAMIETHLGDIDFTKELPIVTGYTHCRENLMYTFDRGYSEMTFSRIAVLCQATEAV
160 :     IHKEYHLSSADPRLVGEDNVVPIGKTNYDIADQLANLGMEAVHPRAAQGLRQAQIPLRIK
161 :     NTFDPGHHGTIFTEDYVSEYPQVEIIAGMQHLIALEVFDQEMMGQQGSYEKVIIDATNRL
162 :     KCQVITKDFNANTITIYLKASLKKVKRLAEQLKQGLPTATINTSKVALASAMGSDMRIKG
163 :     LLAKAVQTLFDQGINVEAIHQNTRQVEMQFFVNETDYEKAVKALHTNLIEVHNHGKAICE
164 :     >Ppro_Ba_|_CG-02
165 :     MSYTVEKIGGTSMSAFDAILDNIMLRPKSPYNRVFVVSAYGGITDALLECKRSGKPGIYQ
166 :     YIAKRDETWLKAVADLEMRMLLVNENMFADPLNRRRADQFIKSRITDAVSCITNIIETCQ
167 :     YGQFSLRHYLPQIREFLSSLGEAHSAYNTALKLKTLGINATFVDLSGWDNKSYGSLDDVI
168 :     KRAFTNIDVTKELPIPTLLQNADFADSNFMILCPKNSSIFNDHGYITYYLSGGMEILNKL
169 :     LYKAEKRYSNSTITGCMVTFISIIGASINTNTALSKGILALTDKQISPIAAHSSMRNVNV
170 :     QFVVEDKYYKAAICALHSEFINQSENTTRKIA
171 :     >Vcho_Fa_|_CG-02
172 :     MMSYTVEKIGGTSMTAFDAVLENILLRPEQLYGRVFVVSAYSGMTDALLECKRTGAPGIY
173 :     QKIAKHDESWRDAVYALEQRMLLINENMFADAMTRLRADKFIRARLAEAIACIQNILQTC
174 :     QYGQFSLRQYLPQIREFLASLGESHSAYNTALKLNTLGVNARFVDLSGWCEAMQGNLDQV
175 :     IEEAFRDIDVTSELPIVTGYASCQEGLMRTYDRGYSEMTFSRIAVVTGAQQAIIHKEYHL
176 :     SSADPRLVGAEKVRPIGLTNFDVADQLANLGMEAIHPNAAAGLRQSNIDLRIKNTFEPDH
177 :     SGTLITASHQPQQDRVEIIAGRDKVFALHLFDQSMVGMMDKVSHELIEWIHAAKVQLIGK
178 :     EMNANSVTYYLSGSSEPLNHIRYQAEKRYPQAKVSGRMVALISAIGAHMETNKVLAQGLQ
179 :     ALLEHQLQPMAAHSSMRNVNVQFVVDDADYANGVCVLHQALMPFAQPSSARKVA
180 :     >Vfis_Ac_|_CG-02
181 :     MTYTVEKIGGTSMTAFDAVLDNIFLRPKDPYNRVFVVSAYGGITDSLLECKKTSKPGVYQ
182 :     LIAKRDDKWEEALEYVEKRMLLTNEHIFIDPMNRIRADKFICSRIKQAKNCIANILETCQ
183 :     YGQFSLRRYLPQVREFLSSIGEAHSAFNTALKLKTMGINAKFVDLSGWDNQPPRSLDDTI
184 :     INVFKDIDVTKELPIVTGYAYCQEGLMGTYDRGYSEMTFSRIASLTQADLAIIHKEYHLS
185 :     SADPRVVGTDKVFPIGRTNYDVADQLANLGMEAIHPNAAAGLRESNIEIQIKNTFEPKHK
186 :     GTLISSDYQPETDKVEIIAGKEKVFALHLFDQTMVGQVDNVSYELMEIISDAHVNLIGKE
187 :     MNANSITYYLGGNTESLNKVLYKTEKRYPNASIKGRMVALIAVIGSQIDTNKALAKGVLS
188 :     LMNSDVTPVALHSSMRNVNVQFVVSDKDYQNAIKALHHEFCEEVPAKQVKTSQVA
189 :     >Vpar_Ac_|_CG-02
190 :     MTFTVEKIGGTSMTAFDAVLDNIILRPKTPYNRIFVVSAYSGMTDALLECKKTSKAGVYQ
191 :     LIAKRDDQWQDALAYVESRMLLTNENIFADPMNRIRADKFIRSRIAEAKNCIANILETCQ
192 :     YGQFSLRHYLPQIREFLSSIGEAHSAYNTALKLKNMGINARFVDLSGWDNQEPRSLDDSI
193 :     RDAFADIDVTKELPIVTGYAYCKEGLMHTYDRGYSEMTFSRIAAITKADLAIIHKEYHLS
194 :     SADPRVVGPEKVLPIGSTNYDVADQLANLGMEAIHPNAAAGLRESGIELQIKNTFEPEHE
195 :     GTLISSGYRPEEDKVEIIAGKEKVFALHLFDQAMVGKVDNVSYELMEIISDARVSLIGKE
196 :     MNANSITYYLGGSSDSLNKVLYKAEKRYPNASIKGRMVALISAIGSHIDTNKTLAKGVLS
197 :     LMNSGVTPVALHSSLRNVNVQFVVSDKEYQRAICALHDEFFTPVEGSNAMEHVA
198 :     >Bcla_Ab_|_CG-03
199 :     MKVAKFGGSSVANAEQIKKVAAIIKADNKRKIVVVSAPGKRYADDAKMTDLLIALAEAKV
200 :     ADQPVEAAFNAVMNRYESIANDLELNRDVIAEIEADLKNRLEQTVTGKGRFLDIMKASGE
201 :     DNNAKLIAAYLSKIGLKATYINPKDAGLLVSDEPGNAQVLPEAYEALAKLAEIDGIVVFP
202 :     GFFGFSKLGNLVTFPRGGSDITGAILAAAVQAELYENFTDVDSVYAANPFIVEDPVEIKR
203 :     MTYREMRELSYAGFSVFHDEALIPAFRNDIPVCVKNTNNPKCSGTLILAERERSLNPIIG
204 :     IASDEGFATIYVRKYLMNREVGFGRHLLQILEDAGISYEHIPSGIDDTSVIIRQTQLSDQ
205 :     LENAIIERIKEELNVDDVHIEHDFAMVMLVGEGMHNTVGVTARASSALAKAGVNIEMINQ
206 :     GSSEVSLVFGIHSKDTKQAVRVLYEEFFGQKQ
207 :     >Bhal-1_Ac_|_CG-03
208 :     MKVTKFGGTSVASAEQIRKVATIVADDVERKIVVVSAPGKRHSSDTKVTDLLIRLGETYL
209 :     EKGYANEELEAVLRRYEEIAKGLELGQEIIDQIANDLHTRLTFNQSNPGAFMDQLKASGE
210 :     DNNAKLIAAYLQTKGMNAVYVSPKEAGLLVSDEPGNAQVLPEAYDHLKKLRERDEMIVFP
211 :     GFFGFSPDGALVTFPRGGSDITGAILAAGVKAELYENFTDVDSVFAANPNVVESPAQIRR
212 :     MTYREMRELSYAGFSVFHDEALIPAFRQKIPVCVKNTNNPSSPGTMILAEREYFLNPVIG
213 :     IAADKGFATIYVRKYLMNREIGFGRRLLQIIEDEGLSYEHIPSGIDDASVILRQEQLTDE
214 :     IEHRILARIKEELCVDDVFVEKDFAMVMIVGEGMHNTVGISARATAALARAHVNIEMINQ
215 :     GSSEVSLVLGIHEKDADAAVRELYEEFFGGAEETVQ
216 :     >Blic_Ac_|_CG-03
217 :     MKVVKFGGSSLASGAQLEKVFQIVTSDPERRAVVVSAPGKRHPEDTKVTDLLIECAQQYL
218 :     LSKEATGLVEAIVGRYADIALELGLADDVINRIRADLLQLLEGDKTNPERFIDAIKASGE
219 :     DNNAKLVAAYFRHRGVEAHYVSPKDAGLFVTSEPGNAQVLPESYDNLFQLRQQKGIIIFP
220 :     GFFGFSQEGEVMTFSRSGSDITGSILANGLKAELYENFTDVDAVYSVNPAIVSNPKEIRE
221 :     LTYREMRELSYAGFSVFHDEALIPAFRARIPVQIKNTNNPDAEGTRVVATRDNTNGPVVG
222 :     IAGDSGFCSIYISKYLMNREIGFGRRVLQILEDEGLTYEHIPSGIDDITIILRQNQMDQA
223 :     AEKRMIKRIKEELDADEVAIEHNIALIMVVGEAMRHNVGTTARASKALSEAGVNIEMINQ
224 :     GSSEVSMMFGVKEAQEKQAVRALYQEFFAKVLV
225 :     >Bsub_Ac_|_CG-03
226 :     MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAEDTKVTDLLIACAEQYL
227 :     ATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
228 :     DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
229 :     GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVENPKEISE
230 :     LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
231 :     IASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEHVPSGIDDMTIILRQGQMDAA
232 :     TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
233 :     GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
234 :     >Gkau_Ab_|_CG-03
235 :     MKVAKFGGSSVASAAQFRKVADIVSSDIERRIVVVSAPGKRYKDDVKVTDMLIQLAEQVV
236 :     AGEPHEETMEAIVKRYADIANELGLEADGFLAELVDDLQSKISAYRSEPPRLFDAIKASG
237 :     EDHNARLMALYLQDCGLEASYVSPLEAGIIVTDEPGNAQVLPESYDKLKQLRERRGVLVI
238 :     PGFFGYSRSGHIVTFPRGGSDITGSIVAAGVKADVYENFTDVDSIYCVNPSIVADARKLK
239 :     EITYREMRELSYSGFSVFHDEALEPVYRAGIPVCVKNTNNPAAPGTWIVAKRNHIDEPVA
240 :     GIASDTGFCSINISKYLMNREIGFGRRVLQILEDEGISYEHTPSGIDNMSVILRADQLAD
241 :     GKDERILARIREELAVDEVTIEYGLALIMVVGEGMEKTIGMAAKATTALANANINLEMIN
242 :     QGSSEVSMMFGVKEEVVNEAVRALYNAYFQQATVNHLS
243 :     >Oihe_Ab_|_CG-03
244 :     MKVAKFGGSSVANAEQIQKVANIIKADPSRKVVVVSAPGKRFKDDVKITDLLIEFAGSHQ
245 :     RKQFEQSEKTLTIIMDRFKEIVDNLNLHTSIIDDIKQTIEEDLNKDLSPNQLLDAIKAIG
246 :     EDSSAKIVSAYLQHIGIDATYMNPKDAGIYVSNEPGHAQLLPESFPIIKKLRDIDKVVVI
247 :     PGFFGYAENGELVTFSRGGSDITGSILAAGTKAELYENFTDVDSVYAVNPTIVNNPKEIN
248 :     VLTYKEMRELSYAGFSVFHDEALIPAFREQIPVCIKNTNNPDSPGTMIVSERDARDNCVV
249 :     GIASDVGFCSLYVSKFLMNREVGFGRKLLNIFEDEDISFEHAPSGIDDMSVIFRDHKFTP
250 :     EKERIVIDRIKNELHVDTVSIHRDLAVIMVVGEGLVNTIGVAARATSSFSKARVNIEMIN
251 :     QGSSEVSMMFGIHAEDIDKAIQSLYHEFFEVSQKVEEAETKILT
252 :     >Linn_Ac_|_CG-03
253 :     MKVIKFGGSSLASGIQLNKVFQLVAEDSERKIVVVSAPGKRFKDDTKVTDLLIDCAAKAL
254 :     LGEDTSELFEAVIARYAGIALDTGMDDAIITQIRADLQKTISSDKSDPDKFLDRMKASGE
255 :     DNNAKLIAAYFKFKGLNANYVNPKDAGLFVTDEHASAQVLPESYDRLFALREREGIIVFP
256 :     GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
257 :     LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
258 :     IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
259 :     TERTIMTRLKEELNADQVIMQHGISLIMVVGEAMRHNVGITSRASKALSDAKVNIEMINQ
260 :     GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
261 :     >Lmon_Ac_|_CG-03
262 :     MKVIKFGGSSLASGIQLNKVFQLVAEDPDRKIVVVSAPGKRFKEDTKVTDLLIDCAAKAL
263 :     LGEDTSELFESVIARYAGIALDTGMSDEIINQIRADLQATISSDKSDPDKFLDRMKASGE
264 :     DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
265 :     GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
266 :     LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
267 :     IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
268 :     TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
269 :     GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
270 :     >Lwel_Ac_|_CG-03
271 :     MKVIKFGGSSLASGIQLNKVFQLVAEDSDRKIVVVSAPGKRFKADTKVTDLLIDCATKAL
272 :     LGEDTSELFEAVIARYAGIALDTGMDDTIIKQIRSDLQATISSDKSDPDKFLDRMKASGE
273 :     DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
274 :     GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
275 :     LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
276 :     IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFSEH
277 :     TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
278 :     GSSEVSIMFGVKEEQENTAVRALYDEFFSEVFV
279 :     >Saur_Ab_|_CG-03
280 :     MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLYEKVI
281 :     NHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALLSCGE
282 :     DFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEKLIIP
283 :     GFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPELIEE
284 :     ITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAKNVIS
285 :     GISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSKQIQN
286 :     KETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLKMINQ
287 :     GASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
288 :     >Sepi_Ab_|_CG-03
289 :     MKVAKFGGSSVSTAEQIKKVLTIVNEDPERKIIIVSAPGKRHNDDIKTTDLLIRLYEKVL
290 :     NKLNYESKKQEIIQRYADIVEELGIGNDILITINDTLEEYIKNLSDKPNRLYDALLSCGE
291 :     NFNAQLIAQYNNSQGIPTRYISPKEAGLTVTDLPQQAQILDSAYNDIYKLRDYDEKLIIP
292 :     GFFGVSKQNYIVTFPRGGSDITGAIIARGVRASLYENFTDVSGIYKANPNIINNPELIEE
293 :     ITYREMRELSYAGFGVFHDEALQPLYKDRIPVVIKNTNRPNDKGTYILHDREIDSKNVIS
294 :     GISCDKGFTVINIKKYLMNRLVGFTRKILGVLEDYNISFDHMPSGIDNISIIMRTNQIQG
295 :     KESQVLNAIRKRCEVDELSIDHDLAVLMIVGEGMNQVVGTASKITHALSESNINLIMINQ
296 :     GASEISMMFGIHEADAEKAVLSTYEFCYNGVCLKNLCK
297 :     >Shae_Ab_|_CG-03
298 :     MKVAKFGGSSVSNATQIKKVLDIVNSDSDRKIIIVSAPGKRHKDDVKTTDLLVRLYEKVM
299 :     NNLNYQDKKKEIIQRYADILHDLDMDDSLLKVIDDTLEEIISTLKDKPLRLYDAILSCGE
300 :     NFNAQLIASYNDSQGFKTTYLSPKDAGILVTDLPQQAQILEEAYEKISKLKDIEGKIIIP
301 :     GFFGVSKNDYVVTFPRGGSDITGAIIARGIRASLYENFTDVSGIYKANPNIINNPDLIEE
302 :     ITYREMRELSYAGFSVFHDEALQPLYKHRIPVVIKNTNRPQDKGTFIRHDRDVSDKNVII
303 :     GISCDKGFSVINIKKYLMNRQVGFTRKILEILEDYNISFDHMPSGIDSISIILRTYQLKG
304 :     KEKDVLNAIRKRCDVDELSIEHDLAILMIVGEGMNKAIGTANTITHALAESNINLKMINQ
305 :     GSSEISMMFGISIEDADKAVLSTYEYCYHGICLKNLNKQA
306 :     >Ssap_Ab_|_CG-03
307 :     MKVAKFGGSSVSNAEQIKKVLNIVNSDVDRKIIIVSAPGKRHSEDVKTTDLLIRLYEKVI
308 :     DRLDYTSKKKEIIQRYADIIDELNMDYHLLTSIDETLESYIAILKDKPSRLLDALLSCGE
309 :     DFNAQLIAEYNNSQGIPTRYVSPGEAGIQVTDLPQNAQILEQSYNTLYKLREYNEKLIIP
310 :     GFFGVSRQNYIVTFPRGGSDITGAIVARGVRADLYENFTDVSGIFRANPTIVKNPEVIDE
311 :     ITYREMRELSYAGFGVFHDEALQPLHKDRIPVVIKNTNRPDDIGTYIRHDREINSNNIVS
312 :     GISCDKGFTVLNIKKYLMNRQVGFTRKILAVLEDYGISFDHMPSGIDNISIIMRSKEIQN
313 :     REEQVLNDIRKNCDVDELSVEHDLAILMIVGEGMHRIVGTANTITHALAESNINLKMMNQ
314 :     GASEISIMFGIHVSDADKAVKSTYEYCYNGICLKS
315 :     >Efae_Aa_|_CG-03
316 :     MNVVKFGGSSLASAPQLQKVLQIVKEEPRRTFVVVSAPGKRTPQDIKVTDLLIQYYQRYL
317 :     NNEEIESTISAIIRRYEDLFDELHLDKAVLADIAISIRQLATLPKENNAFLFDYFLASGE
318 :     DNNAKVVASFFKQNGLDARYISPKELGLLVTPEPGNARILPKALEKISVYRETQQILVIP
319 :     GFFGYTEAGEICTFSRGGSDITGSIVAAGVQADLYENFTDVDGIYVAHPGIIEQPQTIQE
320 :     LTYREMRELAYAGFAVLHDEALMPAYRANIPVVIKNTNNPHHPGTLITTSRKVKHAPVVG
321 :     IASDQGFASIYISKYLMNRELGFGRRLLEVLEKLALSYEHMPSGIDDITIVLREDQLTTE
322 :     IENRLMAQLQEVLAPDELRITHHLSMIMIVGEGMRQRIGVTAESTMALAKEKINLEMINQ
323 :     GSSEVSIMFGIKKEQEEKAIKALYRTFFHD
324 :     >Laci_Aa_|_CG-03
325 :     MKVVKFGGSSLATGNNVNKALNIIKNDSSRQVIVVSAPGKRTDDDIKVTDLLITYAYTSL
326 :     RSNNYDDTVEKIFRRYELIAQYFDLPESDLTKIKRLLLTLPTYDYPNADYRMATFKAHGE
327 :     RLNAILIAKILNHQGIKTRYLEPKDVGLIVTGTPNNAEVNPETYVNLKRINLKNNEKIIF
328 :     PGFYGITPSGHIATFSRGGSDITGAILARGFDAELYENFTDVDAIFSANPNIVTNPAPIK
329 :     KMTYQEMRELSYAGFSVFHDEALIPAIQGEIPVNVKNTNDPEKPGTLIVPEDGFIPKHTI
330 :     TGIAGGKNFAALYLRKYMLNKGAGFTLKLMEIFDRHHVSYEHMPSGIDDLTIIFKKDALS
331 :     DQLIDVICNEIQTSLNPDQMQWIDDYAITMVVGEGMKDKLTLCASILYPLGEKNISIQMI
332 :     NQGASQISIMIGTRRQDEEEVIKTIYQNFIENR
333 :     >Laci_Ab_|_CG-03
334 :     MKVVKFGGSSLASGQSVEQALNIILNDPERQVIVVSAPGKRNNADTKVTDLLIKYAEQVL
335 :     KHEETDAIVKQIFARYQEIGYFFGLNDEKLQIIQNILLALPNQNYPDNNYLMAAFKAHGE
336 :     RLNARLIALILQHENIKSRFLDPVDAGLIVTGEPNDALVNPESYLNLDQIKIDPNEKIIF
337 :     PGFFGITPSGNIATFSRGGSDITGAILARGFHANIYENFTDVNGIFAANPNIVMHPISIK
338 :     KMTYREMRELSYAGFSVFHDEALIPAIQGQIPINVKNTQEPDNPGTMIVPEKNFSPDNTI
339 :     TGVTSQKHFSALYLHKYLLNKEAGFTLRILQILYKHNIPYEHMPSGIDDITIIFNNDFLN
340 :     DQLIDQICNEIQATINPDQLEWIDDYAIIMVVGEGMKKTPGVSRQILDSLASQGITPRMI
341 :     NQGASQISIMIGTKKEKADKAVKIIYQDFFN
342 :     >Lcas_Ab_|_CG-03
343 :     MRVVKFGGSSLANGSQFAKVVAIMKANPARQVIVTSAPGKRHPGDTKVTDLLIQYAQAVM
344 :     RHEAVAAIVAEIVARYQAIADDFELEASIMAAIEEELDQLPKLTFKNNDYLMAGFKARGE
345 :     KLNAFLMTAVLNHEGIEATYGEPKSLGIVVTDHPNDAEVSRETYRNLATFRRPIGVLVVP
346 :     GFYGYTSDDDIATFSRGGSDITGAILANGFHADLYENFTDVDGVAAADPRVVANPQMIRE
347 :     MTYREMRELSYGGFGVFHDEAILPAIAGQVPINLKNTNHPAAPGTMIVPEQHFVPKHAIT
348 :     GIVSSQHFGAIYLHRYLLNKEVGFTLKILQVLAHNGISYEHMPSGIDDLTIILDDRQLTE
349 :     AKRKTICAEIQAAVHPDVLKWIDDYAIIMVVGEGMAQRTGLIQTILQPLATAGVHVSMIN
350 :     EGASQISLMLGTSRESANRAVKTIYNAFFIPINQRLEVH
351 :     >Lcas_Aa_|_CG-03
352 :     MKVVKFGGSSVADAGQFQKVKAIIDQDVNRQIVVISAAGKYGNATRKLTDTLYLIADGME
353 :     AGRDVEPLFNQVLARLEAINIALQLNVPLIKLLHTIRHHLAIRYSRDYLVSRGEFLTAHL
354 :     MAAYLGYTFVDAANLLFFNKAGAIDEAKTQTAYQQLASQHGIVVPGFYGRDADGHVKLMP
355 :     RGGSDISGAWLARLAHADLYENWTDVSGIKMADPRIIKDADSIDVMSYDELRELTYMGFS
356 :     VFQEEAVQPVRECGIPTRILNTNAPEVPGTLIIHDDDPANDLKTITGIAGRKHYLVITVR
357 :     KYQLALHLEVIQHALGVVAAHHLVVDYLPTGIDSFSLLIREPRRQVSVQELTAEIAAACQ
358 :     PDKMEVTENVALIAMVSRKLRQRPAIAGKVLAYLDDNLLNVQLVSQTNDDINLLIGVHDL
359 :     DYDKAVRVIYSSIHQNFQRPAPYIEGIA
360 :     >Ldel_Ba_|_CG-03
361 :     MSKVVKFGGSSVANSEQFKKVKQIILADPDRKYVVTSACGKSGQEDHKVTDLLYLCAAHI
362 :     TYDVSYESIFQSIVDKYMEIKRSLGLKIDLAGEFAKIRQNMAQNLNLDYLVSRGEYLTGL
363 :     CLAEYLDADFRDASQVIRFHYDGSIDLDKSQELLKAQVDPGRRVVIPGFYGSLPNGVIKV
364 :     MSRGGSDITGSIVANAFDVDVYENWTDVSGFYVADPRIIKDPVQIPRVTYSELRQMSYMG
365 :     ANVLHDDAVFPVRQKNIPINVRNTNHPENPGTMIMNDCSELDAQEPPHVITGITGKQDFT
366 :     VITMVKSHVSAEAGFLRKVLAVFEKFQISIESVPVTVDTFSIVVQTKKIERYLYEIVAEL
367 :     QQDLHLDDIQVESQQAMLAVVGRVMRQMPGMSGKILSTLGDQQINIRTINQACDEQSIVI
368 :     GVNNQDLVPAIKAIYQQFISEERVER
369 :     >Lgas_Aa_|_CG-03
370 :     MKVAKFGGSSVASGAKIAQVINILNNDNKRQVVVVSAPGKRSKSDTKVTDLLIKYANLTL
371 :     RKQNCEKIQAQIYARYAEIGKYFDLSMQGLNEIKALINDLPTHTFPNRDYLMAAFKAHGE
372 :     FLNAKLLTMIMKKQGFKVRLLTPRQAGLVVTGSPNDASVNPETYVNLRNLELDPTEKIIF
373 :     PGFYGISPSGNIATFSRGGSDITGAILARGFTAELYENFTDVDAIFSANPAIVSHPQPIS
374 :     KMTYREMRELSYAGFSVFHDEALIPAIQAQIPVNVKNTQHPERPGTMIVPETNFKAQHTI
375 :     TGIAGGKNFAALYLHKYLLNKGAGFTLKILQILDQHKVAYEHMPSGIDDITIIFKKEDLN
376 :     AELIDQICNEIQVSLNPDQMQWIDDYAITMVVGEGMRDKLSLCASILYPLGQKNISIQMI
377 :     NQGASQISIMIGTRRGDAEEVIRTIYQTFFN
378 :     >Lpla_Ab_|_CG-03
379 :     MKVIKFGGSSLASSQQLQKVLAIVEADQKRKYVIVSAPGKRFDGDTKVTDLLIQYARQTI
380 :     HHQDTQAVTAAIIDRYAEIGHGFNVPEAQLTPIFETIRNLPKQSYADNTYLMAAFKAHGE
381 :     RLNAQLVAAVFQQSGLNARYLDPKDAGMVVTDVPDDAQIIKSSYDQLAKWANSEQILVIP
382 :     GFFAYNRNGQICTFSRGGSDITGAIIARGVHAERYENFTDVDAIYAVNPSLVAKPAAISE
383 :     MTFTEMRELSYAGFSVFHDEALIPAIEDNITVNVKNTNHPEAPGTLIQSTREPNPHYPVT
384 :     GIASSSSFCSLYLRKYLLNKEVGLGRKILTILENHHISYEHMPSGIDDLTIIFDEHQLTP
385 :     ELEKTLVAEISTAINPDEIYFTHDYSILMLVGENMRNRVGIMSRAATALANDNIKLIMVN
386 :     QGASEISIMFGVHDNDADQAVIALYKEFFD
387 :     >Lreu_Aa_|_CG-03
388 :     MKVVKFGGSSLANGEAFQNAINIITSDPQRRVIVTSAPGKRFADDIKVTDLLIKYAQTVI
389 :     AGQNPQEIVEQILNRYQEIAAYFGLPADKLIPLAERLEGLPNHTYPNDNYLLAAFKAHGE
390 :     RLNAQLMAILLQHLGYEARFVTPSEAGIIVTGTPNNANVIPETYANLSHFTFNENELLIF
391 :     PGFYGLTLAGHIATFSRGGSDITGAILARGLHASTYENFTDVDAIYSANPQIVDHPQPIT
392 :     TMTYREMRELSYAGFSVFHDEALIPAIQGNIPINVRNTNDPEKPGTMIVPDKDFQPSDIV
393 :     TGVVSGKHFAALYLHKYLLNKQAGFTLRILEILAKHNVSYEHMPSGIDDITIILDRNAIN
394 :     DQLIDTICNEIQEEINPDRLEWIDNYAITMVVGEGMRNRTGVIDDILMPLAEKHIAVPMI
395 :     NQGASRIAIMIGTYNEDADEAVRAIYHRFFAN
396 :     >Ppen_Aa_|_CG-03
397 :     MVKVVKFGGSSLANAAQYQKVIEILRADPERRIVVVSAPGKRFKDDVKVTDLLIKYANAS
398 :     GENVKVARQAVLDRYQEIADAYHVSDSDFEQINVHLIDLANLHHANKACRLAHFKAAGER
399 :     LNAILMALVLKKFNVTARFVDPKQLGIKAHGDYNNAILDQHSYAQIEAVCSNLLDEAEYL
400 :     VVPGFYAYNQNGEVCTFSRGGSDITGAILARGFQAQLYENFTDVDSIYSADPKIIAQPHP
401 :     IREMTYREMRELAYAGFSVFHDEAIIPAIEAQVPIVIKNTDHPNLPGTVIEPEQNYASDL
402 :     EITGVASSSRFAALYIHKYLLNREVGFTLKLLKILYRYDISYEHMPSGIDDLTIIFNQNQ
403 :     ITDEILPSLLSDIREELHTDQLEWIDDYAILMVVGEGMRDKVGVVDRIVNALARKQIGIQ
404 :     MINQGASRISTMLGVHQNQVNQAVREIYREFFKNKGRAD
405 :     >Lmes_Ba_|_CG-03
406 :     MKVTKFGGSSLANGQQLQRVYDIIRADDDRKVVVVSAPGKRFKDDRKVTDLLISYAQATL
407 :     ADEDTTEIIETIKHRYHSIGEYFELPDYELADLDEQIEHLARKHYRSFDYLYAAFAAHGE
408 :     YLNAQLIAKVFNHLGMPARFVDPKEIGLVVDDNARSATFDAASYTTIGELDLSTSERLIV
409 :     PGFFGYTKNGDMATFSRGGSDITGAIMARGLRADLYENFTDVSAIYAVNPSIVEHPAAIQ
410 :     QMTYDEMRELSYAGFAVFHDEAIIPAIQGGIRINIKNTNDPDAPGTFIVPPTEVQQTRPV
411 :     TGIANSNRFAALYLHRYLLNKQVGFTLRILEILKRHNISYEHMPSGIDDLTIIFDKTMLT
412 :     QEQVDNMLSDIAAEIKPDTLKWIPSYGIIMVVGEGMRNRVGALTEIVAPLKERNISLQMV
413 :     NQGASEISIMLGIQPDLSDSAVEAIYTNIFK
414 :     >Ooen_Aa_|_CG-03
415 :     MKIVKFGGSSLSSGVQIRKVFQIVKSDPERRIVVVSAPGKRFKGDVKITDLLLKLAEAIL
416 :     NEEKTAQIYEQIFLRYQAIGDFFKIPRSGIEQLKEHLYSVAQADYPSNDFFRAALSAQGE
417 :     NMSAHLITLIFKQLGLKARLLTPKEVGLTVSGEARKAQILPGSYAKIAKTKFTDNEVLIF
418 :     PGFFGITKNGLINTFSRGGSDITGAILARGFGADLYENFTDVDSIYAVNPGLVADPAPIK
419 :     EMTYNEMRELSYAGFAVFHDEAILPAIQGKIPICVKNTNRPEMPGTKIVPRDKVSHKNKI
420 :     TGIASSHHFQAIYLHRYLINREVGFTAKILKIMADLNISYEHMPSGIDDLTIILDKNQLT
421 :     NGRKEKLTQRIKDEIQPDDLQWRNDYAIIMVVGEGLVNRVGAMADIVDPIRDAGISLTMV
422 :     NQGSSEISIMLGVRPEDEQKAVKAIYNDHFENGHPKKELQIPRASFKSVSKSLIANFFV
423 :     >Llac_Ca_|_CG-03
424 :     MKVAKFGGSSLASATQIKRVFDIVQADKLRKFIVVSAPGKRSGADTKVTDALISYYKAYK
425 :     TADDKGIQYYQNWIIARFREIYDELELKSSVIDEIADNIHNLAHLDLENVFTYDTFLAAG
426 :     ENNNAKLIADFFTHSGLPSRYVHPSDAGITVSSDPGNARLLVGAYEHIKYLNDLEETLII
427 :     PGFFGVTKEGEVCTFSRGGSDITGSIIAAGVSAELYENFTDVNGIFAAHPGIVKNPAYIA
428 :     ELTYREMRELAYSGFSVLHDEALVPAYRARVPLVIKNTNNPDHPGTKIVVQRETKGSPVV
429 :     GIASSSAFSSLYVSKYLMNREVGFGRKVLSVLENLGVRFEHMPTGIDDMSIIIRSRYLTQ
430 :     PISKALISNLTESLHPDEVYIDRDFSIITIVGEDMKEHVGVTARATAALSKQGISIAMLS
431 :     QGSSEVSVMFIVKEKYEQEALKAIYSAFFD
432 :     >Saga_Ba_|_CG-03
433 :     MKVVKFGGSSLASSQQLYKVLNIIKSDYTRRFVVVSAPGKRYEEDLKMTDALIQYYQNYI
434 :     NGKDIVKDQTWIINRYQEIISDLSLGSTIAEEITRSIEQLASLPIENNQFLYDCFLAAGE
435 :     DNNAKLVATFFNQNDIPARYVHPNEAGIIVTKEPCNARIIPGSYDKIENLCLYNEVLVIP
436 :     GFFGVTEDNQICTFSRGGSDITGSLIAAGIKADLYENFTDVDGIFAAHPGVVKNPHAIPE
437 :     LTYKEMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPQQPGTKIVLKHTRSNIAVTG
438 :     IASDSRFASINVSKYLMNREVGFGRKVLQILEDLNISFEHMPTGIDDLSIVLREKELTPI
439 :     KEQEILNYLTRKLEVDYVDIQHNLSTIVIVGENMKSQIGVTATATQALSREKINITMISQ
440 :     GSSEVSIMFVINSKDEKRAIKALYETFFQK
441 :     >Smut_Aa_|_CG-03
442 :     MKVVKFGGSSLASATQLEKVLNIIKSDEERRFVVVSAPGKRDAQDTKVTDALIRYYRSYT
443 :     SDKDVTADQSWIINRYRAIIDELGLGQNILEKITKAIVDLANLPIEDNDFLYDTFLAAGE
444 :     DNNAKLIAEYFRKNGLSARYIHPKKAGIIVTSEPGNARIIPSSYDKLEELRDSDEVLVIP
445 :     GFFGVTIDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHKPHSISE
446 :     LTYREMRELAYAGFSVLHDEALIPAYRGKIPLVIKNTNNPEHPGTKIVLAHTGATIPVVG
447 :     IAGDDDFVSINLSKYLMNREIGFGRKILQVLEELNIRWEHIPTGIDDMSIILRGRELTPI
448 :     KEQEIISQLTRKLEVDEVEIERNLSIIMIVGENMKNHIGVTAKAAEAFSKKHINLEMISQ
449 :     GSSEVSVMFVIKTEQEKQAVRALYQTFFMKDE
450 :     >Spne_Aa_|_CG-03
451 :     MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAEDTKVTDALIKYYRDYV
452 :     AGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLPIEENEFLYDTFLAAGE
453 :     NNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSSYDKIEELTNTNEVLVIP
454 :     GFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIHQPHSIPE
455 :     LTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIVLKHSNDEFPVVG
456 :     IAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEHMPTGIDDLSIILRSRQLTPI
457 :     KEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIGVTATATRALSENKINIQMMSQ
458 :     GSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED
459 :     >Ssan_Aa_|_CG-03
460 :     MKVVKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRHDDDIKVTDALIKYYREYI
461 :     AGNDVTPNQQWIINRYADMVAELGLKPKVLEKISKSITSLATLPIEDNAFLYDTFLAAGE
462 :     NNNAKLIAAYFSQNGVPASYVHPREAGLVVSSGLVVSSEPGNARILPSSYDKIEELNNSD
463 :     EVLVIPGFFGVTQDGQICTFSRGGSDITGSIIAAGVKADVYENFTDVDGIFAAHPGIVHK
464 :     PHSIPELTYREMRELAYAGFTVLHDEALLPAYRGKIPLVIKNTNNPEHPGTQIVHKHSKD
465 :     HLPVVGIAGDAGFVSINMSKYLMNREIGFGRRVLQILEDLNIGWEHMPTGIDDLSIILRE
466 :     RELTPIKEEEILRQLVQKAEVDHAEIEHDLSIIMIVGEKMKSHIGVTSTATKALSENNIN
467 :     IQMMSQGSSEVSIMFVVEKNQEKAAIRALYRAFFEPQTQE
468 :     >Ssui_Aa_|_CG-03
469 :     MRMKVIKFGGSSLASAGQLEKVFNIVQSDSERRFVVVSAPGKRNAEDTKVTDALIKYYKE
470 :     YVNGKDVTASQEWIINRYQAMVDELGFTANSMKKIADSIISLASLPIDDNEFLYDAFLAA
471 :     GEDNNAKLIAEYFTHRGLPARYVHPKKAGIIVSSEPGNARILPSSYDKIEELRDTDEVLI
472 :     IPGFFGVTVDNQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIKNPHSI
473 :     KELTYREMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPTHPGTRIVHKHTEQTVPV
474 :     VGIAADDGFVSINLSKYLMNREVGFGRKVLQILEDLNIRWEHMPTGIDDLSIVVRERELT
475 :     PIKEEEILRQLNTKMEVDKAEIEHGLSIIMIVGENMKSHVGVTATATTALSKQNVNLAMI
476 :     SQGASEVSVMFVVKTEEKKRALHALYEAFFNEQ
477 :     >Sthe_Aa_|_CG-03
478 :     MKVIKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRNDEDTKVTDALIKYYKHYI
479 :     KGADVKADQEWIINRYQAMVDELGFKSKEMVKIAKAITDLATLPIEDNDFLHDTFLAAGE
480 :     DNNAKLIAEYFRNNDIEARYVHPREAGILVSSEPGNARILPGSYDKLEELRESDEVLIIP
481 :     GFFGVTSDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHEPHSIPE
482 :     LTYKEMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIILEHQGATVPVVG
483 :     IASDDKFVSINMSKYLMNREVGFGRKVLQILEDLNIRWEHMPSGIDDLSIIIRERELTPI
484 :     KEQEILSYLTRELGVDEVEIEHGLSILVIVGENMRDHIGVTATAAKALSEKNINLEMISQ
485 :     GSSEVSVMFVIETEQEKEAVRALYDAFFRSNN
486 :     >Cace_Ab_|_CG-03
487 :     MKIVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAH
488 :     VKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNG
489 :     VILAKYLNAEFIDAAEVIFFDKSGCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVK
490 :     TFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYM
491 :     GATVLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVI
492 :     AIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKK
493 :     QCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGV
494 :     ETVDFEKAVKSIYNAFN
495 :     >Cbot_Bc_|_CG-03
496 :     MGKVIVAKFGGSSLSDSEQFRKVKSIIYDNENRRYIVPSAPGKRFKKDYKITDLLYLCHA
497 :     HRESAISFDDVFKHIEERYLNLAKELRVKVDIKNKLEEIKREIEAGASRDFAASRGEYLN
498 :     GLILADYLNYEFIDAAEIIHFKKYGSLDLRKTEKAIKEKIKNVKKAVIPGFYGALPDGTI
499 :     KTFSRGGSDVTGAIVARAVEASLYENWTDVSGFLMADPNIINDPKPIEVISYKELRELSY
500 :     MGAKVLHEESIFPVRDVKIPINIKNTNRAEDKGTLIVDDDKALNYTGSITGIAGKKGFTV
501 :     IAIHKMLMNSELGFCRKLLSILEENGVAFENIPSGIDSVSLVIEDSQLGNKLDIILEEIK
502 :     RQCNPDSLEVHVNMALIATVGNGMNRTKGISAKIFKGLLEEDVNIRMINQGSSEINIIVG
503 :     VENDDFERAIRGIYNTFIK
504 :     >Cnov_Ab_|_CG-03
505 :     MNDIIVAKFGGSSLASAEQFRKVKKIVMEDSNRKYVVPSAPGKRDDNDYKITDLLYLCHA
506 :     HVENRISFDDVFKIIEERYKEIVKELGLSIDINFHLVNMKKIISQGVSVDYTVSRGEYLN
507 :     GIILANFLGYEFVDAAEIIAFDKYGCFDSDKTKELISNNLKNIERAVIPGFYGAMPNGDI
508 :     KTFSRGGSDITGAIVAKDVKAKLYENWTDVSGFLMADPRVVDNPKPIEKITYKELRELAY
509 :     MGASVLHEEAIFPAKEGNIPINIKNTNRPQDKGTLIVNEVNYKNGGGRITGIAGRKDFTT
510 :     IVIQKTYMNAEIGFGRRLLSALETYGISFEHMPSGIDTISIVIDDAQLDNKLDKLLEEIK
511 :     RQCNPDSIHVIPNMALIATVGMGMAKAVGTSEKIFSALAKSHVNIGMIDQGSSEINIIIG
512 :     VDAKDFETAIKSIYEAFE
513 :     >Ctet_Ab_|_CG-03
514 :     MNNIIVTKFGGSSLADVNQFKKVKNIVLGDQRRKYVVPSAPGKRHKEDQKITDLLYLCHA
515 :     NVEQNVEIDYIFTIIEKRFKDLAKELGVNIDIDTELENIKKNIKNGATADYTASRGEYLN
516 :     GLILSNYLGYEFVDPAEIIFFRRNGVFDSDKTQEAVSKRLCNIQKAVIPGFYGSLPNGDI
517 :     KTFSRGGSDVTGAIIARGVAADLYENWTDVSGFLMVDPNIVENPKNIEKITYRELRELAY
518 :     MGATVLHEEAVFPVRSAGIPINIKNTNRPEDKGTLIIDDLKPASYAGSITGIAGKKDFVV
519 :     IAIEKNMMNIEQGYCRKVLSVLEENYVSFEHMPSGVDAVSLVISKNQLNGKLDGILEEIE
520 :     MKCKPDSIEVYPNMALVAIVGRGMLRTVGMSAKIFDALAREKVNIRMIIQGSSEINIIVG
521 :     VENEDFEKALKSIYDEFAK
522 :     >Cthe_Aa_|_CG-03
523 :     MKVAKFGGSSLADANQIRKVCDIILSDKDRKLIVVSAPGKRCKEDTKVTDLLIALGEKYY
524 :     KEGKADAELQAVIDRFDDIVKGLELSPDITQMVADDLKKRLECNNGNKDKFMDTIKAAGE
525 :     DNNAKVVAAYLVSRGIDAEYVNPKDAGLLLSEEYGNARVLPESYENLKRLRERDKIMIFP
526 :     GFFGYSKKGDVVTFPRGGSDITGAILAAAVKADVYENFTDVDSVFAANPNIIENPKPIAT
527 :     FTYREMRELSYSGFSVLHEETLEPVYRMEIPVCIKNTNNPSAPGTTIVPKRKLDNGPVIG
528 :     IASGTGFCCIYISKYMMNREIGFGRKVLSILEDEGLSYEHIPSGIDNMSIIIEQKQLDKA
529 :     KEERVVRRIKDELNVDDIKIEYDRALVMIVGEGMMSTVGIAARACTALAKANVNIEMINQ
530 :     GSSEVSMMFGVKAEDNVKAVKALYDEFFS
531 :     >Ahyd_Ac_|_CG-04
532 :     MRVLKFGGSSLADAERFLRVADIAVNTHGQSQVALVLSAPAKVTNHLVALVEQTSRGMDA
533 :     SSTLFEINGIFSRLLAGLKAAYPALDDKALQARLTSELDQVERLMQGIRLLGLCPDNVQA
534 :     RILSRGENLSIAFMHELLRVRGLELDIIVPEQLLVTDGGYLEAHVDIEASRLRFAAKGLR
535 :     SDCLYLMPGFTGGSDKGETVLLGRNGSDYSAAVLAACVDAECCEIWTDVEGCYNCDPRLV
536 :     PDAYLLKTLSYKEAMELSYFGAKVLHPKTIAPVAQFHIPCLIKNSFNPQGPGTLIGVEQG
537 :     DDDLKVKAISDLSGMCMFNVSGPGMKGMVGMAGRIFSAVSRAGVSIVLITQSSSEYSVSF
538 :     CIHSYDCDKTRKVLEREFELEFKNQLLDPLEIMQDLAIISLIGDGMRTSKGMAARFFTSL
539 :     AQASINIVAIAQGSSERSISAVVRDRKVAEAIKACHQNFFGSQQFIDLFVV
540 :     >Asal_Ad_|_CG-04
541 :     MRVLKFGGSSLADAERFLRVADIAVNTHGQSQVALVLSAPAKVTNHLVALVEQTSRGMDA
542 :     SSTLFEINGIFSRLLAGLKAAYPALDDKALQARLTAELDQVERLMQGIRLLGLCPDNVQA
543 :     RILSRGENLSIAFMHELLRVRGLELGIIVPEQLLVTDGGYLEAHVDIEASRLRFAAKGLR
544 :     PAVEGQSPAGKASCLYLMPGFTGGSDKGETVLLGRNGSDYSAAVLAACVDAECCEIWTDV
545 :     EGCYNCDPRLVPDAYLLKTLSYKEAMELSYFGAKVLHPKTIAPVAQFHIPCLIKNSFNPQ
546 :     GPGTLIGVEQGDDDLKVKAISDLSGMCMFNVSGPGMKGMVGMAGRIFSAVSRAGVSIVLI
547 :     TQSSSEYSVSFCIHSYDQEKTRKVLEREFELEFKNQLLEPLDIISDLAIISLIGDGMRTS
548 :     KGMAARFFTSLAQASINIVAIAQGSSERSISAVVRDRKVAEAIKACHQNFFGSQQFIDLF
549 :     VV
550 :     >Cpsy_Ab_|_CG-04
551 :     MRVLKFGGSSLASAERFRQVADIIHDKSKSSKLAVVVSAPQGVTNHLVAMTENISDEEKV
552 :     VADLGHFKRAITTIIDDLSASISNFNNQHCEQALANYEHQISRYMQGAMLLTYCPDHIRA
553 :     RIISTGERLSVAILDAVLQAYSVQVSLLAPEKFLYTNKSSLNAVADLVLSKEKFEHEYTE
554 :     LNQVSLMPGFIGVNADNNDGTPEVTTLGRNGSDYSAAVLAVCAVAECCEIWTDVDGVYNA
555 :     DPRYIKEAKLLDYLSYQEAMELSYFGASVLHPKTIGPIAQYHIPCLIKNTSNPSAPGTLI
556 :     SNENDQQKRVKAISNLDDLTMVNVSGPGMKGMVGMASRVFATMSRENISLVLISQSSSEY
557 :     CISFCIYSSDSARAKQSLHEEFELELLNGLLEPLALKGELSIVSLVGDGMHHQRGVAAKF
558 :     FSSLAQARVNVVAIAQDSSERSISVVVEQRKCMDAMKVSHQNFFSHKPTIDVFLV
559 :     >Patl_Ab_|_CG-04
560 :     MKVLKFGGSSLADAERYLRVKDICLDTHASNGAAVVLSAPKGVTNALSLLCEEAGSGKDY
561 :     GELFAKLNMVLFGILDDLKDTLPEFDDSELAPYIQRILNELNQHLEGFALLRCAPESVVA
562 :     KILSIGEYMSVNIFSQILTTLGTKNQIIDPAELILAEGDYLDSIADVAVSKARFSDVDSS
563 :     GDVVLIMPGFVAVNAEGEKVTLGRNGSDYSAAILAACIDAECCEIWTDVDGVYNADPNQV
564 :     DGAVLLDKLTYQEAMELSYFGAKVLHPKTIGPIAQHHIPCLIRNTLNPAAPGTLISNEKS
565 :     TKWTSVKGISHLDDMTMFNVAGPGMKGMVGMASRVFEVMSNANISISLITQSSSEYSISF
566 :     CIHSKDATRAQDLLEDSFALELANNLLDPIEVRHDLAIVTLVGDGMRHSQGLAAKFFSSL
567 :     AQARVNNVAIAQGSSERSISTVIESSKARKAVKVVHQNFFSNLHAIDVFLV
568 :     >Phal_Ad_|_CG-04
569 :     MRVLKFGGSSLADFACLEMVAVLAKAQLKDEMLLVLSAPGGMTDSLVALASAAEQGEDFS
570 :     HLWQALVNRCDELKKAVEQGYGEIENWPNFTELKNKLDGVSLIKCCPEQVRAFIISFGER
571 :     VSVSLMQCLLGDLNAQYLEATNCIVSTGGYIDAEADLVASKVRFQAVLKEQPATIYIMPG
572 :     FTASNEQGELTTLGRNGSDYSAAIAAACLEADVCQIWTDVDGVYSADPRYIKTATKVDFL
573 :     SYKEAMELSYFGAKVLHPKTILPCAKAGVPCEIKNTRNPNAQGSLISNESVSSEPVKALS
574 :     SLQDLAMLTVSGPGMKGKVGMASKVFNALALDNVSIVLITQSSCEFSISFCVHEVDLALA
575 :     LEALQTAFKLESQAGLIEPIQVKRNLAIVTLVGDNMRAHKGLAAKFFASLAQAQVNIVAI
576 :     AQDSTESSISAVIDGERCNGAVKVCHENFFTHIPSIDVFLL
577 :     >Ping_Ab_|_CG-04
578 :     MRVLKFGGSSLANAERFNQVADIVINNQQQSQIALVLSAPAGVTNNLVAVVEKTSMGISS
579 :     ESHLIDIQNIFADLIKTLKGTYAEFADELLETIFERELSHLSDLLEGVRLLAQCPASIEA
580 :     QILSKGELLSVACMKQLLIAKGHQVEIIKPQEKLISYKGGYLEAQIDIDVSRALFEKETI
581 :     VKDAIYLMPGFTAGNEQGETLVLGRNGSDYSAAVLAACLKAECCEIWTDVDGVYSCDPRL
582 :     VKDAKLLSSLSYAEAMELSYFGAKVLHPKTITPIAQHHIPCLIKNTYNPQANGTLIGVEH
583 :     GDEALQVKGISDLKGLSMLSISGPGMKGIVGMAGRIFTTVSRSGVSIILITQSSSEYSLS
584 :     FCIHSSETQKALYALNEEFSLEFKNHLLEPIDVVEKQAIISLVGDGMKKARGVAARFLTA
585 :     LTEASINITAIAQGSSERSISAVVSEEKAKEAVIACHQNFFGSVQYIDMFLI
586 :     >Sama_Ad_|_CG-04
587 :     MKVMKFGGTSLANWQRFDMAAAIVAEAAKASQVAAVLSAPATVTNGLLDMVDVAVTGGDY
588 :     QAVLGRVVGVFEALFDDACQHQVPQCREHLFAALSAQKHAWQTRLEGVALLGECPDGVRA
589 :     EIVVAGERLSTELMVALMNAHWLSADKLDPRALFLAHGTPLESVVDIGVSKPRFKQLPLD
590 :     SKRVWVMPGFTAADDKGRTVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
591 :     ADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPEAPGTLVSNAVD
592 :     ETGLQVKAISSLDNQTMFDVSGPGMKGMVGMASRTLGAIARAGVSVSLITQSSCEYSISF
593 :     CVAGKDAAKVQSALEQEFELELKSELLEPLEMQSGLAIVSLIGDGMRTHKGVAAKFFSAL
594 :     AQASVNIRAIAQGSSERSISAVVEQRKVQNAIGACHQRFFDVQQYLDVFLV
595 :     >Sbal_Ad_|_CG-04
596 :     MKVMKFGGTSLANWQRFSMAADIVAQSSKLEPIATVLSAPATVTNALLEMVDVAVKGEDY
597 :     LPVLQHVEWVFTSLYQDAVNSVLSSEQSEQLFSGLNAQLVIWQDRLRGIGLLQECPDGIR
598 :     AEIVVAGERLSAALMEQVMISKGITSAQLDPRALFLGRGRPLESVVDIAVSKPRFRALAL
599 :     GEKRVWVMPGFTAADEQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
600 :     VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
601 :     DETGLQVKAISNLDNQTMFDISGPGMKGMVGMASRTLAAISRSGVSVSLITQSSSEYSIS
602 :     FCVATSDSAKVKWALEQEFELEIKSDLLEPIAMRHELAIVSLIGDGMRTHKGVAARFFQA
603 :     LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
604 :     >Sden_Ab_|_CG-04
605 :     MKVMKFGGTSLANWSRFSMAADIIIEAAAVEAVSTVLSAPATVTNSLLEIADLAVNKEDF
606 :     EPVLKHISNVFNELYQGAASELTSVQQALLMQQFQTQFDEWQDRLKGIGLLSECPDSVRA
607 :     QIVVSGERLSAGLMQQVLLARKVSAGLLDPLALFMAHGEVLESVVDIAISKPRFSALTLE
608 :     SNKVWVMPGFTAADAKGRVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
609 :     HDAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIKNSFNPSAPGSLVSNDLD
610 :     TTGLQVKAISNLDHQTMFNVSGPGMKGMVGMASRTLAAISRSGISVSLITQSSSEYSISF
611 :     CVATSEAQKAKWALEQEFELEIKSELLEPIELRQGLAIVSLIGDGMKTHKGVAAKFFSAL
612 :     AKASVNIIAIAQGSSERSISTVIEQSKTKHAVCACHQAFFDVQQYLDVFLV
613 :     >Sfri_Ac_|_CG-04
614 :     MKVMKFGGTSLANWSRFSMAADIIADTASTESVATVLSAPATVTNALLEMVDIAVNQQDY
615 :     QPVLDHINGVFSGLFSDATSLITAVQHKLLVEKLAAQMQVWKDKLYGIRLLGECPDSVRA
616 :     ELVVTGERLSAALMEQVMLAKDITSAQLDPVALFLAHGQPLESVVDIAVSKPRFTLLPLD
617 :     QYRVWVMPGFTAADAQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
618 :     ADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQYQIPCYIKNSFNPSAPGTLVSNDDD
619 :     KTGLQVKAISNLDNQTMFNVSGPGMKGMVGMASRTLAVISRSGISVSLITQSSSEYSISF
620 :     CVSTSQANKAKWALEQEFELELKSELLEPIELRQDLAIVSLIGDGMKTHKGVAAKFFTAL
621 :     AKASVNIIAIAQGSSERSISTVIQQKKTKHAIGACHQAFFDVQQYLDVFLV
622 :     >Sloi_Ac_|_CG-04
623 :     MKVMKFGGTSLANWQRFNSAAQIVLASAAEQPTAVVLSAPATVTNGLLEMVDLAVAGDDF
624 :     FPVLSQVHEVFKTLYGQAASEVLSGEQSDSLEAVLAAQLKHWQDKLQGVVLLGECPDAVR
625 :     AEIVVGGERLSAALMEQLMLAAGVSANQLVPQQLFVAHGPALESVVDIAASKQRFAELSL
626 :     DAHQVWVMPGFTAGDKDGRVVTLGRNGSDYSAAVLSACIDASCCEIWTDVDGVYNTDPRV
627 :     VADAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIRNSFNPQAPGTLVSNQV
628 :     DETGLNVKAISNLDEQTMFDIAGPGMKGMVGMASRTLGAISRSGVSVSLITQSSSEYSIS
629 :     FCVATQDAERVRVALEQEFELELKSEILEQIAMRHNLAIVSLIGDGMRTHKGVAGKFFQA
630 :     LAQANVNIVAIAQGSSERSISAVIELRKTKHAIAACHQSLFDVQHYLDVFLV
631 :     >Sone_Ad_|_CG-04
632 :     MKVMKFGGTSLANWQRFSMAADIVAKAATMEPVATVLSAPATVTNALLEMVNLAVKGEDY
633 :     SPVIQHVERVFTSLYQDAVSSGLSSTQSELLFAGLGAQLARWQDRLHGITLLQECPDGIC
634 :     AEIVVAGERLSAALMEQVMLAKGITSAQLDPRKLFLGRGRPLESVVDIAVSKPRFKNLLL
635 :     DEKRVWVMPGFTAADEDGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
636 :     VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNLA
637 :     DASGLQVKAISNLDNQTMFDVSGPGMKGMVGMASRTLAAISRSGVSVSLITQSSCEYSIS
638 :     FCVATSESAKVKLALEQEFELEIKSDLLEPIEMRHDLAIVSLIGDGMRTHKGVAARFFQA
639 :     LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
640 :     >Sput_Ad_|_CG-04
641 :     MKVMKFGGTSLANWQRFSMAADIVAKSSKLEPIATVLSAPATVTNALLEMVDVAVKGEDY
642 :     SSVLQHVERVFTSLYQDAVTSMLSSEQSEQLFSGLNAQLVIWQDRLRGISLLQECPDGIR
643 :     AEIVVAGERLSAALMEQVMLSKGITSAQLDPRALFLGRGRPLESVVDIAISKPRFRALAL
644 :     GEKRVWVMPGFTAADEQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
645 :     VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
646 :     DETGLQVKAISNLDNQTMFDISGPGMKGMVGMASRTLAAISRSGVSVSLITQSSSEYSIS
647 :     FCVATSDSAKVKWALEQEFELEIKSDLLEPIAMRHELAIVSLIGDGMRTHKGVAARFFQA
648 :     LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
649 :     >SHEW-3d_|_CG-04
650 :     MKVMKFGGTSLANWQRFSMAADIVAKAAKAEPVATVLSAPATVTNALLEMVDVAVKGEDY
651 :     SPVIQHVERVFTSLYQDAVSSGLSSSQSEVLFAGLSVQLARWQDRLRGITLLQECPDGVR
652 :     AEIVVAGERLSAALMEQVMLAKGITSAQLDPRELFLGRGRPLESVVDIAVSKPRFKNLAL
653 :     DEKRVWVMPGFTAADEDGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
654 :     VTDAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
655 :     DESGLQVKAISNLDNQTMFDVSGPGMKGMVGMASRTLAAISRSGVSVSLITQSSCEYSIS
656 :     FCVATSDAAKVKSALEQEFELEIKSDLLEPIEMRHDLAIVSLIGDGMRTHKGVAARFFQA
657 :     LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
658 :     >Bflo_a_|_CG-04
659 :     MRVLKFGGTSLSNASQFIHVANILEKNAQKEQIAVVLSAPARVTNYLVEAINNTLRGNNI
660 :     LESVLNIENIFNTLLKDIAQFQSKFNYVVFHNTLKQEFNSLKQLLQGISLLNFCPDSVNA
661 :     HIICLGEKWSVILMQGILIAKDLKIINLDPVKSILTQGDGYSTSVVNIEESTCRIHNVLL
662 :     SHYADIILMAGFMAGNKKGELVTLGRNGSDYSAAILAACLQARRCEIWTDVDGIYTCDPR
663 :     QVPDARLLHELSYQEAMELSYFGAKILHPRTIVPIAQFHIPCLIKNTSKPDFSGTLISAK
664 :     NKDINIIAKGITYLKDMVMINVSGPGMKGMIGMAARVFAAMSRATCSVVLITQSSSEYSI
665 :     SFCVPYQEYAKACDALDEEFNLELKNGLLEPIGVICDLAIISVVGDGMRTQLGLSGKLFG
666 :     ALARASINIIAISQGSSERSISVVVKNNVTTIGVKAVHQTLFNTDQIIEVFII
667 :     >Baph_Aa_|_CG-04
668 :     MKLLKFGGTSLANAEKFLSVSSIIEENTQTDQIAVVLSAPAKITNYLVKIIENTIKNNQI
669 :     LETVHLAENIFMQLINNFLNIQSNFPHKEIEKIIKKEFNELKNIIQGILLLKQCPDNIRA
670 :     IIISRGEILSVFIMKSILQSKNYNVTIINPVKNLVAIGDNYLDSTVDISESKKNIQNMNI
671 :     NQSNIILMAGFIAGNKDKKLVVLGRNGSDYSAAVLAACLDANCCEIWTDVDGVFTSDPRK
672 :     VPNARLLKSISYQEAMELSYFGAKVLHPRTIEPIAQFKIPCLIKNTNNVKSIGTLICEQN
673 :     CSEKDFLKGVTHLDEIAMFNISGPHIKDVGSVISRIFTMMSRGNIKILLITQSSSENKIN
674 :     FCVYEHDIYKILYLFNKEFQLELKDGLLNPFKIKKNLSILSIVGSNIYKKHNIASKIFSV
675 :     LGALKINVIAISQGSSKHSISLVIKKENILKAVQHVHNTLFFNKKTIHMFLI
676 :     >ENTE-2c_|_CG-04
677 :     MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
678 :     LPNISDAERIFTELLQGLADLQPGFPLAPLKAFVEQEFAQIKHVLHGISLLGQCPDSINA
679 :     ALICRGEKLSIAIMAGLLEARGHKVAVIDPVEKLLAVGHYLESTVDIAESTRRIAASKIP
680 :     ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
681 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTISPIAQFQIPCLIKNTGNPQAPGTLIGASHD
682 :     EDDLPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRNGISVVLITQSSSEYSISF
683 :     CVPQADCMRARRALEEEFYLELKEELLEPLSIQERLAIISVVGDGMRTLRGISAKFFAAL
684 :     ARANINIVAIAQGSSERSISVVVSNDDATTGVRVTHQMLFNTDQVIEVFVI
685 :     >Patr_Ac_|_CG-04
686 :     MRVLKFGGTSVANAERFARVADIIENNARQGQVATVLSAPAKITNHLVAMIEKTVAGQDI
687 :     LPHLNDAETIFSSLLQGLAASQPGFEHARLKAFVEQEFAQLKHVLHGIALLGQCPDSVNA
688 :     AIICRGEKLSIAIMEAVFQARGYGVSVINPVEKLLAQGHYLESTVDITESTRRIAESAIP
689 :     KDHVILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
690 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTENPQAPGTLIGMDST
691 :     DTQYPVKGITNLNNMAMVNVSGPGMKGMVGMAARVFAAMSRAGISVVLITQSSSEYSISF
692 :     CVSQNELARARKTLEDEFYLELKEGVLEPLDVMERLAIISVVGDGMRTLRGLSARLFSAL
693 :     ATANINIVAIAQGSSERSISVVVNNDVATTGVRVAHQMLFNTDQVIDVFVI
694 :     >Ecol_Ac_|_CG-04
695 :     MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
696 :     LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
697 :     ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
698 :     ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
699 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
700 :     EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
701 :     CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
702 :     ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
703 :     >Plum_Ac_|_CG-04
704 :     MRVLKFGGTSVANYQRVLSVADIAEKKFSQGGVALVLSAPAKITNHLVAMIEKTVAGQEI
705 :     ITHMHDAEQIFVDLLQGMARAQPGFAYERLKMMVEQEFAQLKQVLHGISLLGQCPDSINA
706 :     SLICRGEKLSIAIMESVLQARGHKVTVIDPVENLLAQGHYLESTVDINESTKRIASLNIP
707 :     DDHIVLMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRATCCEIWTDVDGVYTCDPRVV
708 :     PDARLLKGMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTANPDAPGTLIGDGQK
709 :     DESTPVKGITNLSNMAMINVSGPGMKGMVGMAARVFAVMSRKGISVVLITQSSSEYSISF
710 :     CVPQRELERARQALSEEFYLELKEGVLDPLDVMENLSIISVVGDGMRTLRGISARFFSAL
711 :     ARGNINIVAIAQGSSERSISAVIDNEVATTAVRLCHQMLFNTDQVIEVFVV
712 :     >Sent_Nc_|_CG-04
713 :     MRVLKFGGTSVANAERFLRVADILESNSRQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
714 :     LPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHVLHGISLLGQCPDSINA
715 :     ALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASQIP
716 :     ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
717 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASSD
718 :     DDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMSRAGISVVLITQSSSEYSISF
719 :     CVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
720 :     ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
721 :     >Styp_Ac_|_CG-04
722 :     MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
723 :     LPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHVLHGISLLGQCPDSINA
724 :     ALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASQIP
725 :     ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
726 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASSD
727 :     DDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMSRAGISVVLITQSSSEYSISF
728 :     CVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
729 :     ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
730 :     >Sboy_Ab_|_CG-04
731 :     MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
732 :     LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
733 :     ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
734 :     ADHMVLMAGFTSGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
735 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
736 :     EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
737 :     CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
738 :     ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
739 :     >Sdys_Ac_|_CG-04
740 :     MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
741 :     LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
742 :     ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRMP
743 :     ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRVDCCEIWTDVDGVYTCDPRQV
744 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
745 :     EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
746 :     CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
747 :     ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
748 :     >Sfle_Ac_|_CG-04
749 :     MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
750 :     LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
751 :     ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
752 :     ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
753 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
754 :     EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
755 :     CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
756 :     ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
757 :     >Sson_Ac_|_CG-04
758 :     MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
759 :     LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
760 :     ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
761 :     ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
762 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
763 :     EGELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
764 :     CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVMERLAIISVVGDGMRTLRGISAKFFAAL
765 :     ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
766 :     >Sglo_Ab_|_CG-04
767 :     MRVLKFGGTSVANAERFIRVADILESNSRQGQVAAVLSAPAKITNHLVAMIDRTLNGSDI
768 :     QPNILDAEQIFSRLLDGLAAAQPEFDHAALRSVVEQEFAQLKQLLHGISLLKYCPDNVNA
769 :     AIICRGEKLSIALMEALLRARGFGVTVIDPVAKLLAQGGYLESTVDIAESTRHINDAAIP
770 :     ADHIILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPHQV
771 :     PDVRLLSQLSYQEAMELSYFGAKVLHPRTIVPIAQFQIPCLIKNTTNPQAPGTLIGPTSG
772 :     EEGNPVKGITHLNNMAMINVFGPGMKEMIGMAARVFAAMSRAGSSVVLITQSSSEYSISF
773 :     CVPQHELAGARRALEEEFYLELKDGLLEPLDVISRLAIISVVGDGMRAQRGLSAKLFVAL
774 :     ACANINIIAIAQGSSERSISVVVDNDSTTTGVRVAHQMLFNTDQVIEVFVI
775 :     >Wglo_Aa_|_CG-04
776 :     MRVLKFGGTSISSLKCFSKVVNIIKKNYKKDQIAVVLSAPKKVTDNLFYMIEKSCQTKDI
777 :     KEIFNNTKDIFFYLIKSLFDSNENYYYLNIYNFIELKFNRLLYLLNIVFNLKFCPNSINA
778 :     EIVCMGEIISVKLMELYLKNKNIDVFVIDPKKIFLSKGQYLESFIDIKESERRIKKINFP
779 :     KNKVILMAGFIAKNKYGELVALGRNGSDYSATALAACLKANVCEIWTDVDGIYTGDPNKI
780 :     KNTKLINKLSCKEAISLSYLGAEILHKRSIFPILEFNIPCIIKNTNNSNSYGTSILNIVN
781 :     DEKEIIKGITFLKDIAMISIFICYNIKTINIYNRILVAFKKSNIKIIFMMQSSSESNINI
782 :     FIFQNNLSESKCIIEYEFCFEINNKLFESIHYKSDLFILSMIGSNIFKNKNIFINIVKFF
783 :     NFIHKKMISILYGGYLSNAFSVVLESCNIVNDLNNMHKIFFEKKNFIEIFIIGNKNIKNC
784 :     LFNLFYKKKFFF
785 :     >Yent_Aa_|_CG-04
786 :     MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
787 :     SPNISDAERIFSELLRGLADAQPGFEYERLKALVAHEFAQLKHVLHGISLLGQCPDSINA
788 :     AIICRGEKLSIAIMEALFQAKGYKVSVINPVEKLLAQGHYLESTVDITESTRRIGSSSIP
789 :     TDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRVV
790 :     PDARLLKSMSYQEAMELSYFGASVLHPRTIAPIAQFQIPCLIKNTSNPQAPGTLIGGESS
791 :     DDGFPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
792 :     CVPQGELIRARQALEEEFYLELKDGLLEPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
793 :     ARANINIIAIAQGSSERSISVVVSNDAVTTGVRVCHQMLFNTDQVIEVFVI
794 :     >Ypes_Ab_|_CG-04
795 :     MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
796 :     SPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHLLHGISLLGQCPDSINA
797 :     SIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLESTVDITESTRRIGASGIP
798 :     SDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRTV
799 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCLIKNTSNPQAPGTLIGGESI
800 :     DEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
801 :     CVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
802 :     ARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQMLFNTDQVIEVFVI
803 :     >Ypse_Ab_|_CG-04
804 :     MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
805 :     SPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHLLHGISLLGQCPDSINA
806 :     SIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLESTVDITESTRRIGASGIP
807 :     SDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRTV
808 :     PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCLIKNTSNPQAPGTLIGGESI
809 :     DEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
810 :     CVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
811 :     ARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQMLFNTDQVIEVFVI
812 :     >Hinf_Aa_|_CG-04
813 :     MRVLKFGGTSLANPERFSQAAKLIEQAHLEEQAAGVLSAPAKITNHLVALSEKAALNQST
814 :     DTHFNEAIEIFYNIINGLHAENNQFDLNGTKALIDAEFAQIKGLLEEIRQAGKVEDAVKA
815 :     TIDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAKGGYLESSVEIEESTKRVDAANIA
816 :     KDKVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASVCEIWTDVDGVYTCDPRLV
817 :     PDARLLPTLSYREAMELSYFGAKVIHPRTIGPLLPQNIPCVIKNTGNPSAPGSIIDGNVK
818 :     SESLQVKGITNLDNLAMFNVSGPGMQGMVGMASRVFSAMSGAGISVILITQSSSEYSISF
819 :     CVPVKSAEVAKTVLETEFANELNEHQLESIEVIKDLSIISVVGDGMKQAKGIAARFFSAL
820 :     AQANISIVAIAQGSSERSISAVVPQNKAIEAVKATHQALFNNKKVVDMFLV
821 :     >Hsom_Aa_|_CG-04
822 :     MRVLKFGGTSLANPQRFLQAAALIEKAHLEEQAAGVLSAPAKITNHLVALSEKAALNQPT
823 :     DGHFDEALEIFYNIINGLYAENTHFDLVGTKALIESEFAQIKGLLENIRQAGKVDDAVKA
824 :     TIDCRGEKLSIAMMNAWFEAKGYTVTVINPVEKLLAYGSYLESSVDIAESTKRVDAKSIP
825 :     AKNIVLMAGFTAGNDKGELVLLGRNGSDYSAACLAACLGASVCEIWTDVDGVYTCDPRLV
826 :     PDARLLSSLSYREAMELSYFGAKVIHPRTIGPLVEPQIPCLIKNTGNPEGAGSIIDNREN
827 :     ISEGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAMSKASVSVILITQSSSEYSIS
828 :     FCVPTKAIEKAKAALNAEFEQELVAKDLDPVEVIHDLSIISVVGDGMAQSKGIAASFFSA
829 :     LASANISIVAIAQGSSERSISAVVPLNKAIEAVKATHQALFNNRKVVDMFLV
830 :     >Msuc_Ab_|_CG-04
831 :     MRVLKFGGTSLANPERFLQAARLIEKAHLEEQAAAVLSAPAKITNHLVALSEKASLNQPT
832 :     ETNFNEALDIFYNIINGLHEKNNNFDLKGTSQLIESEFNQLAELLEQIRQAGKVEDAVKA
833 :     TIDCRGEKLSIAMMKAWFEACGYEVTVINPVEKLLAYGNYLESSVDIEESAKRVDVASIP
834 :     KNNVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLNASACEIWTDVDGVFTCDPRLV
835 :     PDARLLPSLSYREAMELSYFGAKVIHPRTIGPLVRSNIPCLIKNTGNPTAPGSIIDGNEP
836 :     QSGELQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSTMSKAGVSVILITQSSSEYSIS
837 :     FCVPSKLAAKAKDALNTEFAKELLDKDLEPVEVIEDLSIISVVGDGMKQAKGIAARFFSA
838 :     LSQANISIVAIAQGSSERSISAVVAQNKAIEAVKSTHQALFNNKKSVDMFLV
839 :     >Pmul_Ab_|_CG-04
840 :     MRVLKFGGTSLANPERFSQAAQLIEKAHFEEQAAGVLSAPAKITNHLVALSEKASLNQPT
841 :     DANFNEAIEIFYHIIHGLHAENNRFDLEGTKALIDTEFAQISQLLEEIRQQGFVSDAVKA
842 :     TIDCRGEKLSIAMMKAWFEARGYDVTVIDPVEKLLAHGSYLESSVDIEESTKRVDAKSIP
843 :     TKNVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASACEIWTDVDGVFTCDPRLV
844 :     PDARLLPSLSYREAMELSYFGAKVIHPRTIGPLVQTNIPCLIKNTGNPSAPGSIIDGNIQ
845 :     SEQLQVKGITNLDNVAMFNVSGPGMQGMVGMASRVFSAMSNAGVSVILITQSSSEYSISF
846 :     CVPAKSVEVAKQALEKEFEQELKANDLEPIDVIRDLSIISVVGDGMKQAKGIAARFFSAL
847 :     AQANISIVAIAQGSSERSISAVVALNKAIEAVKATHQALFNNKKVVDVFLV
848 :     >Aple_Ab_|_CG-04
849 :     MRVLKFGGTSLANPERFIQAADIIEKAHLKDQAAGVLSAPAKITNHLVAIVDKAIAGESF
850 :     ESNLKEATEIFHNIINGLYAINNKVDREGLLALVEAELAQIQSVASEAAKSKSLPDSVAA
851 :     TIHCRGEKLSIAMMQAWFEAKGYEVTRIDPVEKLLAHGSYLESSVDIAESTKRVDANSIP
852 :     KKNVVLMAGFTAGNENGELVLLGRNGSDYSAACLAACLKADCCEIWTDVDGVYTCDPRLV
853 :     PEAICLESMSYQEAMELSYFGAKVIHPRTIGPLVPLNIPCLIKNTANPDAKGTLIDGNVA
854 :     TDGLKVKGITNLDNVAMFNVSGAGMQGMVGMAARVFSTMSKAGISVILITQSSSEYSISF
855 :     CVPAKFEEKATACLNAEFAQELSKGDLDPIDMIRELSIISVVGDGMRTAKGIAARFFSSL
856 :     AQANISIVAIAQGSSERSISAVVPMNKAIEAVKATHQGLFSNKKSIEVFLV
857 :     >Ppro_Bd_|_CG-04
858 :     MRVFKFGGSSLSDAERFLRAADIIANNAQQGDVSVVLSAPGKVTNKLVSVIDSTVKTGEA
859 :     DLQVADLETVFNELFSGLKALVPSFDKDLVDAKLASSLGQLKQYVHGMKLLGLCPDNVYA
860 :     KIISKGERLSIVTMKALLEAKGQPASLIDPVAYLFAQGDYLEAHVDIEVSTQNFKRNPLP
861 :     EGHVNIMPGFTAGNSDGELVTLGRNGSDYSAAVLAACLRAECCEIWTDVDGVYSCDPRIV
862 :     PDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFSPQGAGTLIGLDTG
863 :     EDNLAIKGITTLKNLTMVNVSGPGMKGMVGMAARVFGAMSISGVSIVLITQSSSEYSISF
864 :     CIESDDKVAVQQALQNNFELELKEGLLEPIEFVDDSAIVTLVGDGMRTSQGVASRFFTSL
865 :     AEVNVNIIAIAQGSSERAISAVIPAMKVAEAVKACHENLFNSKHFLDVFVI
866 :     >Vcho_Fd_|_CG-04
867 :     MHLEEGMRVLKFGGSSLADPERFLRAADIIANNAQQEEVAVVLSAPGKTTNKLVAVIESA
868 :     LRQGEVEAQIVELESSFYALLDGIKAQLPNLDDSAYQQQVHSSMTQLRQFVHGITLLGMC
869 :     PDNVNARIISKGERVSIQLMKAVMEAKGLPANLVDPVKYLLAKGDHLEAMVDVEISTQRF
870 :     RQAPLPQQHVNIMPGFTAGNAQGELVCLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYN
871 :     CDPRLVDDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFQIPCLIKNSFNPQGAGTL
872 :     IGQDTGEDKLAIKGITTLSNLTMVNVSGPGMKGMVGMASRVFGAMSAADVSIVLITQSSS
873 :     EYSISFCIEAQHKALAQQALADAFELELKDGLLEPVEFVDNVAIITLVGDGMRTSRGVAS
874 :     QFFSSLAEVHVNVIAIAQGSSERAISAVIPDDKISEAIKACHENLFNSKHFLDVFVV
875 :     >Vfis_Ae_|_CG-04
876 :     MRVLKFGGSSLADSDRFLRAADIIANNAQQQEVSVVLSAPGKVTNKLVSVVDNLLTNGEA
877 :     ELQISELESVFTQLFSGISNTLPQVDLKLLENKLKDSISQLRQYAHGITLLGMCPDNVYA
878 :     KIISKGERISIVMMKAVLEAKGQPASLIDPVKYLYAKGDYLEGAVDVDVSTLNFKNEPLP
879 :     QGHVNIMPGFTAGNAKGELVTLGRNGSDYSAAVLAACLRAECCEIWTDVDGVYNCDPRLV
880 :     DDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
881 :     EDNLAIKGITTLNNLTMVNVSGPGMKGMVGMASRVFGAMSATGISIVLITQSSSEYSISF
882 :     CIEAEDKCKAEQVLREAFELELKDGLLEPVEFTDNVAIVTLVGDGMRTSKGVASQFFTSL
883 :     TEVNVNIIAIAQGSSERAISAVIPEDKVSESIKACHENLFNSKHFLDVFVV
884 :     >Vpar_Ae_|_CG-04
885 :     MRVLKFGGSSLADADRFLRAADIIANNAQQEEVAVVLSAPGKTTNKLVAVIEGALRNGEA
886 :     ELQINELEESFKTLFADIQAVLPNLEGAAFDNQVKTSLSQLRQFVHGINLLGMCPNNVNA
887 :     RIISKGERVSIQLMKAVLEAKGQKANLIDPVEYLYAKGDHLEAMVDVDVSTQNFRQNPLP
888 :     KDHVNIMPGFTAGNEKGELVTLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYNCDPRLV
889 :     EDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
890 :     EDNLAIKGITTLNDLTMVNVSGPGMKGMVGMASRVFGAMSSAGVSIVLITQSSSEYSISF
891 :     CIEADDKLKAQQVLADAFELELKDGLLEPVDFIDDVSIVTLVGDGMRTSRGVASRFFSSL
892 :     AEVNVNIVAIAQGSSERAISAVIPEDKISEAIKACHENLFNSKYFLDVFVV
893 :     >Vvul_Ab_|_CG-04
894 :     MRVLKFGGSSLADADRFLRAADIVANNAKQEEVSVVLSAPGKTTNKLVAVIESALKNGEA
895 :     ERQVDELDSAFKQLLSDIKQQLPSLNGDAYLKQVADSLSQLRQFVHGIGLLGMCPDNVNA
896 :     RIISKGERVSIQLMKAVLEAKGHLVNLIDPVDYLLAHGDHLEGMVDVDVSTQNFRSNPLP
897 :     QGHVHIMPGFTAGNKHGELVTLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYNCDPRLV
898 :     EDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
899 :     EDNLAIKGITTLNNLTMVNVSGPGMKGMVGMASRVFGAMSASGVSIVLITQSSSEYSISF
900 :     CIEAADRPLAEQALSDAFELELKDGLLEPVEFLTNVSIITLVGDGMRTSKGVASQFFASL
901 :     AEVSVNVIAIAQGSSERAISAVIPEDKISQAIKACHENLFNSKHYLDVFVV
902 :     >Bfra_Ab_|_CG-05
903 :     MKVMKFGGTSVGSVNSILSVKKIVESAGEPVIVVVSALGGITDQLISTSRMAAMGDAAYE
904 :     GAYREIVRRHEEMVQGVIPAGETQTLLHYQVNELLDELKDIFQGIYLIKDLSPKTSDTIV
905 :     SYGERLSSLIASRLIQGAVWFDSRTFIKTEKKHNKHTLDTELTNRLVREAFKEIPRVSLV
906 :     PGFISSDKVSGDVTNLGRGGSDYTAAVIAAALDADSLEIWTDVDGFMTADPRVISTAYTI
907 :     SELTYVEATELCNFGAKVVYPPTIYPVCHKNIPILIKNTFNPDAQGTVIKQHVDHTKSKA
908 :     IKGISSINDTSLITVQGLGMVGVIGVNYRIFKALAKNGISVFLVSQASSENSTSIGVRNA
909 :     DADLACEVLNEEFAKEIEMGEISPIQAEKNLATVAIVGENMKHTPGIAGKLFGTLGRNGI
910 :     NVIACAQGASETNISFVVDSKSLRKSLNVIHDSFFLSEYQVLNLFIC
911 :     >Bthe_Ab_|_CG-05
912 :     MKVMKFGGTSVGSVNSILSVKRIVESAGEPVIVVVSALGGITDKLINTSKMAAAGDSAYE
913 :     GEFREIVYRHVEMIKEVIPAGAGQVALQRQIGELLNELKDIFQGIYLIRDLSPKTSDTIV
914 :     SYGERLSSIIVAELIDEAKWFDSRTFIKTEKKHNKHTIDADLTNQLVKEAFHSIPKVSLV
915 :     PGFISSDKVSGDVTNLGRGGSDYTAAIIAAALDASSLEIWTDVDGFMTADPRVISTAYTI
916 :     SELSYVEATELCNFGAKVVYPPTIYPVCHKNIPIIIKNTFNPDGVGTVIKQETSNPQSKA
917 :     IKGISSINDTSLITVQGLGMVGVIGVNYRIFKALAKNGISVFLVSQASSENSTSIGVRNA
918 :     DADLACEVLNEEFAKEIEMGEISPILAERNLATVAIVGENMKHTPGIAGKLFGTLGRNGI
919 :     NVIACAQGASETNISFVVDSKSLRKSLNVIHDSFFLSEYQVLNLFIC
920 :     >Fjoh_Ac_|_CG-05
921 :     MKVLKFGGTSVANAQNIKLVLEIVNKKAANDKLVVVVSALSKVTDLLQSAAAKAAANDES
922 :     FREVVAEIEKKHLDTLKELIPVSEQSSLLSHVKRIINHLETLLDGCFLLGELSPRTADTI
923 :     LSFGELLSSFIIAQAFQQTEKDAVYKDSRELIKTDNNFGKAAVNFEVSNQLIKEYFAGNK
924 :     AKINILPGFIAQTLDGITSTLGRGGSDYTAAIIAGALDAEQLEIWTDVNGMFTANPKIVK
925 :     QAQPIANISYQEAMELSHFGAKVLYPPTIQPVLRKNIPILIKNTFEPEAVGTLISDTVVS
926 :     KDTVVKGISHIDNISLVTLEGPGMIGVAGSSRRLFEVLSQEKINVIFITQASSEHSICIG
927 :     ILNSDADKAEAAINRAFEIEISQNKIDPCYVEKDLCIIALVGENMKNHQGLSGRMFSTLG
928 :     KNNVNIRAIAQGASERNISTVINERDVKKALNTLHENFFEENTKQLNLFVM
929 :     >Fjoh_Ab_|_CG-05
930 :     MKVLKFGGKSLSNGEGLNKVVSIISDKVNQGEQIAVVVSARGNATDELEDILRIAAKNGN
931 :     YKPLLESFKAYQTSDYPQVDLSEEFNILDKLFEGVSLIGDYSNKIKDQILSKGELLSAKL
932 :     LTSILVEKGIPANFVDTRELLKTDSKFGDAQPLEQLSKKNVINYFKLHNGETVNIVTGFI
933 :     GSNNNNDTTTLGRNGSNYTASLIANYLDAEELQNFTHVDGIYTANPDLVADAKKIEFLSF
934 :     NEANELANFGATILHAKTIIPLLEKNIPLRILNTFNHENHGTLITSNSAKEGIKTLSVLE
935 :     NVSLVNLEGRGLLGKAGVDARIFKVMGDHNISVSIISQGSSERGIGLVVAKDKATLAMVE
936 :     LEKEFENDFYSKDVNQITVTDNVSVISIIGQDLSTFHKPYTALIKNKIVPILFNNTVTGK
937 :     NVSLVVKKEELNKALNVIHGEIFGVSKKINIAIF
938 :     >Gfor_Ac_|_CG-05
939 :     MHILKFGGSSLATPERIKLVAKTIQKHLENDTVVSVFSAFGGVTNDLLLMAELAEKEDDS
940 :     YKAILAKNEKRHFEAVKELIPVTAQSAILSKVKNQFNRLETLYEGVFLLNELSDKTKHVI
941 :     SGFGEILSSLIISEYFKSLKVDSLWVDSRDLIVCKNVNEKVQVNYTKTNFNLTEFFKKNK
942 :     SELFIVPGFVAKNDLGVPSTLGRGGSDFTAAIIAGALEVDQVLIYTDVNGMFTANPNLVP
943 :     QAYALKNISYEEAMELSHFGAKVLYPPTLQPLLDKNIEIYIKNTFEPDNPGTLISKSSER
944 :     NFRWVTGITHIDSIKLLNIEGSGMVGIPGFSKRFFEILFQENINVVLITQASSEHSICIA
945 :     VKDDEAEKAKEALDEAFEVEIGYKKIKPVEIEDNVSIIALVGDRMKSHHGLSGKMFSALG
946 :     NNNINIRAIAQGSSERNISAVISKKDVVKALNTLHEQFFEVPSKELNLFIT
947 :     >Chut_Ab_|_CG-05
948 :     MKVLKFGGTSVGSVESIRKVAEILSSYKKKEKFVVVFSAMSGITNLLVEVGQKASTTDIS
949 :     YQQVLKTIEQKHVSTAKTLIDVKNQGKVIAQLKLILNELQDLLHGVYLLKELSPRSNDLV
950 :     LSFGERLSSYLVSEFLKQEGVDVTFLDARKVIITDSSFGSAKVDFKKTDKAIKDYFKDIK
951 :     SSVVTTGFIGSTDKGETTTLGRGGSDYTASVFGAALDSEGIEIWTDVDGIMTADPRKVKR
952 :     AFTLPQVSYIEAMEMSHFGAKVIYPPTLQPAFKKRIPIWIKNTFNTAFEGTLINEKTSAT
953 :     DHSVKGISSIENISMLNLTGSGMVGVPGVSGRLFGALARNFINVILITQASSEHSICFVI
954 :     DSKESAKAKDAVEEEFEHEIKAGKIDKLHEKDNLAIVAVVGDNMRHTPGIAGKLFSSLGK
955 :     NGINVVAIAQGSSEINLSVVIGKEDLTKALNVIHESFFLSDVKTINVFVV
956 :     >Cchl_Ab_|_CG-05
957 :     MKIYKFGGTSLGSAQLMKNAAALIAAALPSEPIIVVVSAIHPVTDLLLEAARQASRGDAA
958 :     YCEKLQTVEALHATLASLLLEGENFSTTQQTIELELAELGKLMQGVYLLRELSEKSEALL
959 :     VSFGERLSAKLLSAYLSAQQVAASFVDARALIVTDASYSDARVDMAASTERIQHFFKSIA
960 :     QAVPVVTGFIAAAPDGSVTTLGRGGTDYTASILGAALGASEIVLWGDVDGFFSADPLRVR
961 :     DAQVLPAISYQEAMELSHAGACVLHPLAVQPAMKAGIPLLIKNVTNPTAHGTCITAKGAL
962 :     PHRPTLSVTALTSLNNIVLLTMSGSGMAGMPGIASRLFSVLARHRINIIFISQASSEQCI
963 :     TLAINPQQAEKAGALLEAEFAREREARQIEPLGIRRNLSMIAVIGNNMSGHPGVSAQLFE
964 :     TLGKNGINVVAVAQGANEMNISLVVESHDEEKALNCIHESFFLSQSKVHLFIA
965 :     >Cpha_Ab_|_CG-05
966 :     MKIYKFGGSSLGSAARIRKVAAIIAGARSEGPLVVVVSALFRCTDMLLESANEACLGDEN
967 :     YRKTFEEFDALHRNIAADLFNAEVCSDVVSAMSDELLELSDLLHGVFLLRELSEKSTALI
968 :     LSFGERLSARLISRFLPDGYYVDGRNLVVTDSNPLCARVDRHATEKRIQSALSSCSGVPV
969 :     VTGYIAAAPDGTVTTLGRGGSDYTASLVGASLSASEIVIWTDVDGFYSADPKRVRDARVL
970 :     PYISYAEAMELSHAGAKILHPFSIQPAMKASIPVLIRNSFNPDAPGTRIERDVQQEMKDR
971 :     LPVTGLSSINKVVLLNLAGSGMVGVPGIASRLFSCLALHGINIIFISQASSEQSISLAIN
972 :     PLQAEKAKKILEAEFHSEIESRLIDPLLIRRSLALIAVVGNNMSGHPGVSAQLFETLGKN
973 :     GINVIAVAQGANEMNISLVIESHDEDKALNCIHESFFLSQRKVHVFLA
974 :     >Ctep_Ab_|_CG-05
975 :     MRVFKFGGSSIASAAKISNVAGIIRRELKSTPLVVVVSAIGKVTDMLAETAALAGNGDAA
976 :     YRDKLEGIASLHGGIIRELFGTEASAEETWLGEMMAELNDVLHGVFLLRELSDKSLALVL
977 :     SYGERLSCRIVSRYMHVSGTPAECVDARSVIVTDDNHCFAKVDRLATGKLIHERFRSFDV
978 :     LPVVTGFIASAPDGSVTNLGRGGSDFTATILGAALHAEEVWIWTDVDGFYSADPKRVPDA
979 :     RVIPEISYAEAMELSHAGAKVLHPLAVQPVMKAGIPLRIKNSFNPEKPGTRIGIEAAGAE
980 :     ALPGTVTGLTSINHVVLLSLSGSGMAGVPGTASRLFTCLARHSINIIFISQASSEQSISL
981 :     AIAPGQASMAKKVLEEEFAREIEERRIDPVSVRRNLAMVAVVGNKMLGHPGVSAQLFETL
982 :     GKNGVNVIAVAQGANEMNISLVIDSADENKALNCVHESFFLSMRKVHVFIV
983 :     >Plut_Ab_|_CG-05
984 :     MKIFKFGGTSLGSADRIRNVSGIISRALADDRLVIVISAMHGVTDRLLEAARRACGGDSG
985 :     YVAVHEELAERHLSVAADLLEGQALEELSGILRRELEELHDVLHGIFLLRELSFKSSALV
986 :     QSFGERMSARIVAAWLRQAGLPAVYVDGRELIVTDASYPDARLDEPATRERVALRLARET
987 :     ELAVVTGYIAAAADGTVTTLGRGGSDYTASILGAALGAREIWIWTDVDGFFSADPKRVTD
988 :     ARVLPYISYAEAMELSHAGAKILHPLAVQPAMKASIPLIIKNSFNPGAAGTRIERDEHRD
989 :     EAVVLPVTGLTSINTVVLLNLSGSGMVGVPGIASRLFTRLARHRINVIFISQASSEQSIS
990 :     LAINPAQAAEAKLVLDDEFSAEITARQIDPLAVRRDLAMIAVVGNNMSGHPGVSAQLFET
991 :     LGKNGINVIAVAQGVNEMNISFVVESHDEDKALNCIHESFFLSRRRVHVFIA
992 :     >Pvib_Ab_|_CG-05
993 :     MKIYKFGGASLCSADRIRKVSQSIANALQNDGLVVVVSALKGVTDRLLDTARRASKGDAG
994 :     YRTLSGELEGFHLGIVDELFSAAPSRELSEAMRRELDELHDILHGIFLLRELSDRSSAMV
995 :     QSFGERFSALIVSSWLNFCGIAAQRVDGRELIVTDGASLDARVDTAMTKEKINARLPHGG
996 :     PLAVVTGFIAASPDGLLTTLGRGGSDYTATLLAASLGADEVWIWTDVDGFFSADPKRVPD
997 :     ACPLPYISYTEAMELSHAGARILHPLAVQPAMKAGIPLVIKNAFNPAAPGTRVEGEVKDD
998 :     QARRRQVTGLTSINKVALLNLSGSGMVGVPGIASRLFTCLARHRINIIFISQASSEQSIS
999 :     LAISPSQAAGARSVLQEEFRSEITARQIDSISVRRNLCMIAVVGNNMSGHPGVSAKLFET
1000 :     LGKNGINVIAVAQGANEMNISTVVESHNEDKALNCIHESFFLSRRKVHLFLA
1001 :     >Fjoh_Aa_|_CG-06
1002 :     MRVFKFGGASVKDAEGIKNVYDVLQKVGYEDVILVVSAMGKTTNALEVVIKNYFEKSEEL
1003 :     NSSVQEIKNYHFQIVLDLFKDEKHEVFAAVNAQFAELEYFLAHNKSPNYNFVYDQVVSFG
1004 :     ELISTNILSHFMNFMGIQTQWLDVRNFIKTNANYRDAEVDWETTEQNISKNVPRKQLNIT
1005 :     QGFLGADENNFTTTLGREGSDYTAGIFAYCLNAESVTIWKDVPGVMNADPRYFENASLLN
1006 :     QISYREAIELAFYGATVIHPKTLQPLQKKEIPLYVKSFINPLLKGTCVSKGVDLEPQYPC
1007 :     FIVKREQLLISLSSIDFSFIMEENISEIFGLFHEFKIKVNLIQNSAISFSVCVEDKFGNF
1008 :     NDLNAILSKKFKVEYSENVTLYTIRHFTEQAAEMVEKNKEVLLKQVSRETMQIVTKELN
1009 :     >Gfor_Aa_|_CG-06
1010 :     MIKVFKFGGASVKDADGVKNLIKVLRATGSENKLIVISAMGKTTNALEVVVKDYLNIAGI
1011 :     PASLDEVKNYHRNIITGLFPNKEASVYPKIETLFTELENFLQHNKSNQYDFVYDQVVSFG
1012 :     ELFSTTIVSEYLNSRHISSNWLDARNFIKTDSTYRDAQVNWSKTQERVQENIDPKKLNII
1013 :     QGFIASDLNNFTTTLGREGSDYSAAIMAYCLNAESVTIWKDVPGVLNADPRFFENAQLLN
1014 :     KISYEEAIELAFYGASVIHPKTLQPLQGKEIPLFVRSFLNPSEEGTAVSKGKTIFPEIPC
1015 :     FIVKKDQVLISLSSLDFSFMVEENISEIFKLFHQYQMKVDLIQNSAISFRVCVDNRFNQL
1016 :     EKLIQHLKARFKVNYKTGVSLYTIRHFNEEAINSLEKDKNVLLKQLTQNTVQLVAEN
1017 :     >Srub_Ac_|_CG-07
1018 :     MESSAPASANWRVHKFGGTSLADPARIRHVADLLGARTPPVAVVVSAMSGVTDRLLALAE
1019 :     KAHTDADGLADRLQSLRDDQRAVVTDLLDGDAAASVLRTLDQDLDDLADVLRATRLMGTA
1020 :     PDTTRDLVAGYGELWSARVLGGVLRDRGLSAAVCDAREVLVVTHEEMGPVVDWDATQERF
1021 :     ADWRAAHDAPDTIVATGFIATTPDGVPTTLGRNGSDHSAALFAALLEAEALTIWTDTDGV
1022 :     MSADPQYVPDARRLDGLSYEEAMEMAYFGAGVIHPRTLSPAVEHEIPITIRNTFAPDRPG
1023 :     TRIHLNDDGASVVKGFSTIDDVALLNLEGSGMIGVPGIARRLFDALEDEGVSVILISQGS
1024 :     SEHSICFAVPQAQAEVAREAAEHAFYAELDRGQLRTVELVPNCSILAVVGDQMAGTPGVA
1025 :     ATFFGALGEASVNVRAVAQGSSERNISAVVDRDDARRALRAAHAGFYLSKRTLSIGVI
1026 :     >Ftul_Ab_|_CG-07
1027 :     MIVHKFGGSSLATAEKIKNVSNIINCKDEAVVVSASAKTTRNLQKTIDQATIAQDYSETL
1028 :     EQIYEHHNEIIKQLIPNDENLRTLIVTDLANIKHILSTITITGFCADSLRFFILGFGEIW
1029 :     SARILTTYLKSKGKKAAFIDASECLIVNDRSYPVTVDWQQSLEKLEIIKSDNPADVYVIT
1030 :     GFIAQNKYGKRTILGLNCSDYSAAIFAKLLQANKLYIWTDVAGVYSANPQVVPEAKPLTQ
1031 :     LTYKEALELAYFGASVVHPLTIAPMALDRTPIYIKSSYTPDEVGTKISADKDENQGIIKG
1032 :     LTSVSDVAIVRVQGAGMIGVSGISFKVFGALEKANVSVMMISQASSEYSICFAIDSLDVD
1033 :     KATEALRQEFANDIKNNLIEEIIVHKHYSLITAVGEGMKSKTGSLAKLVNSLKLANINIH
1034 :     AIAQGSSERSVTFAVKAEDEVRGVQAMHRHYNSVSDDIAIAVI
1035 :     >Xaxo_Ab_|_CG-07
1036 :     MSSHAVSFEPAAVLASSARTVVHKFGGTSVADAERYRHVAQLLLARDETVQVTVVSAMKG
1037 :     VTDALIELAELAAKNRPEWRERWHETRARHRGAAVALLGEHSGPTVEWLDERFAHLSQIL
1038 :     GALAVIGELPREVLDRVQGLGEVYSAQLLGDHFRAIGEDCAVLDARDVLVVNRGELGVDV
1039 :     DWEASAQRLATWRQAHPQTRVVVTGFVARDRADRVTTLGRNGSDYSGAIFAALFDADELH
1040 :     IWTDVDGVLSADPRVVPEAVQLETLSYDEACELAYFGAKVVHPQTMSPAIERGLPIIIRN
1041 :     TFQPEHPGTRITASSAVSGPIKGLTLSPDLAVLNLEGTGLIGVPGTAERVFAALRTAQVS
1042 :     VVMISQGSSEHSICCVVKQHESERARNALLQAFAHELTVGQVQRVQLTTGISVLAAVGDG
1043 :     MAGQPGVAARLFESLGRAQVNILAIAQGSSERNISVAIDAAHATKALRAAHAGFWLSPQT
1044 :     FSVGVI
1045 :     >Xcam_Ab_|_CG-07
1046 :     MSSPVVSFEPAAVPTPSARTVVHKFGGTSVADAERYRHVAQLLLARDETVQVTVVSAMKG
1047 :     VTDALIELAELAAQNRPEWRERWHETRARHRGAAVALLGEHSGPTVEWLDERFEHLSQIL
1048 :     AALAVIGELPREVLDRVQGLGEVYSAQLLGDHFRALGEDCAVLDARDVLVVNRGELGVDV
1049 :     DWAVSAQRLDTWRQAHPQTRVVVTGFVARDRGDRITTLGRNGSDYSGAIFAALFDAHELH
1050 :     IWTDVDGVLSADPRVVPEAVQLETLSYDEACELAYFGAKVVHPQTMSPAIERGLPIIIRN
1051 :     TFQPEHPGTRITASSAVSGPIKGLTLSPDLAVLNLEGTGLIGVPGTAERVFAALRTAQVS
1052 :     VVMISQGSSEHSICCVVKQHESERARNALLQAFAHEITVGQVQRVQLTTGISVLAAVGDG
1053 :     MAGQPGVAARLFESLGRAQVNILAIAQGSSERNISVAIDAAHATKALRAAHAGFWLSPQT
1054 :     FSVGVI
1055 :     >Xory_Aa_|_CG-07
1056 :     MRTGPPQRGLSMSLPAVSFEPAAVVASSARTVVHKFGGTSVADADRYRHVAQLLLARDET
1057 :     VQVTVVSAMKGVTDALIELAELAAKDRPEWRDRWHETRARHRGAAVALLGEHSGPTVEWL
1058 :     DERFEHLSQILGALAVIGELPREVLDRVQGLGEVYSAQLLGDHFRAIGEDCAVLDARDVL
1059 :     VVNRGELGVDVDWEVSAQQLATWRQAHPQTRVVVTGFVARDRADRITTLGRNGSDYSGAI
1060 :     FAALFDADELHIWTDVDGVLSADPRVVPEAVQLETLSYDEACELAYFGAKVVHPQTMSPA
1061 :     IERGLPIIIRNTFQPEHPGTRITASSAVRGPIKGLTLSPDLAVLNLEGTGLIGVPGTAER
1062 :     VFASLRTAQVSVVMISQGSSEHSICCVVKQHESERARNALLQAFAHELTVGQVQRVQLTT
1063 :     GISVLAAVGDGMAGQPGVAARLFESLGRAHVNILAIAQGSSERNISVAIDAAHATKALRA
1064 :     AHAGFWLSPQTFSVGVI
1065 :     >Xfas_Aa_|_CG-07
1066 :     MSTVETPVYVPRTVVHKFGGTSVADADCYRHVTRLLLAREETVQVTIVSAMKGVTDTLIA
1067 :     LAEQAANHSPDWQVLWQQTRTRHCDAAQALLGEHAATLQDWLNTRFNELHEMLVALSVIG
1068 :     MLPSEVLDRLQGLGEVYSAQLLGHYLQSQGEDCVVLDARQVLVVSPGEFGAEVDWATSAQ
1069 :     HLAHWRMQHPQRRVVVTGFVASDRTGRAITLGRNGSDYSGAIFAALFEADELHIWTDVDG
1070 :     VMSADPRVVPDAVQLDALSYDEACELAYFGAKVVHPQTMSPVMKRGVPIIIRNTFQPGHP
1071 :     GTRITADSVVSGSVKGLTLSPGLAVLNLEGTGLIGVPGTAERVFAALRNARLSVVMISQG
1072 :     SSEHSICCLVHQTEAERARDALLYAFAHELAIGHVQRVQLTNNISVLAAVGDGMAGHLGV
1073 :     AARLFESLRRAHVNILAIAQGSSERNISVAIDSQQATKALRAAHAAFWLSPQTFSIGVI
1074 :     >Atha_d_|_CG-07
1075 :     MATLKPSFTVSPPNSNPIRFGSFPPQCFLRVPKPRRLILPRFRKTTGGGGGLIRCELPDF
1076 :     HLSATATTVSGVSTVNLVDQVQIPKGEMWSVHKFGGTCVGNSQRIRNVAEVIINDNSERK
1077 :     LVVVSAMSKVTDMMYDLIRKAQSRDDSYLSALEAVLEKHRLTARDLLDGDDLASFLSHLH
1078 :     NDISNLKAMLRAIYIAGHASESFSDFVAGHGELWSAQMLSYVVRKTGLECKWMDTRDVLI
1079 :     VNPTSSNQVDPDFGESEKRLDKWFSLNPSKIIIATGFIASTPQNIPTTLKRDGSDFSAAI
1080 :     MGALLRARQVTIWTDVDGVYSADPRKVNEAVILQTLSYQEAWEMSYFGANVLHPRTIIPV
1081 :     MRYNIPIVIRNIFNLSAPGTIICQPPEDDYDLKLTTPVKGFATIDNLALINVEGTGMAGV
1082 :     PGTASDIFGCVKDVGANVIMISQASSEHSVCFAVPEKEVNAVSEALRSRFSEALQAGRLS
1083 :     QIEVIPNCSILAAVGQKMASTPGVSCTLFSALAKANINVRAISQGCSEYNVTVVIKREDS
1084 :     VKALRAVHSRFFLSRTTLAMGIV
1085 :     >Atha_e_|_CG-07
1086 :     MPVVSLAKVVTSPAVAGDLAVRVPFIYGKRLVSNRVSFGKLRRRSCIGQCVRSELQSPRV
1087 :     LGSVTDLALDNSVENGHLPKGDSWAVHKFGGTCVGNSERIKDVAAVVVKDDSERKLVVVS
1088 :     AMSKVTDMMYDLIHRAESRDDSYLSALSGVLEKHRATAVDLLDGDELSSFLARLNDDINN
1089 :     LKAMLRAIYIAGHATESFSDFVVGHGELWSAQMLAAVVRKSGLDCTWMDARDVLVVIPTS
1090 :     SNQVDPDFVESEKRLEKWFTQNSAKIIIATGFIASTPQNIPTTLKRDGSDFSAAIMSALF
1091 :     RSHQLTIWTDVDGVYSADPRKVSEAVVLKTLSYQEAWEMSYFGANVLHPRTIIPVMKYDI
1092 :     PIVIRNIFNLSAPGTMICRQIDDEDGFKLDAPVKGFATIDNLALVNVEGTGMAGVPGTAS
1093 :     AIFSAVKEVGANVIMISQASSEHSVCFAVPEKEVKAVSEALNSRFRQALAGGRLSQIEII
1094 :     PNCSILAAVGQKMASTPGVSATFFNALAKANINIRAIAQGCSEFNITVVVKREDCIRALR
1095 :     AVHSRFYLSRTTLAVGII
1096 :     >Ahyd_Ad_|_CG-08
1097 :     MEQQQQGEIAVATEAGLKRRHVHKFGGSSLADPVCYRRVASILEQQAEQQGGGRELVVVS
1098 :     AAGKTTNRLIQLVELAEAGDEAAGEAISALQAYQQSLIDGLLEGELHLELSQQLADDMQL
1099 :     IAKTLEGQFDRFERNGLLAFGEVWSARLLAALLTSRGDKAIWLDARSFLRAEDGALVKVD
1100 :     TALSSELLKARLAEHAGRIVVTGFIAADMEGRSLLLGRNGSDYSASLLALLADGESTTIW
1101 :     SDVAGVYSADPRRVKEARLLERLSLAEANELARLGSSVLHSRTLQPVADSRQRLTLRCSY
1102 :     NPDEGCTHILRRAPRSGGARIVSSVDQIALIELKVLPQTHYEQTVAAIEAHLARHRLNPL
1103 :     TLQRQPDRRILRLAYTLEVAQGAFELLRDFQLQGSFTGLIQREGYSLVALVGAGVTDNAE
1104 :     QCHRFYQLLADQPLEFVQVAKDGLSLVAVLRQVVLEPLLIALHSALFSRPNRVGLVVF
1105 :     >Asal_Ac_|_CG-08
1106 :     MKRRQVHKFGGSSLADPVCYRRVAAIVEQQVGGDELVVVSAAGKTTNRLIQLVELADAGD
1107 :     EAAGEAISALQAYKQSLIDGLLEGELQLDLSQQLADDMQLIAKTLEGQFDRFARNGLLAF
1108 :     GEVWSARLLAALLSSRGEKAIWLDARSFLRAEDGALVKVDTALSSELLKARLAEHAGRIV
1109 :     VTGFIAADMEGRSLLFGRNGSDYSASLLAALADGESTTIWSDVAGVYSADPRRVKEARLL
1110 :     ERLSLAEANELARLGSSVLHSRTLQPVADSRQRLTLRCSYNPDEGCTHILRRAPRSGGAR
1111 :     IVSSVDQIALIELKVLPQTHYEQTVAAIEAHLARHRLNPLTLQRQPDRRVLRLAYTLEVA
1112 :     EGAFEILRDFQLQGSFTGLIQKEGFSLVALVGAGVTDNAEQCHRFYQLLADQPLEFVQVA
1113 :     RDGLSLVAVLRQVVLEPLLIALHSALFSRPTRVGLVVF
1114 :     >Cpsy_Ac_|_CG-08
1115 :     MSSNEIADIDFIAEVAAENKLAKHAIQVHKFGGSSLATPKCIKRALEIIRENCQLNDIVV
1116 :     VSANGKTTDRLFALYSLVERTIAEDTIQKSDELTQAIDELAKEQAQLITELLNANNTKQL
1117 :     LLRLHKDIEQLTTWLTADIVQHHNDVLALGEVWSARLLSALLNEQVCPSNSIDSRDFLVI
1118 :     DNEQSCVVDTALSAAQLRQRRQFGKLAVITGYISKDSRGKSCTLGRNGSDYSATIIASLV
1119 :     AAGNVTLWTDVDGIYSADPRVVPSARKLHRLPNGVAKELGRLGNPVLHAKTLLPLINPLS
1120 :     EHHTHLHVASSFDAQVIGTEIGKFGQIAKQELSVTYLNDLLLAQSVSFIGEAATRAKAEF
1121 :     SPICIDDQKGFMVITQGQQKALSDWLASHDVEITFKPVAIIATVGHRVAERGDIRARFKR
1122 :     SLKAAKPLNLVGSDNNHSVIAILPEPCSIELLNTVHHEMTKDARHIGLVVA
1123 :     >Iloi_Ab_|_CG-08
1124 :     MTTTQLTEEQKQAVADSVQVHKFGGSSLADAFCYRRVARIVTEYAGASDLVVVSAAGDTT
1125 :     NRILAIINAKAQPGDTASILLDQLESFQQGLITELLSGNLQQQLLQQSQQDFARWRRWLA
1126 :     CDETISHNAELLSYGELWSARLLSALLQKQGTRADHIDARDFLLAADAPEPVIQVEHSRE
1127 :     KLLQRVAPHSGTRFIVTGFIARGLHGESLTLGRNGSDYSATLVGSLLDTRQVTIWKDVAG
1128 :     VYSADPRKVERVVSLPTLDWTEAEELARLGSPVLHPRTFQPVDRQRMVISVRSSLKVENQ
1129 :     QTRIGQFQNTQPRGKVFTSLSEVVLFKVELHDKALVKRLDELELEPLVSWTEPENHQQYL
1130 :     VFHQNHLDYLTGWLDSLGAGDAITQIRGYSMLAIVGNRIQETDQFSTFKLQLSEQKVRRF
1131 :     ALTQNGDSAVAILEQKLDNRLLNRLHSQLFNYRRSLGVLVI
1132 :     >Phal_Ac_|_CG-08
1133 :     MTNNIHKFGGSSLSSAERYKSVAKIIIGQAQPGDCVVVSAAGKTTDTLVKLWQSYQQHDT
1134 :     QALADIVLQLNNHQSDLITQLLQGDLKRSALTTLNEELSLVAKLASTEQLQEAALLAHGE
1135 :     LWSARLLAAYLQQLNVAACMQDARGLFTLSDGQLLHSQNTQQCSELISQHKINVVTGFIA
1136 :     ANTQGDTVTLGRNGSDYSATLLASYCNAKQVYIWTDTQGIFSTDPRKVNKAIKYAKVCRA
1137 :     QANLLARLGNPVLHAKTLSPLKNTDIKLAVRSSFDVQASSTNVVKEGCVKQKRFITTLEN
1138 :     IDLLSVEGLVEGEVTQVSQLIQHSLHHFSSAGETYLIVPAVATHQVVSYFAGRANISESN
1139 :     LHGCALVAPEQDINSLSTQARELLNLHNIEPRFVHQDSGYVLLLTDQLIDSDVLNVLHDK
1140 :     LITKGQEIALIVA
1141 :     >Sama_Ac_|_CG-08
1142 :     MARCHLHKFGGSSLADADCYRRVAHILLTQGHSDDLVVVSAAGKTTNFLYKLLSLRDAGE
1143 :     LWQEELQVLISYQQNLIEQLLSAEQARYLRERLSTDKAQLVSLLSLATLNDYQTSHVVSF
1144 :     GERWSARLMAALLRESGVAASHVDACSILVADEGAVPNIREQESREKVAAMLAEHENERI
1145 :     VITGFICANPAGETLLLGRNGSDFSATLIASLADIERVTIWTDVEGVFNADPNKINDAKL
1146 :     LKSMSLAEADRLARLGSPVLHSRTLQPLFNTQVSMAVRSSYAPHTDFTLVAPTSSQASAP
1147 :     VVTNLSEVALFSLTTQADTDALLATLSASGLTPLASWQGSRGGLELAYTPENLKQVSAFL
1148 :     KANAEAYGLGDVSISNDFGLVALVSADAVLYRKSFARLLSREAKPLYHDTLSLVTLVPKA
1149 :     QVNLLTQKVHRRCAGPRKRIGVILL
1150 :     >Sbal_Ac_|_CG-08
1151 :     MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLALRDVGQ
1152 :     LWQEELQVLTSYQQGLVEQLLSNEQARDLRERLATDQAQLISLLSLDERNEYQVNHVVSF
1153 :     GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
1154 :     VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
1155 :     LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
1156 :     VVTNLNAVVLFGFKLTGELTSLLDSLIAAGLTPLAHWTSAHQRVELAYTAENQKQVQRLL
1157 :     DAEAQVLGISDQQINTDLGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
1158 :     QVNLLTQKVHRRCAGPRKRIGVLLL
1159 :     >Sden_Ac_|_CG-08
1160 :     MARSHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLDLRDTGQ
1161 :     LWQEELQVLISFQQALIEQLLSNEQARDLRERLSNDKAQLASLLSLEQRNEYQISHVVSF
1162 :     GERWSARLMAALLRESGVAASHVDACSILVADEGAVPKIRVEESKAKIQTLLAERTNERL
1163 :     VITGFICANAQGDTLLLGRNGSDFSATLIASLADIGRVTIWTDVEGIFNADPNKINDAKL
1164 :     LKSMSLAEADRLARLGSPALHSRTLQPLFNTQVSLAVRSSYASHTDFTLIAPQSSSASAP
1165 :     VVTSLSQVVLFSFKLETHNKIESDSQSKPQPQSQFESVLAALTSAGLTPLAHWEYGADKH
1166 :     ELAFMLENQKQVNALLSKQAPTFGITELQLNLDLGLVALVSADAEHFRRSFARLLSRDAK
1167 :     PIYQDNLSLVTLVPRAQVNLLTQKVHRRCAGPKMRIGVLLL
1168 :     >Sfri_Aa_|_CG-08
1169 :     MTRSHLHKFGGSSLADADCYRRVAHILLTHGQSDDLVVVSAAGKTTNFLYKLLSLRDSGQ
1170 :     LWQEELQILISYQQTLIEQLLSNEQARDLRERLSTDKSQLVSLLSLEQRNDYQLNQVVSF
1171 :     GERWSARLMAALLREMGVAATHVDACSILVADEGAVPNILVAESRDKVQALLALHPQERL
1172 :     VITGFICANRHGDTLLLGRNGSDFSATLIASLADIDRVTIWTDVEGVFNADPNKINDAKL
1173 :     LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPLSSSASAP
1174 :     VVTNLNEVVLFSFKMNADIEPLLAILDKAGITPLAYWSLAQHKFELALTLESQKQVQALL
1175 :     NQYSSEFLIEELSAQTDLGLVALVSADAHHFRRSFARLLSRDAKPIYQDALSLVTLVPQA
1176 :     QVSLLTQKVHRRCAGPRMRIGVLLL
1177 :     >Sloi_Ab_|_CG-08
1178 :     MTRCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLIVVSAAGKSTNFLYRLLELCDTDQ
1179 :     LWQEELQVLVSYQQNLIEQLLSNEQARSLRERLATDKSQLTSLLSLDELNDYQRNQVVSF
1180 :     GERWSSCLLAALLRESGVAATDVDARTLLVADEGAVPQIRLGESRQKVQALLEAHPQERL
1181 :     VITGFICANEQGDTLLLGRNGSDFSATLLASLADIERVTIWTDVEGVFNADPNRINDAKL
1182 :     LKSMSLTEANRLAHLGSPVLHNRTLQPLFDTEVSLAVRSSYAPHTDFTLIAPKSSSASAP
1183 :     VVTSLSSVSLFSLTISVELPQLLACFAQAGLTPLAYWSLAHGRAELAFTHENQKQAQAIF
1184 :     EAKRSELGIDELQLRDDLGLVALVSADASLYRRGFSRLLSREAHPLCNDGLSLVTLVPKA
1185 :     QVNLLTQKVHRRCAGPRKRIGVLLL
1186 :     >Sone_Ac_|_CG-08
1187 :     MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKTTNFLYKLLSLRDSNQ
1188 :     LWQEELQVLISYQQGLIEQLLSNEQARDLRERLTTDKAQLISLLSLDVRNDYQISHVVSF
1189 :     GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
1190 :     VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
1191 :     LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
1192 :     VVTNLNAVVLFGFKIAGDVASLLDQLVEAGLTPLAHWVSAHQRLELAYTAENQKQVQKLL
1193 :     DAQAEALGIRDLQINTELGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
1194 :     QVNLLTQKVHRRCAGPRKRIGVLLL
1195 :     >Sput_Ac_|_CG-08
1196 :     MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLSLRDAAQ
1197 :     LWQEELQVLISYQQGLIEQLLSHEQARDLRERLATDKAQLISLLSLDVRNDYQINHVVSF
1198 :     GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
1199 :     VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
1200 :     LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
1201 :     VVTNLNAVVLFGFKLTGELTRLLDLLIAAGLTPLAHWTSAHQRVELAYTAENQKQVQRLL
1202 :     DAEAEALGISDQQINTDYGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
1203 :     QVNLLTQKVHRRCAGPRKRIGILLL
1204 :     >SHEW-3c_|_CG-08
1205 :     MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKTTNFLYKLLSLRDSNQ
1206 :     LWQEELQVLISYQQGLIEQLLSNEQARDLRERLTTDKAQLISLLSLDSRNDYQISHVVSF
1207 :     GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRTKVQTLLAAHPNERL
1208 :     VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
1209 :     LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
1210 :     VVTNLNAVVLFGFKIAGDVASLLEQLVEAGLTPLAHWLSAHQRLELAYTAENQKQVQKLL
1211 :     DAQAEALGIKDLQINTELGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
1212 :     QVNLLTQKVHRRCAGPRKRIGVLLL
1213 :     >ENTE-2b_|_CG-08
1214 :     MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSMPGDMMVVSAAGSTTNQLISW
1215 :     LKLSQTDRLSAHQVQQTLRRYQSDLISGLLPAQAADGLISAFVHDLERLAALLDSGITEA
1216 :     VYAEVVGHGEVWSARLMAAVLEQQGLEAAWLDARDFLRAERAAQPQVDEGLSYPLLQQLL
1217 :     VQHPGKRIVVTGFISRSNAGETVLLGRNGSDYSATQIGALAGASRVTIWSDVAGVYSADP
1218 :     RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
1219 :     VLASGTGARIVTSHDDICLIEFQVPAGQDVKLAHKDIDLILKRAQVRPLAVGVHSDRHLL
1220 :     QFCYTAEVADSALKTLDEAGLPGELRLRQGLALVAMVGAGVSRNPLHCHRFWQQLKGQPV
1221 :     EFTWQSEEGISLVAVLRKGPTESLIQGLHTTLFRAEKRIGLVLF
1222 :     >Patr_Ab_|_CG-08
1223 :     MSALGVAPSVTGRQLHKFGGSSLADVKCYLRVAGIMAEYSHPGDLMVVSAAGSTTNQLIS
1224 :     WLKLSQSDRLSAHQVQQALRRYQSELIAGLLPAQDAEALTAQFIRDLERLAALLDGKITD
1225 :     AVYAEVVGHGEIWSARLMCAVLNHRDMNAAWLDARDFLCAERAAQPQVDEGRSWPLLQQY
1226 :     LTQHSGQRLVVTGFICRNDAGETVLLGRNGSDYSATQIGALAGVERVTIWSDVAGVYSAD
1227 :     PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
1228 :     RVLASGTGAKIVTSHDDVCLIEVQVPSEHDFVLLQKEVEQILNRAQLKPLAIGVHQDRSL
1229 :     LQLCYTSEVVESALQLLTQAALPVELSERDGLAMVAMVGAGVGKNPLHSHRFYQQLKDQP
1230 :     IEFVRQADDGISLVAVLRVGPTEHLIRGLHHSLFRAEKRIGLVLF
1231 :     >Ecol_Ab_|_CG-08
1232 :     MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
1233 :     LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
1234 :     VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
1235 :     VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
1236 :     RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
1237 :     VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
1238 :     QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
1239 :     EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
1240 :     >Plum_Ab_|_CG-08
1241 :     MGALVVATAENDRQLHKFGGSSLADVKCYQRVAKIMANYSQPGDLMVVSAAGSTTNQLIN
1242 :     WLKLSQSDRISAHQVQQVLRRYQQDLIRGLLPETVAEELVKRFIADLEKLSALLDKPVSD
1243 :     VTYAEVVGHGEIWSARLMSAVLEAQGIPSAWVDARQFLRAERAAQPQIDVTLSQPLLNQL
1244 :     LTQNLNKRLVVTGFISSNHDGETVLLGRNGSDYSATQVGALAGARRVTIWSDVAGVYSAD
1245 :     PRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSFSDIDLLLRCSYQPEQGSTRIE
1246 :     RVLASGTGAKIVTSHDDVCLIELHVAAHHNFKQTYKDIDLLLKREQIRPLATGIHLDCNL
1247 :     IQLCYTSEVVNSALSVLEDATLPGKLSLREGLALVALVGAGVCKNPLHCHRFYQQLKDQP
1248 :     VEFIWHAEDGISLVAVLRTNQTEHVIQGLHQSLFRAEKRIGLILF
1249 :     >Sent_Nb_|_CG-08
1250 :     MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLISW
1251 :     LKLSQTDRLSAHQVLQTLRRYQCDLISGLLPADAADDLTSAFISDLERLAALLDGGVTDA
1252 :     VYAEIVGHGEIWSARLMSAVLNQQGLDAAWLDARAFLRAERAAQPQVDEGLSYPLLQQLL
1253 :     AQHPGKRLVVTGFISRNHDGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
1254 :     RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
1255 :     VLASGTGARIVTSHDDICLIEFQVPASQDFRLAHKELDQILKRAQARPLAVGVHRDRQLL
1256 :     QFCYTAEVADSVLKLLDDVGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
1257 :     EFTWQSEEGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLMLF
1258 :     >Styp_Ab_|_CG-08
1259 :     MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLISW
1260 :     LKLSQTDRLSAHQVLQTLRRYQCDLISGLLPADAADDLTSAFISDLERLAALLDGGVTDA
1261 :     VYAEIVGHGEIWSARLMSAVLNQQGLDAAWLDARAFLRAERAAQPQVDEGLSYPLLQQLL
1262 :     AQHPGKRLVVTGFISRNHDGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
1263 :     RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
1264 :     VLASGTGARIVTSHDDICLIEFQVPASQDFRLAHKELDHILKRAQVRPLAVGVHRDRQLL
1265 :     QFCYTAEVADSVLKLLDDVGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
1266 :     EFTWQSEEGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLMLF
1267 :     >Sdys_Ab_|_CG-08
1268 :     MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
1269 :     LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
1270 :     VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRSERAAQPQVDEGLSYPLLQQLL
1271 :     VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
1272 :     RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
1273 :     VLASGTGARIVTSHDDVCLIEFQVPTSQDFKLAHKEIDQILQRAQVRPLAVGVHNDRQLL
1274 :     QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
1275 :     EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
1276 :     >Sfle_Ab_|_CG-08
1277 :     MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEFSQPDDMMVVSAAGSTTNQLINW
1278 :     LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
1279 :     VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
1280 :     VQHPSKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
1281 :     RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
1282 :     VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
1283 :     QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
1284 :     EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
1285 :     >Sson_Ab_|_CG-08
1286 :     MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
1287 :     LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
1288 :     VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
1289 :     VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
1290 :     RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
1291 :     VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
1292 :     QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
1293 :     EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
1294 :     >Yent_Ab_|_CG-08
1295 :     MNATAVAAAVTGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
1296 :     WLKLSQTDRLSAHQVQQNLRRYQHDLISGLLSPEMAEPLISEFIHDLERLAGLLDNKVDD
1297 :     AIYAEVVGHGEIWSARLMSAVLNKLDMAADWLDARSFLRAERAAQPQIDEGRSYPLLQQL
1298 :     MAQHPHQRLVVTGFISRNNAGETVLLGRNGSDYSATLVGALAGVERVTIWSDVAGVYSAD
1299 :     PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
1300 :     RVLASGSGAKIVTSHDDVCLIELQIAGHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
1301 :     LQLCYTSEVVNSALRVLEDATLPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
1302 :     VEFIWQAEDGISLVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
1303 :     >Ypes_Ac_|_CG-08
1304 :     MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
1305 :     WLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFIHDLERLAGLLDNKIDD
1306 :     VIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERAAQPQIDESRSYPLLQQL
1307 :     MAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALAGAERVTIWSDVAGVYSAD
1308 :     PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
1309 :     RVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
1310 :     LQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
1311 :     VEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
1312 :     >Ypse_Ac_|_CG-08
1313 :     MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
1314 :     WLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFIHDLERLAGLLDNKIDD
1315 :     VIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERAAQPQIDESRSYPLLQQL
1316 :     MAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALAGAERVTIWSDVAGVYSAD
1317 :     PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
1318 :     RVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
1319 :     LQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
1320 :     VEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
1321 :     >Ppro_Be_|_CG-08
1322 :     MKRQLHKFGGSSLADPECYRRVTDILREYSHPNDLIVVSAAGKTTNCLIEWVERLNKDGR
1323 :     QAHETLQEIRQFQQHLIEASVNGEQADRLLSQLHAELSELAKLSGLEITEAVRSSILGHG
1324 :     EIWSARLLAALLNRNNMPAVSLDSRDFLRAERAVQPEVDRTLSRPLLQQQLVQHNKCRIV
1325 :     ITGFMARNQASETVLLGRNGSDYSATVIGALADVSRVTIWSDVAGVYSADPRKVADACLL
1326 :     PLLRLDEADELARLAAPVLHSRTLQPVAQSTIDLTLRCSHQPESGSTRVERVLASGRGAK
1327 :     IVTSLDEVCLIELDVPRSHDFDAIKTDIERTLQRAQLLPLAQSAEVELGRILLAYTSEMV
1328 :     NCVLELLQNRGVAAELRLREGFSMVAAVGAGVVNNPVHCHGFYQQLKGLPVEFMTEAESG
1329 :     LSLIAVLRKVDTEGLVARIHQSLFQAQKRVGIVLC
1330 :     >Vcho_Fc_|_CG-08
1331 :     MTHPRQLHKFGGSSLADPECYQRVAKILKSYSKSDDLVVVSAAGKTTNRLISFVEALSKD
1332 :     GRVAHETLHALRQYQSELITKLLSNEAAEPLLSQLQQEISVLGELTAPLSNAQYAWVLGH
1333 :     GELWSARLLAALLNQQDLPAVAQDARTFLRAEAGTQPEVDRARSYPLLKAVLAQHTQRRV
1334 :     VITGFMAQNEQGDTVLLGRNGSDYSATVIGALAEVSRVTIWSDVAGVYSADPRIVSDACL
1335 :     LPLLRLDEANELARLAAPVLHSRTLQPVAQSTMELHLRCSHQPESGSTRIERVLASGRGA
1336 :     KIITSLDDVLLIELSFAHHHDFQRVQEDVLQHLQRVQLQPLTYEAQPDQYRLRLAYTAEI
1337 :     APGAFAALQDAAFEAEIKLKEGYDLIAAVGAGVTKNPNHCYGFYQQLNALPVEFISASES
1338 :     SLSLVAVLRQTPIHSLVNAIHKQLFQAQKHVAIALC
1339 :     >Vfis_Ad_|_CG-08
1340 :     MTIPCSRQLHKFGGSSLADPECYRRVATILKEYSNEHDLIVVSAAGNTTNRILEWIDDLS
1341 :     KDGRLAHETLESLRTYQQGLITELLSAENAEPLLTVLYQELIAIGQLHAPLTEVQQADVL
1342 :     GHGEVWSSRLLSAYLNQIDLQAAPLDSRTFLRAERAAQPEVDRVQSWPLFKEQVAQHPHG
1343 :     RIVITGFMARNQRGETVLLGRNGSDYSATMIGVLGEVSCVTIWSDVAGVFSADPRKVEDA
1344 :     CLLPLLRLDEASELARLAAPVLHSRTLQPVAQSALDLSLRCSYQPESGSTRIERVLASGR
1345 :     GAKIVTSLEDVYLIQLGFGRGQYFERAQQEVLSLLTRSQLQPLALEPQADQFTLLLAYTS
1346 :     EVVNEALEVLQNSAVHAEIKLKEGYSMVAAVGAGVTANAIHSHGFYHQLKNCPLEFVYAS
1347 :     ESGLSLVAILRKVDTSSIINAIHNSLFQAQKRVGLILC
1348 :     >Vpar_Ad_|_CG-08
1349 :     MSVQRQLHKFGGSSLANPECYLRVADILKEYSAENDLVVVSAAGKTTNRLIEFLEGLDKD
1350 :     GRIAHEALQGLRQFQSELIESLLEGEVQTQLLASLHDEFSTLAELTAPLTDAQKAAVLGH
1351 :     GEVWSSRLLAALLSQQNVPAVAQDARAFLRAEAGTQPEVDRARSYPLIKEALAQHSHKRV
1352 :     IITGFMAQNEAGETVLLGRNGSDYSATVIGALAEVTTVTIWSDVAGVYSADPRLVSDACL
1353 :     LPLLRLDEASELARLAAPVLHSRTLQPVAQSTMDLSLKCSYQPESGSTRIERVLASGRGA
1354 :     KIITSLDEVLLIQLSFRHGHDFNKTQSDVLKSLQRAQLEPLSYEVQADQQKLRLAYTAEI
1355 :     ATGALKYLQDLAVEAEIKLKEGYSLVAAVGAGVTKNANHCFGFYQKLKHAPVEFVSETES
1356 :     GLSLVAVLRRTDTEALVQLIHSQLFQAQKRVAVTLC
1357 :     >Vvul_Aa_|_CG-08
1358 :     MSQVRQLHKFGGSSLADPDCYRRVVNILKEYSGDNDLVVVSAAGKTTNRLIEFSEALEKD
1359 :     GRLAHEALQALRQYQTGLVEALIASNQRSELLDQLADEFSTLAEFSAPLTTAQKAAILGH
1360 :     GEVWSSRLLASLLNQHDLAAVAQDARAFLRAETGTQPEVDRARSYPLIKEVLAQHSHRRV
1361 :     VITGFMAQNQAGETVLLGRNGSDYSATVIGALAEVAKVTIWSDVAGVYSADPRLVSDACL
1362 :     LPLLRLDEASELARLAAPVLHSRTLQPVAQSATELNLRCSYTPESGSTRIERVLASGRGA
1363 :     KIITSLDDVMLVQLNFSAGHDFERQQQEVLRALKRAQLEPLAFEAQKDQFKLRLAYTTEI
1364 :     AGGALAHLQELGLAAEIKLKEGFSLVAAVGAGVTNNASHCFGFYQQLKHSPVEFISEAES
1365 :     GLSLVAVMRRVDLPVLVKAIHTQLFQAQKRVALALC
1366 :     >Srub_Ad_|_CG-09
1367 :     MMPASGRPWVVCKFGGTSVSSRARWDTIVEVVRTHRAEGRAPFLVCSALQGISDQLEALC
1368 :     AQLASAEPGAPESTLNTIRERHRALGQDLGVEAEAVLSGEFARLERWVDEIQATDGPSPR
1369 :     QRAAVLATGELLSTRLGAAYLSAQGLPAEWLDAREFLRATDDPHLPPRRQYLAANCTSHA
1370 :     DPGLQARLADAPETVYLTQGFIASNALDETVLLGRGGSDTSAAHFAAKLEAERTEVWTDV
1371 :     PGLFTANPGEVPSGRLLRRLDYDEAQELATMGARVLHPRCLDPARRHQIPLHVRSTEAPS
1372 :     LDGTIVSGEGPDVGPQVKAISAKTDITAVSMDTLGMWQEVGFLADVFQVFKHHGLSVDLM
1373 :     ATSESNVTVTLDPVANALDPDILDRLLHDLNRYCDAELIDPCAIVSLVGRHIRSLLSELG
1374 :     PAFEVFDEQKVHLVTQAASDLNMSFVVDEDQASRLVRELHAQFFGHRAPDAVFGPRWQEL
1375 :     VEDGTPEETPDVWWRER
1376 :     >Mmar_Ab_|_CG-09
1377 :     MEHAQNWVVLKFGGTSVKSLADWRVISKRIEAVRAEGKRVFVVHSAIATISNLLDTLVAR
1378 :     AVEGGGEAELDAIKARHLTLADELGVDGNNLLADHFDALTRLRAGLALTGDASPRLKARI
1379 :     MAQGELMATRLGQAWLAKGGTDSIWLDARDHLAALPAAGARGYLAVDCEHDRDDGLLGQC
1380 :     AALPPVIVTQGFIARREDGDTALLGRGGSDTSASYFAAKLGAERIEIWTDVPGFFSADPR
1381 :     LTGAARQIRSLAYAEAQELASMGAGVLHPRAISPVRKAGIEMQVLCTHRPDMSGTTISVN
1382 :     PSEDAPRLKAVSVKQGVRLITLETDGMWRASGFLSKAFEPFARHGVSIDLVSTSETSVTV
1383 :     SLDDDPGLTPDVLGALEDDLAQIARVEIIENCAAVSLVGRGVRALLAQFGPAMEAFAHYP
1384 :     VRLVSQAANDLNLTVVVDGDQGKPLCRRLHDQLIQPKPMDRTFGPSWREIGENLTETAPA
1385 :     GTGTWWRAKRQALLDLCPVDGATYVY
1386 :     >Lpne_Aa_|_CG-09
1387 :     MSGILIMQQVVIKFGGTSVSTRATWNNIAAITQKHLNTGVQPVIVCSALTQISNKLEKAI
1388 :     EAALLDEHHSLFNDIQSSHLNLAEQLEVNHQLIANDLHQLQQWLTGISLLKQAPAKTHAQ
1389 :     ILSLGELMMTRLGHAFLEKQGIKVKWYDARELLTSTPTLGGETMNYLSARCESEYDSALV
1390 :     EKFLSSGAQAIITQGFFAANPHGETVLLGRGGSDTSAALLAGKLQAASCEIWTDVPGIYT
1391 :     ANPHQLPHARLLKQLNYDEAQEIASMGAKVLHPNCIPPVRKANIPMVVKYTHLPEHSGTL
1392 :     ITKDIDESAPLIKSIQVKHSILLISIDTLNMWQQVGFLADVFAAFKKHGFSVDLLSSSEF
1393 :     NVTLSLDVNAKIHDRPAINALLDDLNQFGRAKLIEPCSAVSLVGHHIRTVLPHLGPALEV
1394 :     FEAKQVYLMSLASNDLNLTFVVDESHADKLCQRLHHLLIESNPQIFYYSKSWHEEFGKPN
1395 :     VRPTPWWEIERDRLLTTSAIHSPCYVY
1396 :     >Xaxo_Aa_|_CG-09
1397 :     MSAPHSTDRWIVLKFGGTSVSRRHRWDTIGKLASKRANETGGRVLVVVSALSGVTNELTA
1398 :     IADGAADSAQRVAALDQRHREFLAELELDADAVLGERLAALHALLGDARAATRTLDWQAE
1399 :     VLGQGELLSSTIGAAYLHASGLDMGWLDARQWLSALPPQPNQSEWSKRLSVSCQWQSDAD
1400 :     WRTRFAAQPTRLLITQGFISRHADGGTAILGRGGSDTSAAYFGALLGASRVEIWTDVPGM
1401 :     FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDSGVPMAILDTERPDLPG
1402 :     TSIDGNAELVLGVKAISRRNGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
1403 :     TNVTVSLDPSENLVNTDVLAALSADLSQICKVKIIVPCAAITLVGRGMRSLLHKLSDVWA
1404 :     TFGQERVHMISQSSNDLNLTFVIDEADADGLLPILHAELIDSGAMPVSEGEVFGPRWRQI
1405 :     IGSVRPRPTPWWHAERAHLLSLSRAGTPRYAY
1406 :     >Xcam_Aa_|_CG-09
1407 :     MSASLSTDRWIVLKFGGTSVSRRHRWDTIGKLASKRANETGGRVLVVVSALSGVTNELTA
1408 :     IADGAADSAQRVAALELRHREFLAELELDADAVLGARLAALHALVGDARAASRTLDWQAE
1409 :     VLGQGELLSSTIGAAYLHANGLDMGWLDAREWLSALPPQPNQSEWSKRLSVSCQWQSDAA
1410 :     WRARFDAQPTRLLITQGFISRHADGGTAILGRGGSDTSAAYFGALLGASRVEIWTDVPGM
1411 :     FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDSGVPMAILDTERPDLPG
1412 :     TSIDGSAEPVLGVKAISRRNGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
1413 :     TNVTVSLDPSENLVNTDVLAALSADLSQICKVKIIVPCAAITLVGRGMRSLLHKLSDVWA
1414 :     TFGQERVHMISQSSNDLNLTFVIDESDADGLLPILHAELIDSGAMPVSEGEVFGPRWRDI
1415 :     IGSVRPRPTPWWHAERAHLLTLSKAGTPRYVY
1416 :     >Xory_Ab_|_CG-09
1417 :     MSAPHSTDRWIVLKFGGTSVSRRHRWDTIGQLASKRASETGGRVLVVVSALSGVTNALTA
1418 :     IADGAADSAQRVAALDQRHREFLAELELDADAVLGERLAALHALLSDARAATRTLEWQAE
1419 :     VFGQGELLSSTIGAAYLHASGLDMGWLDARQWLSALPPQPNQSEWSKRLSVSCQWQSDAD
1420 :     WRARFAAQPTRLLITQGFIARHADGGTAILGRGGSDTSAAYFGALLGASRVEIWTDVPGM
1421 :     FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDSGVPMAILDTERPDLPG
1422 :     TSIDGNAEPVLGVKAISRRNGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
1423 :     TNVTVSLDPSENLVNTDVLAALSADLSQICKVKIIVPCAAITLVGRGMRSLLHKLSDVWA
1424 :     TFGKERVHMISQSSNDLNLTFVIDESDADGLLPILHAELIDSGAMPVSEGDVFGPRWREI
1425 :     TGSVRLRPTPWWHAERAHLLSLSKAGTPRYAY
1426 :     >Xfas_Ab_|_CG-09
1427 :     MSASPTAERWIVLKFGGTSVSRRHRWDTIAMVVRKRLEEHGTRVLIVVSALSGVTNELTA
1428 :     IAQGVVDSAKRVTALEQRHRDFLVELGLDAQAVLGTRFAMLSDLLQDARAVTRSLDWQAE
1429 :     LLGQGELLSSTLGAAYLGASGIDIGWMDARDWLTALPPQPNQSEWSQRLSVSCQWKSDVE
1430 :     WRTRFDAQRAQVLITQGFISRHQDGGTAILGRGGSDTSAAYFGALLGAACVEIWTDVPGM
1431 :     FSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPCRDTGVPMLILDTERPDVLG
1432 :     TRIDAEVEPVLGVKAISRRDGIVLVSMEGIGMWQQVGFLADVFTLFKKHGLSVDLIGSAE
1433 :     TNVTVSLDPSENLVNTDVLTALSTDLSQICKVKIIVPCAAITLVGRGMRSLLHKLSEVWA
1434 :     TFGKERVHMISQSSNDLNLTFVIDETDADGLLAVLHFKLIESGAMPVQDRAVFGSPWREI
1435 :     IGHVRTRVMPWWHSARMRLLAMRDEEGIGPCYVY
1436 :     >Oale_Ab_|_CG-09
1437 :     MTDQTPLANRVWTVLKFGGTSVAKPENWAVIAKLAKARLKQDKPGGKVLIVHSALSGVSN
1438 :     RLEALPDQALLGDVSSEIAAIKAVHLDFAEAALLDGSTLLVSHFETLDRLAAGIALVREA
1439 :     SPRVRAELLALGEQMASVLGMERLRQEGLSPVFLDARDALQAASNSEDAGGYLSNSVIEG
1440 :     ADARLQMRLKDAELVLTQGFIARNSRDETVLLGRGGSDTSAAYFANKLDAAKLEIWTDVP
1441 :     GLFSADPRLTEGARLLQALSYDEAQEIATMGGKVLHPRCIGPARRANVPVEVRSTLRPEL
1442 :     AGTLITAKPGDDAPQLKAVSVKSGVRIVAMEGAGMWRQAGFLADVFACFKECGVSVDLVS
1443 :     TSETNVTVSLDPDPSLDQARLDALRARLERFCRVKIMDDGAAVSLVGYGVRRILHKLAPA
1444 :     LEMFQDKPIRLVSQAANDLNFTVVVDASEGRALAARLHEELIAPA
1445 :     >Cchl_Aa_|_CG-10
1446 :     MAVMKFGGTSVGNARAMQQAIAIVANKEKSGAPLVVLSACSGITNKLIHIADAAGRSALA
1447 :     EAMVLAAEVRAFHLALAAELVTTPERLHTLTTSITELVDRLEMLIKGVDIVGELTERSKD
1448 :     MFCSFGELFSTTIFAAAMQERGHNAAWVDVRTVMITDDNFGFARPLDSVCEANALSIIRP
1449 :     LLEQGTTVVTQGYIGATRDGRTTTLGRGGSDFSAALLGAWLDDSVIEIWTDVDGVMTCDP
1450 :     RLVPDARSIRVMTFTEAAELAYLGAKVLHPDTIAPAVQKNIPVYVLNSIHPEAKGTLITN
1451 :     DSEHLSGMSYEGLVKSIAVKKNQCIINVRSNRMMGRHGFMSELFELFAHYGVSVEMISTS
1452 :     EVSVSLTVDDKCVTSELIQALGSLGDTEIEHNVATISVVGDNLRMSRGVAGRIFSSLKEV
1453 :     NLRMISQGASEINVGFVVDEAEVATAVNTLHKEFFSTPNDHAIFEKPAGSH
1454 :     >Cpha_Aa_|_CG-10
1455 :     MAVMKFGGTSVGTARAMQQAITIVATKKKERAPLVVLSACSGITNKLIRIADAAGLSRLD
1456 :     EAMAIAGEVRRHHLDLLDELVKSPAVKEELTVAVNLLVGELELLVKGVDIVGELTARSMD
1457 :     MFCSFGELLSTTVFAAAMKEQGHDALWVDVRKVMVTDDNFGFARPIQALCEANALSMIKP
1458 :     LLDAGTTVITQGYIGSSKAGKTTTLGRGGSDFSAALLGAWLDENAIEIWTDVDGVMTCDP
1459 :     RLVPEARSIRVMTFTEAAELAYLGAKVLHPDTIAPAVLKNIPVYVLNSLHPQAKGTLITD
1460 :     DPRMLSGMSYGGLVKSIAVKKGQCIINVRSNRMFGRHGFMNELFDVFSRYGVSVEMISTS
1461 :     EVSISVTVDDRSFNEELIRELKTFSDVEIEHNVATVSVVGDNLRMSRGVAGRIFSSLKDV
1462 :     NLRMISQGASEINVGFVVEEHDVAIAVNTLHREFFSGQETAGIFEIPAGSR
1463 :     >Ctep_Aa_|_CG-10
1464 :     MVVMKFGGTSVGSAAAMRQVIANVAEKKKSSAPLVVLSACSGITNKLIQIADAAGSGCLE
1465 :     EAQQLVGEVRQFHLDLIGELIESEELQQEVIAKIEVYLTRLERLTEGIEIVGELTERSKD
1466 :     RFCSFGELLSTSVFAAALNEAGVSCKWIDVRTVMITDDRFGFARPLAEICQKNTSEIIKP
1467 :     LLDAGTVVVTQGYIGATESGRTTTLGRGGSDLSAALFGAWLHSESIEIWTDVDGVMTTDP
1468 :     RIVPEAKSIRVMTFSEAAELAYLGAKVLHPDTIAPAVQKNIPVYVLNTWHPDSKGTLITN
1469 :     DPELLAGKSHGGLVKSIAVKKAQAILNIRSNRMFGRHGFMSELFDVFERFGISVEMISTS
1470 :     EVSVSLTVDDAVVSEPLIKALGALGEVEIEHKVATVSVVGDNLRMSKGVAGRIFNSLRNV
1471 :     NLRMISQGASEINVGVVVDESDVQAAVASLHCEFFAESQCDAIFEKPAGS
1472 :     >Plut_Aa_|_CG-10
1473 :     MAVMKFGGTSVGTARAMQQAISIVAREAELSTPLVVLSACSGITNTLLKIADASGRGSLD
1474 :     EAMALVGEVRSHHIGLVRELIPSAESQAVLIPRIEELLSRLELLVKGVEIVGELTERSRD
1475 :     MFCSFGELLSTTVFAAAMQAAGHRAEWVDVRTVMVTDDHFGFARPILKECMANTEQIIRP
1476 :     LQRAGTTVVTQGYIGRTEDGRTTTLGRGGSDLSAALLGAWLHESQIQIWTDVDGVMTCDP
1477 :     RIVPEARSIRVMTFSEAAELAYLGAKVLHPDTIAPAVEKNIPVFVLNTWHPDARGTVITN
1478 :     DPERLSGMSYGGLVKSIAVKKGQSIINVRSNRMLGRHGFMNELFNVFARYRVSVEMISTS
1479 :     EVSVSVTVEDAPFSQELLGELREFGQVDIEHGVATVSVVGDNLRMSKGVAGRIFGALAEV
1480 :     NLRMISQGASEINVGVVVGLHDVPVAVSALHREFFSGDDAAGIFEVPAGKA
1481 :     >Pvib_Aa_|_CG-10
1482 :     MAVMKFGGTSIGSAKAMRQAISIVARQEQESTPLVVLSACSGITNMLLRIADASGSGLLD
1483 :     DALALAGEVRAHHLGLVDELLTEEAAKAELVLRIEEILSRLELLVKGVEIVGELTERSRD
1484 :     MFCSFGELLSTTVFAAALQAAGHSARWVDIRTIMITDGNFGFARPIEAECRARATEVIAP
1485 :     LLAAGTTVVTQGYIGATADGRTTTLGRGGSDLSAALLGAWLHLSAIQIWTDVDGVMTCDP
1486 :     RVVPDARSIRVMTFSEAAELAYLGAKVLHPDTIAPAVEKNIPVFVLNTWHPDARGTVITN
1487 :     DPVRLSGMSYGGLVKSIAVKKGQGIINIRSNRMLGRHGFMNELFDVFARYAISVEMIATS
1488 :     EVSVSVTVDDACFTDMLLDDLREFGEVDVEHGVATVSVVGDNLRMSRGVAGRIFGALKEV
1489 :     NLRMISQGASEINVGFVVGEHDVVAAINALHSEFFSGEDAAGIFEVPAGKP
1490 :     >Bfra_Aa_|_CG-11
1491 :     MKVLKFGGTSVGSAQRMKEVAKLITDGERKIVVLSAMSGTTNTLVEISDYLYKKNPEGAN
1492 :     EIINKLEAKYKQHVDELYATEEYKQKGLEVIKSHFDYIRSYTKDLFTLFEEKVVLAQGEL
1493 :     ISTAMVNYYLQECGVKSVLLPALEYMRTDKNAEPDPVYIKDKLQAQLDLYPDAEIYITQG
1494 :     FICRNAYGEIDNLQRGGSDYTASLVGAAIHASEIQIWTDIDGMHNNDPRIVDKTAPVRQL
1495 :     HFEEAAELAYFGAKILHPTCIQPAKYANIPVRLLNTMDPHAPGTLISNDTEKGKIKAVAA
1496 :     KGNITAIKIKSSRMLLAHGFLRKVFEIFESYQTSIDMICTSEVGVSVSVDNTKHLNEILD
1497 :     DLKKYGTVTVDKDMCIICVVGDLEWENVGFEAKALDAMRDIPVRMISFGGSNYNISFLIR
1498 :     ECDKKVALQSLSDMLFNGK
1499 :     >Bthe_Aa_|_CG-11
1500 :     MKVLKFGGTSVGSAQRMKEVAKLITDGEQKIVVLSAMSGTTNTLVEISDYLYKKNPEGAN
1501 :     EIINKLESKYKQHVDELFATQEYKQKGLEVIKSHFDYIRSYTKDLFTLFEEKVVLAQGEL
1502 :     ISTAMVNFYLQECGVKSVLLPALEFMRTDKNAEPDPVYIKEKLQTQLELYPDMEIYITQG
1503 :     FICRNAYGEIDNLQRGGSDYTASLIGAAVKASEIQIWTDIDGMHNNDPRIVDKTAPVRQL
1504 :     HFEEAAELAYFGAKILHPTCIQPAKYANIPVRLLNTMDPDAPGTLISNDTEKGKIKAVAA
1505 :     KNNITAIKIKSSRMLLAHGFLRKVFEIFESYQTSIDMICTSEVGVSVTIDNTKHLNEILD
1506 :     DLKKYGTVTVDKDMCIICVVGDLEWENVGFEAKALDAMRDIPVRMISFGGSNYNISFLIR
1507 :     DCDKKTALQSLSDMLFNNK
1508 :     >Pgin_Aa_|_CG-11
1509 :     MKVLKFGGTSVGDAERIRSVARLITSVKGRKIIVLSAMAGTTNSLVEIASHLVKRNVAQA
1510 :     KEVVQVLREKYHREINALYKRPDTLSAAKKAVDSLLDSLGHMCDVEGFTLFEEKRVLILG
1511 :     ELMSTTMMQIYLQEMGAVVAMLPALEYMRTDKNAEPDKDYIRKHLLPMIEAHPDEDMLFL
1512 :     TEGYICRNAFGEIDNLQRGGSDYTASLIGAALNADEIQIWTDIDGMHNNDPRVVDVTAPV
1513 :     RRLHFEEAAELAHFGAKILHPTCIKPAKEKNIPVRLLNTMDPDAPGTLISLDTEKDCIKA
1514 :     VAAKDGITVIKVKSSNKLLSWHFMRKLFEIFEFYQEPVDMVATSEVGVSLTIDNDKNLPD
1515 :     IVRALSDIGDVTVDKDMVIICIVGDMEWDNVGFEARIINALKGVPVRMISYGGSNYNVSV
1516 :     LVKAEDKKKALIALSNKLFNSRATKA
1517 :     >Gfor_Ab_|_CG-11
1518 :     MKVLKFGGTSVGSAVSIRNVKEIISNLPGDKLLVLSAMSGVTNQLVEISEFVKTGSLDQV
1519 :     SEKIQALKAKHFSLIDELVPDKTSNQSIKDHIVLQLEELVEICQVQPWSNEVDAKIITTG
1520 :     ERLLTSIFSSYLKFEEVANTLLDARKFMKIHNLENPDTGLVGELLNDTLKSSFESNILIT
1521 :     QGFVRLNAQNEVSTLKRGGSDYTATILGAAIRAAEIQIWTDISGLHNNDPRFVENTHAVS
1522 :     QLSFEEAAELAYFGAKILHPQTISPVIGKNIPVYLKNTFTPEATGTCISALAERKGLKAI
1523 :     SAKDEITAIKIKSNRMLMAHGFLKKIFEVFDTYETSIDMITTSEIAISLTIDNTANLDLI
1524 :     LQELDQYGEISVDASHSIICVVGEGLIEDRGTSRLFEILQDVPIRMISYGGSSNNISLLV
1525 :     DTRNKIEVLQKLNEKLFVNQLKSV
1526 :     >Chut_Aa_|_CG-11
1527 :     MRVLKFGGTSVGKPERMHSVAKLISSPDPKVVVLSAVSGTTNALVDISTKLCKKDIKAAE
1528 :     DAIEKLFTPYHAFVEELYTTEAGKYKGHAIMRTYYELIKSYVTAPSFGDKETRFFLAQGE
1529 :     LISTNLFQEYLAEQGYSSALLPALEFMKTDADSEPMLEYIEEKLNEQLAKHPNKQLYITQ
1530 :     GYVCLNSDGEVDNLKRGGSDYTATLIGAALRMEEIQIWTDIDGMHNNDPRIVKRTFPIPE
1531 :     ISFDEAAELAYFGAKILHPTCIRPAQVRKVPVRLLNTMQPEQKGTVINSKPSDRDITAIA
1532 :     AKDDITAIKIKSSRMLQAHGFLRKVFEIFENYKTSVDMITTSEVAVSLTIDDAKNLEQIV
1533 :     KELKEFSIVEVDTDQTIICIVGNFGKEKTGISKRLFDAMETIPVRMISYGGSASNISILI
1534 :     NSTLKNETLNALNERLFFQAETVK
1535 :     >Bfra_Ac_|_CG-11
1536 :     MKRRQIRKKNRITKKNREMKIYKFGKIPTGSVQGMKGMLRLIDNSIPKIIVLSATTETTE
1537 :     RLAGIAAHLFNRDTEQAHDEISRLEFRFIDFANELFNDESIKQQAVDSIIDRFRTLWNFT
1538 :     RQRFTSVDEKDILAQGEFISSMLVSLYLKEQGINNRLLNSLDFMRLAPEEEPDMEYIGTK
1539 :     LHLLLAEHKSTNVFLTQGHLCRNAYNETCYLKQGGDDVSATLIGAALQAQEVCLWTDSKE
1540 :     LHSCDPRFVKHPAMVKQLSFDEAEQLAYCGWTGFNPHCILPARENNIPIRLLCSMEPAEG
1541 :     GTLISNSQSGENIKAITARDNIYYIKFQSNRTLRPYLFISKIFDTFAKYHTSLCLFASSG
1542 :     SDVSVAINDKERLSHILHELSRYAATVVKDHMCILSAIGNMQWQCAGFEARIINALATIP
1543 :     IRMISYGSNNNNVSLVIRAEDKREALQRLNDTLFAPCHANPSQIHVPTLKHS
1544 :     >Bthe_Ac_|_CG-11
1545 :     MKVCKFEKMKEEDEIRQVINYILKEHPYVVVVPTLTQLQEWLQDISISWFHEEDSASHTT
1546 :     INNIEEYCCTLADHLITDLPLNTDIKKYIRECIEKMHKLVEDKADLLIDKIIKAEIYRLS
1547 :     GELFACCLRQHGLNARTLDTGTFMQMNLERKPDIPYIQESIRQYINENRDTDIFIAPLSL
1548 :     CKNVYGEIDFMNEKRNDYYATVLASIFEADEIILSTELTNIYANRNCAREQHSLTYTEAE
1549 :     QLINSGVHLIYTDCITLAARSNIVIRLIDTHDLETERLYISSHDTESSVKAIIVQDSVTF
1550 :     VRFTSLNVLPGYLLMGKLLEVINKYQINVISMASSNVSVSMILTASRDTLRIIQRELHKY
1551 :     TEMVVDENMSVIHIIGSLHWERTQLESNIMETIRHIPISLISYGGSDHCFTISVHTADKK
1552 :     QLLNSLSQRFLERLSA
1553 :     >ACID-2a_|_CG-12
1554 :     MIVMKFGGTSVESAEAIDRVAGIVRGRLDRRPTVVVSAMSKATDQLLAMAAAAGAGDKEK
1555 :     AVTLCQALRDRHFGVASALVSDASNPVHTSIAADYLALEQLLEGICAVGELTPRTQDNVV
1556 :     AYGERINSKVVAAAFAARGLKATHVDAREIIVTDHTFGKATPQVAEIDRRLMAKVKPLID
1557 :     DGVVPVLGGFIGSTPDGITTTIGRGGSDFSAALVGAGLNAEAIEIWTDVDGMKTTDPNLC
1558 :     PDAHRIKVISFEEAAELAYFGAKVLHPATVLPAIEKNIPVYVLNSRNPSNEGTKIVARAP
1559 :     QTRNPFKAIAAKKRITVIDVVAARMLMAHGFLRQIFEIFDRHKCAVDVVSTSEVSVSLTV
1560 :     DSNERIPEIAADMEKLAFVKYSGRKAIVCLVGENIRERPGIAAQVFTAISDINVRMISQG
1561 :     ASEINITFVIDEADVPEAVRRLHAHFFTDVDPEVFD
1562 :     >ACID-2b_|_CG-12
1563 :     MIVMKFGGTSVEDAAAISRVAGIVRDRAKQKPAVVVSALGGFTDSLVAMGKAAAKGDLAA
1564 :     ALKLWKAGRQRHLAVLAGVKGAGAAEEQVQELFGNLQDVLKGIAALGELSPRTQDNVLSF
1565 :     GEMLSSVMVVALFKAAGVDAIHIDARQCIVTDNCHTKAVPLLDQTNSRLRSALKEHLAKN
1566 :     RVPVLGGFVGATEDGTQTTLGRGGSDFSAAIVGAALGAKKIEIWTDVEGMLTTDPRICKD
1567 :     ARRIEVIGFEEASELAYFGAKVLHPATLIPAVESNIPVYVLNSRNPKSTGTCIQQHAPHS
1568 :     ATTFRAIALKKGTKILNIRAPRLLINHGFLRSLFEVFEKHSLSPDLVNTSEVSVSVALDG
1569 :     TRDVKALVSDLKRLGQVDVENGKAIVCLVGDNIRGRVGICADVFAVVAKHGVNIHMVSQG
1570 :     ASEINISFVAEENEAVRAVKALHAHFFEEEKLTFAAKGDEVYAGCSGVA
1571 :     >Susi_Aa_|_CG-12
1572 :     MIVMKFGGTSVESAAAIERVAGIVRAREARRPVVVVSAMGKTTNKLLAIASAAIAGKRNE
1573 :     YIPQLHDLRDYHSREARLVVPLSERAELDRFLDEHFQELTELVKGLAVLGELTPRSIDAI
1574 :     SSYGERLSSYIVTLAFRHFGMAAEHIDSRDVIITDRRHTQAAPNFPETYARLQKTIPPLA
1575 :     AQSVVVMGGFIGSTEDGVTSTLGRGGSDFTAAIVGAGIQAEEIQIWTDVDGMLTADPTIL
1576 :     AGGHRVKTISFAEAAELAYFGAKVLHPATVVPAIEKNIPVMILNSRRPEVPGTHITAHTV
1577 :     HCENAVKSIACKRKITTVSIHSTRMLMAHGFLHRIFEIFDRYQTPVDMVATSEVSVSLTI
1578 :     DNTTHIDLVLGELRQFAEATVEHDSVIVCLVGENIRHTPGVARRVFNSLDGINIRMISQG
1579 :     ASLLNISFVIAETDLVNAVRLLHEEFFATLDPNVFERKEAVHA
1580 :     >Atha_a_|_CG-13
1581 :     MASLQLYGVKTPGLALSSKRLEFASKGACFSVTLPSSSAVFRDVEHSCRNIGLRVSCEAL
1582 :     RVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVESAERMKEVANLILSFPDERPVIVLSA
1583 :     MGKTTNKLLKAGEKAVTCGVTNVESIEELSFIKELHLRTAHELGVETTVIEKHLEGLHQL
1584 :     LKGISMMKELTLRTRDYLVSFGECMSTRLFSAYLNKIGHKARQYDAFEIGFITTDDFTNA
1585 :     DILEATYPAVSKTLVGDWSKENAVPVVTGYLGKGWRSCAITTLGRGGSDLTATTIGKALG
1586 :     LREIQVWKDVDGVLTCDPNIYPGAQSVPYLTFDEAAELAYFGAQVLHPLSMRPARDGDIP
1587 :     VRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFTTF
1588 :     EDLGISVDVVATSEVSISLTLDPAKLWGRELIQRVNELDNLVEELEKIAVVKLLQRRSII
1589 :     SLIGNVQKSSLILEKVFQVFRSNGVNVQMISQGASKVNISLIVNDEEAEQCVRALHSAFF
1590 :     ETDP
1591 :     >Atha_c_|_CG-13
1592 :     MAASMQFYGVKTPELALNSKRIEFSSKGLNFSALVSSARVFSRNVDRSCKNIALRVTCEA
1593 :     GRVELLERKASETFKLNKTEKKLTCVMKFGGSSVASAERMIQVAKLILSFPDEKPVVVLS
1594 :     AMAKTTNKLLMAGEKAVCCGVTNVDTIEELSYIKELHIRTAHELGVETAVIAEHLEGLEQ
1595 :     LLKGVAMMKELTLRSRDYLVSFGECMSTRLFAAYLNKIGHKARQYDAFEIGIITTDDFTN
1596 :     ADILEATYPAVSKKLLGDWSKENALPVVTGFLGKGWRSCAVTTLGRGGSDLTATTIGKAL
1597 :     GLREIQVWKDVDGVLTCDPNIYCGAQPVPHLTFDEAAELAYFGAQVLHPLSMRPAREGNI
1598 :     PVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDITSTRMLGQYGFLAKVFST
1599 :     FEKLGISVDVVATSEVSISLTLDPSKFCSRELIQHELDQVVEELEKIAVVNLLRHRSIIS
1600 :     LIGNVQRSSFILEKGFRVLRTNGINVQMISQGASKVNISLIVNDDEAEHCVKALHSAFFE
1601 :     TDTCEAVSECPTGYIAASS
1602 :     >Atha_b_|_CG-13
1603 :     MAATRVRCCHSNAAFTRLPLTRHRNSPTLPISLNRVDFPTLKKLSLPIGDGSSIRKVSGS
1604 :     GSRNIVRAVLEEKKTEAITEVDEKGITCVMKFGGSSVASAERMKEVADLILTFPEESPVI
1605 :     VLSAMGKTTNNLLLAGEKAVSCGVSNASEIEELSIIKELHIRTVKELNIDPSVILTYLEE
1606 :     LEQLLKGIAMMKELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDD
1607 :     FTNGDILEATYPAVAKRLYDDWMHDPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIG
1608 :     KALGLKEIQVWKDVDGVLTCDPTIYKRATPVPYLTFDEAAELAYFGAQVLHPQSMRPARE
1609 :     GEIPVRVKNSYNPKAPGTIITKTRDMTKSILTSIVLKRNVTMLDIASTRMLGQVGFLAKV
1610 :     FSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQQELDHVVEELEKIAVVNLLKGRA
1611 :     IISLIGNVQHSSLILERAFHVLYTKGVNVQMISQGASKVNISFIVNEAEAEGCVQALHKS
1612 :     FFESGDLSELLIQPRLGNGSPVRTLQVEN
1613 :     >Aful_Aa_|_CG-14
1614 :     MRIVMKFGGVSVKDGENIYHCANLVKKFSEGNEVVVVVSAMQGVTDALLKAAHRCCSEPS
1615 :     AGFIKMFIADMMKRHYEAIEYAVRNDEIKAKVIAAVERLLDELEKVLLGISYLGELTRRS
1616 :     EDYIVSFGERLSAPIFSAALLSLGVDSVALTGGDAGIITDRNFGRAKPLPGVYTTIRNRL
1617 :     EPLLTIKKTIPVVTGFIGATDDGSITTLGRGGSDYTATILAAALDADEVWLWKEVDGIMT
1618 :     CDPKYVPNARVIPEISYQEAMELSHFGAKILHPRALEPVMRKNIPVRIKNTFNPDAPGTV
1619 :     IGPTTKDSSEIVKALSLIPQAGIVNVSGAGFDFAEIMSEVFGRLAEERVNVIMVAQSSSE
1620 :     LNLSIVVDIRDLEKAYNALKSLENGVIKVEKIPYIAVVSAVGSGMAGTPGVAGKIFSALG
1621 :     KNGINVIMISQSCSEYNVSFVVDGSDGVNAVKVVHDEFGLGN
1622 :     >Umet_Aa_|_CG-14
1623 :     MRLVMKFGGTSVGDGARIRNVARLVKGYQDQGNEVIAVASAMTGVTDKLYEMAQVAKDTC
1624 :     STSDVEKRFGELAKRHETAIHDAIQDQGIRQEVSAEIERRLSELKNALVGVCYLGELTNR
1625 :     SLAYIYSFGERMSVPILSGALRDLGAKSKPFTGGEAGVITDSRYESARPDPITDIKVREK
1626 :     LLPLLQEGVIPAVTGFVAADSRGIITVLGRGGSDYSASIIGAAVDADEIWVYTDVNGIMT
1627 :     TDPRIVPEAKTLPVVTYLEAMEMSYFGAKVLHPKTIEPAVKKGIPVRVLNTFQPDHPGTV
1628 :     VLMKDNSANCAPIKAVTMIKNIGLVNISGAGLSGTPGIAGKIFSVLGKEDINIIMISQAS
1629 :     SEFNVSMAIDGAQVDKAIAALRREFNGEIERDLTCDNNVCVVAVVGAGMAGSPGTAGKIF
1630 :     TALGKSGVNIRMISQGSSEANISFVINKEDAQRAVKILHDEFELHNL
1631 :     >Mthe-2_Aa_|_CG-14
1632 :     MARLVMKFGGVSVADGRRLRNVGELVRGFSSGNEIVVVTSALQGVTDDLLECARSSAKYG
1633 :     RVSDVDDFIMRLAEKHEQAITDAISDEAIRDEIRSDIRKKIDTLEKAYVGICYLGELTPR
1634 :     SIDYISSFGEQLSAPILSGVFRDMGIESRYYTGGEVGIITNSDYGNAKPLEKSYSLIAKK
1635 :     LLPIKGIPVVTGFIAMDENGIITTLGRGGSDFSASIIGAAIDADEIWFWKETSGVLTADP
1636 :     KIDPSAKTIPTISYIEAMELSFFGAKVLHPRAIEPAIRKGIPVRVKCTFDPESPGTQIVQ
1637 :     EEELKDGVIKAVSLSTNVALLNVSGAEMIGTPGVAARVFSALANAGVNIIMISQGSSEAN
1638 :     ISMVVEEKDLDKAEEALRRDLPREIVRGISHNKDVCVVAVVGSGMAGTPGVAGRLFSAMG
1639 :     RAGINVRMISQGSSEHNISFVVAAKDGKRAVQKIHREFRLNGDRA
1640 :     >Mbur_Aa_|_CG-14
1641 :     MRYVMKFGGTSIADGKKIRHVAQLLIGYKEGGDQVVAITSALGGVTDGILTNAAEASQKG
1642 :     KVSQVKEFMAELAKKHYDAISDAIDNERIADEVIETIDIRIDELEKALIGICYLGELTPR
1643 :     SIDYISSYGERLAVPIISGSIRSMGIDSKPFTGGEAGINTTENYGNARPLKKSYAQIKEV
1644 :     VGPLVENSIPVVTGFIAEDKNGIITTLGRGGSDFTASLIGAAIQADEIWLWKEVHGIMTT
1645 :     DPKIVPEASTISQISYIEAMELSYFGAKVLHPRAIEPAIIHGIPVRVKNTFDTQFPGTLI
1646 :     VADQNCSEEVAKAVTLIRNVAAINICGAGMVGAIGTAAKIFTTLANAGVNIIMISQSSSE
1647 :     ANMSLVIEQSHLKRAIKSLEHAFNEGVVGEVAYDEDVCVVAVVGAGMDGSPGVAGKIFGA
1648 :     LGKEKINVIMISQGSSQHNISFVVKEEDAEEAVKVLHREFGLGKKNGCN
1649 :     >Mace_Aa_|_CG-14
1650 :     MKIVMKFGGTSVGDGKKIRHVAQLLKRYHEEGNQIVVVTSALGGVTDRLLENARLASTKG
1651 :     KVSLVKEFKTELTNKHHEAVKDAIEDPRVAKEVLQVLDLRIEELEKALIGICYLGELTSR
1652 :     SIDYISSYGERLAAPIVSGAVRSLGAASIEYTGGEAGIVTTSDYGNARPLEKTYELVLKR
1653 :     LGCRLESHILVVTGFIGENEDGIITTLGRSGSDFSASILGAALKADEIWLWKEVNGIMTT
1654 :     DPRIVPEAKTIPQISYAEAMELSYFGANVLHPRTIEPAMREHIPVRVKNTFNPEFPGTLV
1655 :     VAEKFQCRHVVKAVSLIKNVALINISGAEMPGTVGTVARLFTALARAGVNIVMISQGSSE
1656 :     SNLSFVVSESHVESALKALHAEFNREIVKEITSDRNVCVVAVVGAGMAGTPGVAKRVFGA
1657 :     LGNSMINIIMISQGSSQYNISFVVREGDAFAAVKTLHDEFELYNGNGIEKKL
1658 :     >Mbar_Aa_|_CG-14
1659 :     MKIVMKFGGTSVGDGKKIRHVAQLLKRYREEGNQIVVVTSALGGVTDELLENALFASTKG
1660 :     KVSLVKEFKTEITNKHHKAVKDAIDDPTVAKEVIQTLDLRIDELEKALVGICYLGELTSR
1661 :     SIDYICSYGERLAAPIVSGAIRSLGIESTEFTGGEAGIITSSDYGNARPLEKTYELVNKR
1662 :     LGCRLETQILVVTGFIGENEEGIITTLGRSGSDFTASILGAALKADEIWLWKEVNGIMTT
1663 :     DPRIVPEAKTIPQISYAEAMELSYFGANILHPRTIEPAMREHIPVRVKNTFEPKLPGTLV
1664 :     VAEKFQCKNVVKAVSLIKNVALINISGAEMVGAIGTVARLFAVLAKSGVNVIMISQGSSE
1665 :     SNISFVISEAHVKTALKALHEEFNRGIVKEITSDKNVCVVAVVGAGMAGTPGVAKRVFGA
1666 :     LGNSLINIIMISQGSSQYNISFVVRENDAFAAVKTLHDEFELYNGNGIEKQL
1667 :     >Mmaz_Aa_|_CG-14
1668 :     MLKRDPIMKIVMKFGGTSVGDGKKIRHVAHLLKKYNEEGNQIVVVTSALGGVTDRLLENA
1669 :     RLASTKGKVSLVKEFKTELTNKHHEAVRDAIEDPNVAKDVLHILDLRIDELEKALIGICY
1670 :     LGELTNRSIDYISSYGERLAAPIISGAVRSLGIPSIEYTGGEAGILTTSDYGNARPLEKT
1671 :     YELVSKRLGCRLDSHILVVTGFIGENEDGIITTLGRSGSDFSASILGAALKADEIWLWKE
1672 :     VNGIMTTDPRIVPEAKTIPQISYAEAMELSYFGANVLHPRTIEPAMREHIPVRVKNTFDP
1673 :     EFPGTLVVSEKFQCKHVVKAVSLIKNVALINISGAEMAGTIGTVARLFTALARAGVNIVM
1674 :     ISQGSSESNLSFVVSEAHVEPALKALHAEFNREIIKEITSDKNVCVVAVVGAGMAGTPGV
1675 :     AKRVFGALGNSMINIIMISQGSSQYNISFVVREDDAFAAVKTLHDEFELYNGNGIEKKL
1676 :     >Mmar-6_Aa_|_CG-15
1677 :     MKFGGTSVGEADCIGRVADIVESHRSAGDEVAVVVSACSGITDRIIAVADEVIASKEQPD
1678 :     IGTLLDAMRERHTRLLKETAPDHAREVTAVIDDRLTRLQNILTAVHTLKELTPRSRDYIV
1679 :     SFGERLSAPIVAAALRQRGIASVALDGAEAGITTTANHGDARALPVSAENIRARVAPLLA
1680 :     DAVPVIMGFMGATEQGVITTLGRSGSDYSAAVIGAGVDADEIWIWTDVDGVMTSDPRIIP
1681 :     DARVLDDISYLEVMELSYFGAKVLHPRSIEPAMQKDIPIRVKNSFKPEVPGTLVLRDKHQ
1682 :     EKRVVKAIALIEKVALVNINGAQMVGRPGVAKTIFSALAEREVNVMMISQGSSEANISLI
1683 :     IDESHLDAALGALDPLVEQGIVREVTYDHDVAAVAVVGAGMAGTPGTGGRIFSAIGRAGI
1684 :     NMMMISQGSSEVNVSFVVKAGDGKRALQVLHDEFRLSENSDD
1685 :     >Mhun_Aa_|_CG-15
1686 :     MKLIMKFGGTSVQNAESVRRAVDIVYDRYSRHDRLAIVISARRGVTDRLITCAEAMVTSR
1687 :     DAAEVTDLVEYLTEGHLSTLKEVAPDFSPEVSGIITRRIENLRDFLYAVYHLRELTVRSR
1688 :     DYIISFGERLNAPIISAALRQRGIPSMVLDGCEAGILTTENHGDAIALPAGEARIKSRLE
1689 :     PVIDHSVPVITGFMGCTEKGVVTTLGRSGSDYSATIIGAALDADEIWIWTDVDGIMTTDP
1690 :     RLVPEARVIPRISYIEVMELSYFGAKVMHSRSIEPAMQKGIPVWVKNTFNPSYPGTVIEG
1691 :     GEQKDSRVVKAITYIDKVAAITIAGAQMVGRPGVARHIFTLLAEHQINVMMISQGSSEAN
1692 :     ITLIIEANQVRTAMEALLPLKERCVFRDITANEDVCAVAVVGSGMAGMAGTAGRTFSALG
1693 :     KAGINVMMISQGSSEVNISFVVRQQDGPRAVKVLHDEFNLMNEEA
1694 :     >Mjan_Aa_|_CG-16
1695 :     MTTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVR
1696 :     DIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPK
1697 :     SRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLP
1698 :     LLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDP
1699 :     RLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITN
1700 :     DMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETN
1701 :     ISLVVSEEDVDKALKALKREFGDFGKKSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGI
1702 :     AGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEKTNS
1703 :     >Mmar-5_Aa_|_CG-16
1704 :     MVTVMKFGGTSVGNGERIRNVAKIVVNKTNEDKDVVVVTSAMTQVTNSLVEISAQALDVR
1705 :     DIAKINNFIEDLRRKHEIAIEQAIENHDIRVEVSKTIQSSINDLEKVLVGVSYLGELTPK
1706 :     SKDFILSFGERLSAPILSGAIRDMGKHSLFLAGRDAGIITDDTFTCAKILRLDVADKIEP
1707 :     LLKDGFIPVVTGFVAGTEEGHITTLGRGGSDYSAALVGRGLMANMVEIWTDVSGVLSADP
1708 :     RMVENVKKIPKMSYIEAMELAYFGAKVLHPRTMEPVMEKKIPLRIKNTFEPENEGTLITD
1709 :     SSETSNGVIKAITTIKDVILINIFGGGMVGVSGTAARIFNVLGKSNANVILITQGSSETN
1710 :     ISIVIYDGELEAKKCVRELRSEFGECHLIKDISFDKDVCVVSVVGSGMKGAKGIAGKLFD
1711 :     AVAESGANIKMIAQGSSETNISFVINEDKLEPCLKNLHKTFVEDDINF
1712 :     >Dgeo_Aa_|_CG-17
1713 :     MAYSLLVMKFGGTNMQDAQAIRHSASLAARSIREGVKVVVVVSAMAGVTNQLLGLADAAQ
1714 :     RGDIATANDEIAALRTRHFAAAQELGAAPDSEVVREIRELHETLRQAVYGVYLLRELTPR
1715 :     SRDLIVAFGERFSAPLMRLALEGQGLLAHHLTGGQAGITTDTHFGNARPLPGTYERIRDR
1716 :     LGGLLAAGVTPVVAGFMGETEEGAITTLGRGGTDFSATIIGKALDADEVWAWKDVDGVMS
1717 :     ADPRVVPDARNIEVLSYGEVMELAYFGAKVLHPLAVTPLQESGIPLRVKSAADPDFPGTL
1718 :     VQEGAHNEAGHPVKAVTAIRRVSIINVTGAGVLGVPEVVASLFEAIARENITLLMVSQSS
1719 :     SMSNVSLAVQSADAARTLDALRRRVTGELNIEEQPGVAVLAIVGAGMRGQKGVAARLFGA
1720 :     LAAADVNILMISQGSSELNISVALEDAQVERATRAVHAAFGLGQTAAAAD
1721 :     >Drad_Aa_|_CG-17
1722 :     MSQPQPPSRLLVMKFGGTNMQSAHAIRHSASLAGRSVREGVKVVVVVSAMAGVTNGLLHL
1723 :     ADAAQSGDIARANDEIAALRTRHFTAAQELGAAPDSETVRELRELHETLRQAVYGVYLLR
1724 :     ELTPRSRDLIVAFGERLSAPLMSLALEQSGLRARHLTGGEAGILTDTNFGNARPLPGTYE
1725 :     RVGDRLSGFLSAGVTPVIAGFMGETEQGAITTLGRGGTDFSATIVGKALGADEVWAWKDV
1726 :     DGVMSADPRVVGDASNIGVLSYGEVMELAYFGAKVLHPLAVTPLQDSGIPLRVKSAADPD
1727 :     FAGTLVRSQAEEIPGRPVKAVTAIKNVSLLTVTGAGVLGVPEVIASVFTAIARENITLLM
1728 :     VSQSSSMSNVSLAVPSADAARALQALRAGLSSELNVEETNGVAVLAIVGSGMRGQQGVSA
1729 :     RLFTALASEDINILMISQGSSELNISVALSGEEVDRATAAVHAAFTLSQPVGA
1730 :     >Paby_Aa_|_CG-18
1731 :     VRKMIVLKFGGSSVKNDFHEAVSLTKSIFEEKEVAVVVSALKGITDMLIKYAKTFDSKYA
1732 :     IKIADSYVKFARTNGVDPNILSPHIQELFNPPSLPKDALTDYILSIGELLSAVIFAEVVE
1733 :     GQVIYPWELFSAYGKFGDGFIDLKKSKKNAKIIYEVIDSGKIPIVPGFVGGMDGYRVTLG
1734 :     RGGSDYSAVALGVILNSELVAIMSNVEGIFTADPKLVPSARLIPYLSYEEALIAAKHGMK
1735 :     AIQWKAAELAKEKKILMLFGRTNNWRMGTVISNRTSRMPLMTYKDGLLLINVEEELEYRV
1736 :     IDEGPFWKLYDVPGNEGIRIIRELHKAIFGNVLSMLQEPGKHIRINRHKVGKSFEHMTFN
1737 :     QSFSRKFY
1738 :     >Paby_Ab_|_CG-18
1739 :     VVYKLLVVKFGGSSVRYAFEEALELVKYLSERIPIVVVVSALKGVTDELIRFANGDKGAL
1740 :     PRIERIHEEFLNYHGLNTKISISFRKDMPPEALRDEIISLGERISAKIFAEGLELLGIKS
1741 :     KVVDPLEFLIAKGEFGDAYINIQESKRRAGKLIRLIKSGVIPVIPGFYGNLNGFRVTFGR
1742 :     GGSDYSATALARILDSRCVLIMSDVEGIFTADPKLVPSARLIPYLSYEEIKVAAKLGMKA
1743 :     LHWKAVDPVVGDIPIIFGKTKDWKFGTIVLNARSNFPIIVHRVREDFAEIFVVGRNISLP
1744 :     GFLVEEEREDFVKIVVAREDLPEAIREIHREVVEREEKNLRTGNNSELWARI
1745 :     >Pfur_Aa_|_CG-18
1746 :     VVEKPVVVKFGGTSVRYAFEEALELVANLNENTRTIVVVSALAGVTDCLLRLANGDMSAL
1747 :     LEIEEIHEELSQELDVQLDHLMYQLHKTLNSKSSFPSKEAFVDEIASFGERFSAELFSEG
1748 :     LKILGINAKAVDSKDILFAKGDYGNAEVDFKKSVYGAGILYRMLRRGIVPVVTGYYGNLN
1749 :     GFRATFGRGGSDYSATSIARLVNAKATLIMSDVEGIYTADPKLVPSAKLIHYISYREAKI
1750 :     AAKLGMKALHHRAIDPVEGRIPVILGKTRDLKFGTLISHKSQGIPVVVHKLIEDHAEVSV
1751 :     VSTRRSFSLPYEVYEEGDFYFKIKIPKEQFLEVLKDIHRRVVENESLRPSYDSELWAWV
1752 :     >Pfur_Ab_|_CG-18
1753 :     MIVLKFGGSSIKYDFEEATNLALSLFEDDAVIVVVSAIKGITDKLILYSQTLDKTIATKI
1754 :     ASEYVSFAKSHGIDPVILKPYLDELFNLPDLPEEALRDYILSLGEVLSAVIFSASIGGKF
1755 :     VPSWDIFEAEGNFGNAFIDIKSSKKKFKRVFEVLEEGYIPVIPGFTAGKDGYILTLGRGG
1756 :     SDYSGVAAGVLGKAKLVAIMSDVEGIYTADPKLVPSARLIPYVSYDEIIISSKHGMRALQ
1757 :     WKAAELAKEYKIPVLFGRTRNWRMGTLMSERSSGMPLMTYKDGLLLVNVTEEIKYPIIAE
1758 :     GPFWKLYKVSQEEGIHLMRELHTKLFQPSFIQYSVYKSSENGQKTQEFNEKISIEQGENR
1759 :     KIYYSEEEVNLPG
1760 :     >Phor_Aa_|_CG-18
1761 :     MNLRGKMIVIKFGGSSLRSEFKSAVSLIKALSEEKDVVVVVSALKGITDLLEKYTDTFDS
1762 :     RYAVEVSKTYLEFGKRMGIDTSSLSPYLKQLFNPPDLPPQALRDYILSIGELLSAAMIAE
1763 :     KANGAVIFPWDLFVAHGSFGNGFIDIKKSKRNVKLVKEALESGKIPIIPGFIANLNGYRV
1764 :     TLGRGGSDYSAVALGVLLNSELVAIMSDVEGIFTADPKMIPYSLLIPYMSYDEILIASKY
1765 :     GMEAIQWKAAKLAKEYEALILFGRASDWRMGTVVSNSSSHMPLLSYDQGKLLVMNMDSEI
1766 :     PYEVVEEGEFWRVYRVPKRDSIKIIKELHRKIIYQENAQLLGRVKA
1767 :     >Phor_Ab_|_CG-18
1768 :     VVEKPVVIKFGGTSVRYAFEEALELVAKLHENMKIIVVVSALAGVTDCLLRLAKGDKSAL
1769 :     LEIDEIHEELSQELNVQLEHLIHQLKKTINSKSSFPSEKAFIDEIASFGERFSAKLFSEG
1770 :     LKILGITARPVDSKDVLFVKGEFGNAEVEFKKSAQGVDVLYRMLRRGIVPVVTGYYGNLN
1771 :     GFRATFGRGGSDYSATSIASLVNAKAVLIMSDVEGIYTADPKLVPPARLIHYISYKEAKT
1772 :     AAKLGMKVLHPRAIDPVEGKIPVILGKTRDLKFGTLISHESQGIPIVTHKLLENHAEISV
1773 :     VSVKTNIPLPYEVYEEGDLYFKIKTSKDQFLEVLRDVHRRVVENENLHSSHDGELWTWV
1774 :     >Tkod_Aa_|_CG-18
1775 :     VVKFGGTSVRDDFREAVTFVSRLWDENEVALVVSAIKGVTDALLKFSRTGEGFEWIEKVH
1776 :     RDFAKKYGIPFETLAAPLRELKKLSREDFPSFEAYRDHVLSYGEWLSGLAFAEALRREGI
1777 :     QVELFEPWEILETDGNFGNARVDIAKTSRNLKVVEEALERGRVAVVPGFVGSYNGLRTTL
1778 :     GREGSDYTAAVLGKGLKARAVLIMSGVDGIYTADPRRVVSARLIPFVSYDELYVASKAGM
1779 :     KAIHHGAIDVVRGIPIIFGRTRDWSIGTIAGYESSSLPILVHRVAGEEAVITAVGVAEVP
1780 :     GFDGENGSELGIPLVRLTVPSARLGSTLNLIHLRLIADRISPPRALSIIRGGVSAGNV
1781 :     >Aper_Aa_|_CG-19
1782 :     VVGCAPNDLVVVKFGGSVLNGSPGFLAAGRLVLGLLESGLEPVVVVSAVKGVTDALLSSF
1783 :     ERRDPGVGGAVGKTYLSIARELGLPPESVRDVSLASAEVSKLLWAAEVLGQWTPRVRDLV
1784 :     VSYGERLSAALMAGLLRRLGVEARWLGGGEAGIVTDGEFGDATPLYGYTEGVIRERLEPM
1785 :     LEEGVVPVVAGFTGATREGDTTLLGRGGSDLTATLLASALGAGRVVLYTDVPGILSGDPR
1786 :     VVGEPRRVGYMSYEEAWEVARLGLRKFHPRTFEPLIAGGLGVEVVVSDLRGRSTRIGPGR
1787 :     GGPPLKVVSLSRGVARLVVRGPSMAGKRGFLSRLAGLLAGRGVNILAIRQPPSETAIELV
1788 :     VDERDLPAAVEELGARSGAAGVRLEVERGFDVVSIVGWGAVEALPEALSAAEKTGGRLLS
1789 :     TGELSPSISILARGRTSPELARLLHRRVVESWVTG
1790 :     >Mkan_Aa_|_CG-19
1791 :     MEVHKFGGTSVASEEGLRTLEASAASGHVIVVSALAGVTDALEDFVRRAAEGSADPTPIL
1792 :     ERHREFITEHLEQRHEEVESFLKDMETLLHGVATVLEQLGRPEERLRDLVLSLGERASAR
1793 :     IVAAYLKERGIKAMAYDAWDVGLVTTDDPGNADIVGWDGTRSRLLRDLRSGRVPVVTGFI
1794 :     GRSDRGHVTTLGRGGSDYTATVLAGVLGSRSVIWTDVDGIMTTDPELADAEVVERLSYEE
1795 :     AMMAGASGAGVIHPKAVEAAKNLGVTVLIGNSFTGEIGTVISDSTEPGPKVVASRDDVAL
1796 :     IRVSGAKMVDEPGVVGRVTSALGNAGVNLLAVFTTVSEPYINLLVEETALRSAEEALNGL
1797 :     DYDWEVDKDVGLVTVVGEGMSARDVSTFLAACEGFDLLGSAHGVVAVSVVVPESEVREVT
1798 :     RRLAERLLA
1799 :     >Msed_Aa_|_CG-20
1800 :     MLVVKIGGSIQKDERDFELIANRISQYSSRDRTIVVTSALKGVTNSLIEATENRDKAVEI
1801 :     VSEIYDRHVKLLSKIVDGPEFDNAFKSISKLADELFRIAWSIKVLDEISARVRDYILSFG
1802 :     ERMASVTLGAMLRSRKMDAQSYPEPLLVTDDSFGEANVIEDLSAMEARKVLDIPSKIVVV
1803 :     PGFIGKTPTERYTTVGRGGSDYTATLLGKLLGFPEVRLVTEVPGIMTADPRKFPGAKTIS
1804 :     RLSLEEAMELAQMGAKRLHPRTFEPMFDRDIRVYIEGLYDEGYTLVQGTCDSSDKLKGIA
1805 :     VLDDLKLISVESTNIVGKIGSAARVMEKAREAGVNIISLSQPASETTIHIVVDSKNAERL
1806 :     SSRLQELRDVDSINVQDASAVSVVGCGLRNKELFREVLREASSFEVASISRGLRNVSATF
1807 :     VVKKDEGFNLAKDLHEVVVKWIN
1808 :     >Saci_Aa_|_CG-20
1809 :     MIKVIKIGGSIQKDEKDYELIADKISKYSDENRTLIVTSAIKGVTDQLTSVINETDKAVD
1810 :     KVTEIYDKHIKLLSKLVDGIEFEKAFRDISRLVDELYRIAWSIRVLDEATPRVKDYILSF
1811 :     GERLAVILLSSFLRTRKFSVNNLIEPPIVTDENYSEANVLLEDSKELLSKKLEESQQKIV
1812 :     VLPGFIGKSKNNRYTTIGRGGSDYTATLIGKLVDAKEVRLVTEVPGIMTADPRKISNSVT
1813 :     IQRLSLEEAIELSQLGAKKLHPRTFDPLFDANMKVIIEGLYEEGCTIIEGLCTSKDGLKG
1814 :     ITTKEGLSLITIESTRIVGKIGSASTITSEAKNANVNIIALSQPASETTIQFVVDQKDQK
1815 :     KFVERLSQLSGLIKNIELSEVGAVSIVGCGLRNKEISSKVLSKASSYNPIFVSRGLKGVS
1816 :     ITFIVDKKELDSISKELHEVVVNWSIN
1817 :     >Ssol_Aa_|_CG-20
1818 :     MALIVKIGGSIQKDEKDYELIVKKIQDFSKKSDKIIVVTSAIKNVTNELISATSNTDNSP
1819 :     NIVTEIYERHIKLLSKLADGKEFENSFKDISRLSDELFRVAWSIRVLDEVTPRVRDYILS
1820 :     FGERMATLLLSAILRSNGIEAEGIITPPFLTDENYGEANVIEDLSKNEIANILENAKANV
1821 :     IVLPGFIGRTREGRYTTLGRGGSDYTATLLGKLVGVREVRLVTEVPGIMTGDPKKFENAK
1822 :     TISRLSLEEAIELSQLGAKRLHPRTFDPVFGSDMKVIVESLYEDGFTIINGECQNNDGLK
1823 :     GISLLDNAKLITVESTKIVGKIGSAARITNEAKEAGVNIISISQPASETTIQLVVDSLSA
1824 :     NRLLSKLEEIRGTLVKDIEVNDINIVGIVGCGIKKKEISTKVLSIASSYDPLAISRGISN
1825 :     VSMTFIVNKDEGEKLAKELHKVIVSG
1826 :     >Stok_Aa_|_CG-20
1827 :     MKVIKIGGSIQKDEKDYELILDKLKKEIDYNDKNIIVTSAIKNITNQLLDIIKNTDKAMD
1828 :     IVTDIYDRHVRLLSKLTNGIEFERSFGEISKLADELFKIAWSVRVLDEVTPRVKDYILSF
1829 :     GERFAVILLSAFLRSNNIQSSYILDPPLITDENFGEANVLLQQSKENLTKKIDGINGNVI
1830 :     VIPGFIGKSTQNKFTTIGRGGSDYTATIVGKILGAKEVKLITEVPGIMTADPKKIPQAKT
1831 :     IPRLALEEAIELSQLGAKKLHPRTFDPIFNTNLKVVIEGLYEEGSTVIEGNCTKDDILKG
1832 :     IATRNNLELITIESTNIVGKIGSAATIMSEARNANVNLIAISQPVSETVIQLVIESQDKD
1833 :     RLIERLNNLNNLIEDIQSRKVSAISIVGCGLRNKEISAKVINKASSLDPIFISRGLKGVS
1834 :     LTFIVDEKDENSLAKELHEVILEWQTK
1835 :     >Bbac_Ab_|_CG-21
1836 :     MAKLVVSKFGGTSMGDADCMLRSAEVSFRQGSGLVVVSATSGTTNDLIALGKTAESQAWS
1837 :     ESEKILSKIQDKHNKIAQDLKLPADAKAKLETLFEEMSSLAKGMHLLKDCSVKAMDTLMS
1838 :     LGERMSSVLFTEAMSQVLKKHGSAKSAELLDVRTVLRTDDQFGKAKPLTNDVANLCQKNL
1839 :     SFLREGKKVMCTQGYIGMTEEGITTTLGRGGSDYSAAILAEGVSADVLEIWTDVAGIATT
1840 :     DPRLCPKAQPISEISFKEASELATFGAKVLHPATLLPAIRKNIPVFVGSSFDVEARGTWV
1841 :     RMDVEDHPLIRAMALRKKQVLVTLSTPEMLYAHGFLFQIFKIFNDHKVSIDAITTSEISV
1842 :     SVTLDDSTLLNKNLIKDLSQIADVQVEENLALISLIGNNINHTPGLGKRIFETIPDINVR
1843 :     MICLGASKHNFCFLVADEQGPEVIKRLHACFIEAGIEEMA
1844 :     >Ahyd_Ab_|_CG-21
1845 :     MSPINVAKFGGTSVANAAAMNNCAEVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
1846 :     QEAQLARLTEIQQAILTELGDPGDLSDLIHGQLGEIRTMARQAHLHTDAELADRLIACGE
1847 :     LMSTRLFTELLRQRGVKACWQDARQLLRTDSRFGKASVDLAATRALCQAALGPLLGDSLI
1848 :     ITQGFIGADGDGRTTTLGRGGSDYSAALLAEALDAGTIEIWTDVPGIYTTDPRLVTRARP
1849 :     IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTRTNPLF
1850 :     RAVALRRNQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
1851 :     SNGEPILGDKVLAELGQLCKVQVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
1852 :     YGASAHNLCFLVKEDEAGHIVNRLHQELLD
1853 :     >Asal_Ab_|_CG-21
1854 :     MSPMNVAKFGGTSVANAAAMNNCANVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
1855 :     QEAQLAKLAEIQQAILTALGDPADVSTLIHATLGEIRTMARQASQHTDAELADRLIACGE
1856 :     LMSTRLFTELLHQRGIKAHWQDVRQLMRTDSRFGKATVDLGATRGLCQQALGPLLGDSLI
1857 :     ITQGFIGSDADGRTTTLGRGGSDYSAALLAEALDAGSIEIWTDVPGIYTTDPRLVTRARP
1858 :     IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTSTNPLF
1859 :     RAVALRRQQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
1860 :     SNGEPVLSDKVLAELGQLCKVKVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
1861 :     YGASAHNLCFLVKEEEAGHIVNRLHQELLD
1862 :     >Cpsy_Aa_|_CG-21
1863 :     MNSVQSTSSLTVAKFGGTSVADYQAMLRCANIIKNDNSNRLVVVSASSGVTNLLVRLSQK
1864 :     NVSVIEQKDIVENIRAIQVNITQHLSSDVEAQLNQEINSLLDELTQHALTQLLQYSTKTA
1865 :     DAILAFGEQFSSRIFAQVLQSVDIPGEYFNVQQVMKTNSLYGKAVVDLNQLSEQSTQLLA
1866 :     PKLIDKVIVTQGFIGQDSQGHTTTLGRGGSDYSAALLAEALNGTNLSIWTDVVGIFTTDP
1867 :     RITDQARAIKEISFGEAAEMATFGAKILHPATLIPAMRRNIPVFVGSSKEPEKGGTQIKQ
1868 :     KVDSNPTYRSIALRREQTLVTVKSPAMLHASGFLAKVFGVLAKHELSIDLITTSEISVAL
1869 :     TFDNPSGSTQSLITNAVVAELEQLCEVSVEHGLSLVAVIGNGLTCAKGIGQSIFETINDV
1870 :     NIRLICHGASANNLCFLVNEDEANYVVEKLHNTLFA
1871 :     >Iloi_Aa_|_CG-21
1872 :     MTFTVAKFGGTSVADYASMLRCAEIIQSNSSIRLVVVSACAGVTNRLVAIADLQGRQIEK
1873 :     LLNEIYEIHFAIQKRLKNASQVQKSLEQLHHKLALHCQKTTEDQASWRDELLSFGERCSS
1874 :     LLFSSLLVEQGLCSSTLDARQLLKTNSDFGRAQPDEVTTKSHCLEQKQKLESGCVRVTQG
1875 :     FIGSDENNQTTTLGRGGSDYSAALLAAGFNATDLQIWTDVAGIYTTDPRICPSARAIAEM
1876 :     SFSEAAELATFGAKILHPSSLAPAIKNDIRVFIGNSQDALSGGTYISASPTSRPDVRAIA
1877 :     LRRDQTLVTVHSLNMLHASGFLARLFEILARYNVSVDLVTTSEVSIALTLDEGGSAANGQ
1878 :     ALLPAAALEELEQFCRVEVETGLSLVAIIGNGIGRDAHISQLTFNTVNDYAVRLICQGAS
1879 :     EHNLCFLVADNEGENVIRTLHDRILR
1880 :     >Patl_Aa_|_CG-21
1881 :     MSDSSINVAKFGGTSVATYATMLNCAKVVKGNPATKVVVVSASAGVTNILVELAHKALTK
1882 :     DEISAYIEQIQAIEFAILNDLGAPTLVADKLLELLESLKQLAFHEEILHRPDLKDSLLSH
1883 :     GERMASLLFSEVLTQQGLPADNFDVRNVLLTDSEFGQAAPQLDGIKQRAAKLMAPEIAKT
1884 :     VLVTQGFIGSDEAGNTTTLGRGGSDFTAALLAEALGAQSCEIWTDVIGVYTTDPRITDAA
1885 :     RPLPELSFEEAAEMATFGAKVLHPATMEPALRQNIKVFVGSSKEPEKGGTWIVRDCEHEP
1886 :     SYRAITRRKDQVMVTVKTPKMMYAQGFLQNVFTIIAKHNLSVDLVTTSEICVSFTLDNPP
1887 :     NSVLQRLNRETIEELSQICEVELEEHFDLVTVVGNNMHSAAGVSSRIFAAVSDFNLRMIC
1888 :     FGANVHNMSMLVSEKDSSNVVKALHKSLFEAE
1889 :     >Phal_Ab_|_CG-21
1890 :     MGLNPQNCHQYRWRASGSEFSYLIFAAKFFLFYYGLDAVKGDEMTTQSVPHVVLGNKSNY
1891 :     TVAKFGGTSVANFAAMDHSSKIIVADKSVRIVALSASAGVTNHLVELCNSSLSEDERQAH
1892 :     INGVLAIQQAILAELSLDTDLEQGFAQTLAAFEKLASQTLQTKALHDELLSFGERLSTYL
1893 :     FTQVLRSKGLNAIRFDVRQVLKTDSQFGKATPNVAATAQAASALLIPLLDDQVIVTQGFI
1894 :     GSDEHGQTTTLGRGGSDYSAALLAEAIHAKSVHIWTDVVGIFSTDPRLCVKATPIARLSF
1895 :     DEAAEMATFGAKVLHPATILPASRSHINVFVGSSREPERGGTWIEREKSQLPGIRAVTQR
1896 :     KNQILLTLKSPEMLLASGFLARVFTILSEFNISVDLVTTSEISVAITLDNAPNASRPELD
1897 :     QGCLDKLAEFCHVSVENNLTLVALIGSEIQLRQHEMNLMQVLSDFNIRLICHGASKHNLC
1898 :     FLVEQGESDNVVQAIHSRLLESDCAA
1899 :     >Sama_Ab_|_CG-21
1900 :     MSLVVAKFGGTSVADFNAMSRCAAIVLANSATRLVVVSASSGVTNLLVELTQATVTDERR
1901 :     LQLLKQIAQIQYAILDKLERPQDVAAALDALLSRISVLSESLILNRSKAIMDELLSMGEQ
1902 :     CSALLFSAVLRQQGAKSSSFDVRQVMRTDSHFGRAEPQIEDIAALARDFLQPLLERDIVV
1903 :     TQGFIGADAEGRTTTLGRGGSDYSAALLAEALRADAVEIWTDVAGIYTTDPRLAPNARPI
1904 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSREPEKGGTWIRHQVDNPPIYR
1905 :     AVAVRRDQTLLNLHSLQMLHARGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
1906 :     TGSGLLSEALLQELSQHCRVRVEDNLALVAIIGNRIASTPGICRQVFTVLENHNVRMICQ
1907 :     GASPHNLCVLVAESEAAQVVKALHENLFEGQA
1908 :     >Sbal_Ab_|_CG-21
1909 :     MSLVVAKFGGTSVADYNAMNRCADIVLANPHCRLVVVSASSGVTNLLVELTQESINDDGR
1910 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMSVLSDALASQRSKATMDELLSLGEQ
1911 :     CSSALFSAVIREKGVNSSAFDVRRVLRTDSHFGRAEPQVEQIATLARDYLQPLLAEQVIV
1912 :     TQGFIGADEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAFPI
1913 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
1914 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
1915 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
1916 :     GASPHNLCVLVTESEAAQVVKSLHQNLFEGA
1917 :     >Sden_Aa_|_CG-21
1918 :     MSLVVAKFGGTSVACHYSMVRCAQIVINSPMTRLVVVSASSGVTNCLVELTQSNINDQQR
1919 :     QTLLTEIAKIQYGICDGLSRRAEVLSNIDVILSRIAELSDALVLNRSKALMDELLATGEQ
1920 :     CSALLFAAVLREQGANAQAFDVRQVLRTDNHFGRAEPQIAFIADLAQTQLAPLLQSQVIV
1921 :     TQGFVGADVDGNTTTLGRGGSDYSAALLAEALQASAVEIWTDVAGIYTTDPRLAPNARPL
1922 :     KEISFNEAAEMATFGAKVLHPATILPAVRQQINVFVGSSKAPEEGGTWIRHQTEDSPVFR
1923 :     AVTLRKDQTLLNLHSLQMLHTQGFLAETFATLAKHKISVDLITTSEVNVSLTLDKTGSDS
1924 :     SGQGLLTEALLADLSEHCRVKVEDQLALVAIIGNKIASTAGICARVFNVLVDFNVRMICQ
1925 :     GASPHNLCVLVSAADASAVVQALHSDLFE
1926 :     >Sfri_Ab_|_CG-21
1927 :     MSFVQSEIDTPELVVAKFGGTSVADYASMSRCADIVLANQATRLVVVSASSGVTNLLVEL
1928 :     TQANVNDERRLVLLKQIAQIQYAILDELGRPQDVAASIDKILSRMSVLSESLELNRSKAV
1929 :     MDELLSTGEQCSSILFSAVIREKGTASNHFDVRQVLRTDSHFGRAEPQIEAISTLAGDFL
1930 :     QPLLARYVIVTQGFIGADEEGRTTTLGRGGSDYSAALLAEALRATAVEIWTDVAGIYTTD
1931 :     PRLAPNARPIAEISFNEAAEMATFGAKVLHPATILPAVRQKIQVFVGSSKAPELGGTWIR
1932 :     HQVEDTPVFRAVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVS
1933 :     LTLDKTGSDSSGQGLLSESLLQELSQHCRVRVEENLALIAIIGNRIASTAGICSRVFKVL
1934 :     ENHNVRMICQGASPHNLCVLVAESEAAQVVNALHQNLFE
1935 :     >Sloi_Aa_|_CG-21
1936 :     MSIVVAKFGGTSVADYEAMNRCADIVLANPETRVVVVSASSGVTNLLVELTQEHVDFERR
1937 :     QQLLKAIASIQYKILDELGQPHDVAARLDAILSKIASLSESLSQNRNKATTDELLAQGEQ
1938 :     CSSVLFAAVLREKGERASAFDVRQVMRTDSHFGRAEPQIEAVKQLCTEHLLPLLSEQRIV
1939 :     TQGFIGADEQGATTTLGRGGSDYSAALLAEALDASAVEIWTDVPGIFTTDPRLAPNARPI
1940 :     PEISFNEAAEMATFGAKVLHPATILPAVRHKIQVFVGSSKAPELGGTWIRHQVNDEPIYR
1941 :     AVAVRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
1942 :     AGNSLLSEALLQELSQHCRVRVEDGLALVAIVGNKIATTSGVCRRVFEVLEPHNVRMICQ
1943 :     GASPHNLCVLVAESEAAQVVSALHQNLFEGSL
1944 :     >Sone_Ab_|_CG-21
1945 :     MSLVVAKFGGTSVADYGAMNRCAEIVLGNPDCRLVVVSASSGVTNLLVELTQESINDDGR
1946 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALVSARSKATMDELLSLGEQ
1947 :     CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIALLSREHLLPLLSEQVIV
1948 :     TQGFIGADEAGQTTTLGRGGSDYSAALLAEALTASAVEIWTDVAGIYTTDPRLAPNAHPI
1949 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
1950 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
1951 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
1952 :     GASPHNLCVLVAESEAAQVVKALHENLFEGA
1953 :     >Sput_Ab_|_CG-21
1954 :     MSLVVAKFGGTSVADYGAMNRCADIVLANPDCRLVVVSASSGVTNLLVELTQEAITDDAR
1955 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMALLSEALVSVRSKATIDELLSLGEQ
1956 :     CSSALFSAVLREKGASSSAFDVRKVLRTDSHFGRAEPQVEQIALLSYEHLLPLLSEQVIV
1957 :     TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAHPI
1958 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
1959 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
1960 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
1961 :     GASPHNLCVLVAESEAAQVVKALHENLFETA
1962 :     >SHEW-3b_|_CG-21
1963 :     MSLVVAKFGGTSVADYGAMNRCADIVLGNPDCRLVVVSASSGVTNLLVELTQESMNDDGR
1964 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALASQRSKATMDELLSLGEQ
1965 :     CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIAILSREHLLPLLSEQVIV
1966 :     TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALKASAVEIWTDVAGIYTTDPRLAPNAHPI
1967 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
1968 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
1969 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
1970 :     GASPHNLCVLVAESEAAQVVKALHENLFEGA
1971 :     >ENTE-2a_|_CG-21
1972 :     MTSFVVAKFGGTSVADYAAMNRSADVVLADPDTRLVVLSASAGVTNLLVALSEGLEATER
1973 :     FVKLDALRKIQFDILERMQNPHVIREEIERLLENITTLAEAASLATSTALTDELVSHGEL
1974 :     MSTLLFVEILRERDVMAQWFDVRKVMRTSDRFGRAEPDVATLSELSKQQLAPRLAEGIVI
1975 :     TQGFIGSEAKGRTTTLGRGGSDYTAALLGEALYATRVDIWTDVPGIYTTDPRVVPAAKRI
1976 :     DVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPKAGGTLVCKNTVNPPLFR
1977 :     ALAMRRKQTLVTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSIALTLDTTGSTS
1978 :     TGDTLLTQSLLMELSALCRVEVEEDLALVAIIGNKLSRACGVGKEVFGVLDPFNIRMICY
1979 :     GASSYNLCFLVPGHEAEQVVQKLHHNLFE
1980 :     >Patr_Aa_|_CG-21
1981 :     MSATEVSANANATVIAKFGGTSVADFDAMNRSADVVLSNPNVRVVVLSASAGITNLLVAL
1982 :     AEGQTQETRAEHLAKIRQIQYAIIDRLTNQSVIRDEIDRMLDSVTTLSEAAALATSNALT
1983 :     DELVSHGELMSTLLFVEILRQRDVIAEWFDVRKIMRTDDHFGRAQPDCDVLGELTRSLLQ
1984 :     PRLEQGLVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALNVNRIDIWTDVPGIYTTDP
1985 :     RVVPTAKRIDQIMFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPAAGGTLVCN
1986 :     KTENPPLFRALALRRKQTLLTLHSLNMLHTRGFLAEVFSILARHNISVDLITTSEVNVAL
1987 :     TLDTTGSTSTGGSLLSSALLTELSSLCRVEVEENLSLVALIGNKLSQACGVGKEVFGVLE
1988 :     PFRIRLICYGASSNNLCFLVPGDDAERVVQTLHRSLFE
1989 :     >Ecol_Aa_|_CG-21
1990 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
1991 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
1992 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
1993 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
1994 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
1995 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
1996 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
1997 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE
1998 :     >Plum_Aa_|_CG-21
1999 :     MSAVSSQCPEIGGHVVAKFGGTSVANFDAMNNSADIVLANKAVRVVVLSASAGITNLLVA
2000 :     LAAGCDADKRADYLKQIHSIQYAIIDRLHESDTIRQEIDRLLENIKTLAKAASLATSAAL
2001 :     TDELVSHGELMSTRLFTELLRQRGKDAEWFDIRKVMYTDESFGRAEPNYEQLQSLATEHL
2002 :     LPQLKNSLIVTQGFIGREENGRTTTLGRGGSDYTAALLGEALGLKRVDIWTDVPGIYTTD
2003 :     PRVVPAAQRIDKIAFDEAAEMATFGAKILHPATLFPAIRCGIPVFVGSSKNPQAGGTLVC
2004 :     DTTEAPPQFRAIALRQKQTLLTLHSLKMLHAQGFLAEIFTILSRHNISVDLITTSEVNVA
2005 :     LTLDTTGSTSTNGSLLTNALMTELSTLCRVEVEEDLALVAIIGNQLSQTNGLGKKVFSVL
2006 :     EKFNLRMISHGASNHNLCLLVQGKDAEQIVQTLHQRLFE
2007 :     >Sent_Na_|_CG-21
2008 :     MTEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGMEPGER
2009 :     FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
2010 :     MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
2011 :     TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
2012 :     DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
2013 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
2014 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
2015 :     GASSHNLCFLVPGDDAEKVVQKLHQNLFE
2016 :     >Styp_Aa_|_CG-21
2017 :     MTEIVVSKFGGTSVADFDAMNRSADIVLSDTNVRLVVLSASAGITNLLVALAEGMEPGER
2018 :     FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
2019 :     MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
2020 :     TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
2021 :     DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
2022 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
2023 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
2024 :     GASSHNLCFLVPGDDAEKVVQKLHQNLFE
2025 :     >Sboy_Aa_|_CG-21
2026 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
2027 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
2028 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNDGLVI
2029 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
2030 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
2031 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
2032 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
2033 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE
2034 :     >Sdys_Aa_|_CG-21
2035 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPSER
2036 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLTEAAALATSPALTDELVSHGEL
2037 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
2038 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
2039 :     DEIAFAEAAEMATFGAKVLHPATLLPTVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
2040 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
2041 :     TDDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
2042 :     GASSHNLCFLVPGEDAEQVVQKLHFNLFE
2043 :     >Sfle_Aa_|_CG-21
2044 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
2045 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
2046 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
2047 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
2048 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
2049 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
2050 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
2051 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE
2052 :     >Sson_Aa_|_CG-21
2053 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
2054 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
2055 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
2056 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
2057 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
2058 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
2059 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
2060 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE
2061 :     >Sglo_Aa_|_CG-21
2062 :     MSNNSAVPLRVAKFGGTSVADFDAMDRSADIVLANPSVRLVVLSASAGVTNVLVTLSEGN
2063 :     EAERRAYYLDEIRRIQYSIIDRLAEQTVIREEIDRMIDNIAMLAEAAGLATSLALTDELV
2064 :     SHGELMSTLLFVEVLRQRGVPAAWFDVRKVMRTNDQFGRAEPDSHALKAQARTLLLPRLE
2065 :     TELVITQGFIGSEAKERTTTLGRGGSDYTAALLGEALEAGRIDIWTDVPGIYTTDPRVVP
2066 :     TAKRIDEISFEEAAEMATFGAKILHPATLLPAVRSAIPVFVGSSKDPGAGGTLVYNHTDN
2067 :     PPLFSALALRRRQTLLTLHSLNMLHARGFLAEVFNILARHAISVDPITTSEVSVALTMDT
2068 :     TGSTTTCASLLTQALLTELSSLCRVEVEEDLALVALIGNKLSQACGVGKEVFGVLDPFNI
2069 :     RLICYGASSHNLCLLVPGHDAEQVVRTLHSALFD
2070 :     >Ypes_Aa_|_CG-21
2071 :     MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
2072 :     VALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
2073 :     ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
2074 :     LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
2075 :     TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPMFVGSSKDPAAGGTL
2076 :     VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
2077 :     VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
2078 :     VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
2079 :     >Ypse_Aa_|_CG-21
2080 :     MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
2081 :     VALADGSEPEKRADHLEEIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
2082 :     ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
2083 :     LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
2084 :     TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPVFVGSSKDPAAGGTL
2085 :     VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
2086 :     VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
2087 :     VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
2088 :     >Hduc_Aa_|_CG-21
2089 :     MSHFSVAKFGGTSVADFNAMNACANIVVKDNHTRVVVLSASAGITNYLVELANGCAPLRR
2090 :     VEILQNVRSVQYNIIQQLQQPEAISAEIDRLLQHISVLAESASVTTSATLTDELIAHGEL
2091 :     MSSKIFTQLLIEREIPAIWVDVRDVIATNSHHGKATPDDKKTQQQADAIVKPLLEANKII
2092 :     ITQGFIARDQQGNTTTLGRGGSDYSAALLAEVLSAKDVLIWTDVPGIYTTDPRIVPNAQR
2093 :     IATIAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPTCRPIF
2094 :     RAIALRRNQTLVTLSSLAMLHAQEFLASVFSILAKYQVSVDIITTSEVSITLTLDKTDST
2095 :     ASTAQILSDALVHELSQFCHIKIENDLSLLAIIGNDLHLQQGIAKELFQTIEPFNIRLIN
2096 :     YGASTNNIYMLVKNSDADHILLALHYDLFES
2097 :     >Msuc_Aa_|_CG-21
2098 :     MANLSVAKFGGTSVANYAAMTACAKIVIADPNTRVVVLSASAGVTNLLVALANGCEATQR
2099 :     AKLLAEVRQIQENILNELKDAGTVRLEIEELLTNIEYLAEAASLATSSALTDELISHGEM
2100 :     MSTKIFVQVLRELNAQATWVDVRTVVATNSNFGKAAPDDEQTQKNSDNVLKPLIDRGELV
2101 :     ITQGFIGRDPNGKTTTLGRGGSDYSAALIAEVLNAKDVLIWTDVAGIYSTDPRIVPNAQR
2102 :     IDTMSFAEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
2103 :     RAIALRRDQTLLTLSSLNMLHAQGFLANVFNILAKHKISVDTITTSEVSVALTLDKTGSA
2104 :     SSGAELLSSDLLNELSEVCTVKVDTGLALVALIGNDLHLSAGIAKRIFGTIEEYNIRMIS
2105 :     YGASTNNICTLVHSAHADDVVRALHKELFE
2106 :     >Pmul_Aa_|_CG-21
2107 :     MSHLSIAKFGGTSVANYAAMSASAKIVVNDPNTRVVVLSASAGVTNLLVALANGCDNEER
2108 :     TKLINEVRQIQENILSELKDDSLVRNKVEKLLANIESLAEAASLATSPALTDELISHGEM
2109 :     MSSLIFVEILREFNTPSTWIDVRNIIATDSHFGKAVPNDHKTQENSTHILKPLIDRGELI
2110 :     ITQGFIGRDEQGKTTTLGRGGSDYSAALLAEVLNAEDVLIWTDVAGIYTTDPRIVPNAKR
2111 :     IDTMSFSEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEAGGTWVTRDPQHRPIF
2112 :     RAIALRRDQTLLTLSSLNMLHAQGFLANVFTILAKHKISVDVVTTSEVSIALTLDKTGSA
2113 :     SSGLSLLSSALIDELSQLCSVKVDSDLALVALIGNDLHITSGIAKRIFDTLAPYNIRSIS
2114 :     YGASTNNVCLLVTNAHADAVVSALHKNLFE
2115 :     >Aple_Aa_|_CG-21
2116 :     MSHLSVAKFGGTSVANFDAMTSCANIVTSDANTRVVVLSASAGVTNYLVELANGCEKERR
2117 :     EEILDAVRTIQYNIIEKLQNQSEVSAEIDELLQHIAALAESASLATSNALTDELICHGEM
2118 :     MSTKIFTQLLKERNFPAVWVDVRDIVATNSNYGKAAPNDEKTQQQSDAIIKPLIAAGNVV
2119 :     ITQGFIGRDDEGKTTTLGRGGSDYSAALLAEVLNANDVLIWTDVPGIYTTDPRVVPNAQR
2120 :     IDTMAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
2121 :     RAIALRRNQTLLTLSSLSMLHAQGFLANVFAILAKHKISVDVITTSEVSVALTLDKTGSA
2122 :     SSGADMLSKELLDELNAYCHVQVEHDLALIAIIGNNLHTQAGVAKQLFHTIENFNIRLIS
2123 :     YGASTNNVCTLIKNDEADEVVRALHAGLFE
2124 :     >Ftul_Aa_|_CG-21
2125 :     MSEIIVAKFGGTSVANQQAIRQCANIVNSDNRIKLVVVSAQSGITNLLIQLANNKDNSKI
2126 :     QEIIGQIESIVNPISQSINSESVTTSVSNMIAELRMFANMAAYFSGKQLSDSILAFGEII
2127 :     SSFLVANIFNQKGINAYHLDSRKILKTNSHFGCASPDLSALATNAIEHILPKIREGYVCV
2128 :     LGGFIGSDAHGNTTTLGRGCGDYSAALYTQAIKASQLKIYTDVTGIYQIDPRVIPRAISL
2129 :     SKLGFSEAAELATFGAKVVHPKTFGPAISSNFDIYIGSTFQPELGGTLITQKIDYDRNII
2130 :     AVAERKAQTLLTIKSFNMFGSQGFLVKVFSILANHNIAVDLVSTSEVSVAITLDKLGSHS
2131 :     MGDDLVTPELLKDLESIGNVNIKVENDLSLVSVVGSNLHQINGVSGELFNSLKDYNIRLF
2132 :     SHGASENSICMLVASKDAQKVVNNIYGSFFS
2133 :     >Ppro_Bc_|_CG-21
2134 :     MSLVDSYVNPYTSLTVAKFGGTSVADFTAMSRSAAIILHAPQTRLVLISACSGVTNILVE
2135 :     LANGVTDTQQRHALLTRLTDIHQSVLSQLKQPQQADEAITLLLKNVAELAKKAAIEKSVA
2136 :     LTDQLVSHGELLSTHLFAQILRELGIKAIRFDIRDVMRTDGQFGKAIPQPSIIRQLSEQH
2137 :     LLPQLKKHVVVSQGFIGSDEQGNTTTLGRGGSDYSAALMAEAIGASTLEIWTDVPGMYTT
2138 :     DPRIATKAKPIKEISFSEASEMANFGAKILHPSTLVPAIRQQIPVFIGSSKAPEQGGTWI
2139 :     RETVSDAPLFRALALRCNQTMVTLTSLNMFHAYGFLAEVFRILAEHKISVDLITTSEVSV
2140 :     SLTLDQTDTSGGAPTLPAQALAELSELCRVEVEQDLCLVALIGNQMSSTKGSAKTVFSTL
2141 :     EYYNLRMICYGASPHNLCFLVKAQDAKSAIKDLHCAIFE
2142 :     >Vcho_Fb_|_CG-21
2143 :     MLYKKHSLHNIGRWVTNNSFFRKSGRIAVSTFNVAKFGGTSVANFEAMSRCSAIIENNPQ
2144 :     TRLVVSSACSGVTNLLVELANGVASTERRQAILQQLADIHYVIIDQLADPTRVEKEVKAV
2145 :     LDSVASAAEAASFQSSKKLTDHLVACGELISTYILTQLMRERGVDAVRFDIREVLRTDDH
2146 :     YGRAEPQLKEIAQLAKEKLVPLCEQYVVVTQGFIGSDAQGNTTTLGRGGSDYSAALIAEA
2147 :     VQASGLEIWTDVPGIYSTDPRIAPKAAPIPEISFSEASEMANFGAKILHPSTLLPAVRHG
2148 :     IPVFVGSSKEPEKGGTWIRKQVESAPLYRALALRCNQTMVTLRSAQMFHAYGFLAKVFEI
2149 :     LAKHKISVDLITTSEISVSLTLDKTDTSGGAPELPEAVRAELEELCTVEVEYNLCLIALI
2150 :     GNKMKESRGYAKQVFSVLEDYNLRMICYGASAHNLCFLLHESVSKQAVQKLHKELFEQE
2151 :     >Vfis_Ab_|_CG-21
2152 :     MNPINVAKFGGTSVANFEAMTKSASVIEQNPNTHLVVISACSGVTNLLVELANGVQDNHR
2153 :     KKAILEGLKTIHFSVLDQLADPLIPEQAILDILDDIEKTAETAASQSNDKLTDHLVSCGE
2154 :     LMSTHLFTQLLIERGNPAVRFDIRTVLRTDSRFGKGEPQLNDISRLAQKKLTPLCQQQIV
2155 :     VTQGFIGSDSEGNTTTLGRGGSDYSAALIAESVDACGLEIWTDVPGIYTTDPRIAPKASP
2156 :     IPEISFSEASEMANYGAKILHPSTLLPALRHQIPVFVGSSKEPEKGGTWIKEKVDSTPLF
2157 :     RALTLRCNQTMVTLHSPSMFHAYGFLAEVFKILAKYQISVDLITTSEVSVALTLDQTNTN
2158 :     GKAPELPLEAQQELEELCTVEVEHNLCLIALIGNKMSHSKGSAKQVFGTLEEFNLRMICY
2159 :     GASQHNLCFLLHESESKQAVKILHKELFEQ
2160 :     >Vpar_Ab_|_CG-21
2161 :     MSAFNVAKFGGTSVANFEAMSRCATIIENNPNTRLVVSSACSGVTNILVELANGVQDQEH
2162 :     RAELLKNLAEIHDSILAQLEDATEASSEVYGILDTVTSLAEAASIQANTKLTDHLVACGE
2163 :     LMSTHILAQLMRERGINAVRFDIREVLRTDDNFGRAEPNVEAIAQLAQEKLIPLCLDSVV
2164 :     ITQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAPKASP
2165 :     IPEISFSEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHQVESSPLF
2166 :     RALALRCNQTMVTLRSANMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDQTDTS
2167 :     GGAPQLPQAAREELEELCKVEVEHDLCLVALIGNKMSERKGYAKQVFGTLEDLNLRMICY
2168 :     GASPHNLCFLVNESVAKQAIQKLHTELFEQ
2169 :     >Vvul_Ac_|_CG-21
2170 :     MSALNVAKFGGTSVANFEAMSRCSAIIENNPETRLVVSSACSGVTNLLVELANGVQSQER
2171 :     RAELLAQLAEIHDAILNQLEDATEAAAEVYAILDTITSLAEAASIQASNKLTDHLVACGE
2172 :     LMSTHILAQLMRERGVNAVRFDIREVLRTDDNFGRAEPDVAKIAELAQEKLLPLCRDYVV
2173 :     VTQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAAKAAP
2174 :     IPEISFAEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHEAQSSPLF
2175 :     RALALRCNQTMVTLRSAKMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDKTDTS
2176 :     GGAPELPQAAREELEELCTVEVEHNLCLVALIGNHMETKGYAKEVFSTLGDFNLRMICYG
2177 :     ASDHNLCFLVDAHDSKSVIQKLHQDLFER
2178 :     >Cmur_Aa_|_CG-22
2179 :     MFKEKKAPLVCKFGGTSVGTSSSIQRVCEIIRKEKPSFVVVSAVAGVTDLLEEFCRAPVG
2180 :     QKSQFTAMIREKHESIAKELGIDVAIEPFLGPLKQFEGAGHLQQEDQAKILAIGEDLSAS
2181 :     LICSYCRANSLQLEQLEARQVILTDSQFLRAEPDLALMQTMWGELVLKENTIYLMQGFLG
2182 :     ATASGATTVLGRGGSDFSASLVGELCEARELRIYTDVRGVHTADPKILKDTQLIDFLTFE
2183 :     EMQELASSGSKVLHQDMLKPCIRAKVPIFVTSTFDLTKEGTWICASLNEGVEGPEIKALS
2184 :     LKANQALWFVEYHSPLMRLENVLRCVRGLGSIPGVVMAQNSGVYFTVDWEENNQSMTEAL
2185 :     REFGAVSCEGPVSLVALVGAKLTSWSMTGVFDALQGTPVLYWSQTDTVINLIINEESGVV
2186 :     VTKLLHDYVLGLNRSGL
2187 :     >Ctra_Aa_|_CG-22
2188 :     MLRQETAPLVCKFGGTSVGTAQSIRRVCEIIQEERPSFVVVSAVAGVTDWLEEFCRLPKG
2189 :     KRAALTEKIRERHESIAKELGIEVSLAIFWEILEHFEDVEELFSEDQARILAIGEDLSST
2190 :     LICSYCCTYVLPLKRLEARQVILTDSQFLRAVPDLALMQTAWGELALQEDTIYLMQGFLG
2191 :     ATSSGKTTVLGRGGSDFSASLIGELCKARELRIYTDVCGVHTADPKILKDTQLIDSLTFE
2192 :     EMQELASSGAKVLHQDMLKPCVRAKVPIFVTSTFNVTKEGTWICASLNESTEGPVIKALS
2193 :     LKSNQALWFVEYNSPLVRLEDVLGCVRSLGFVPGVVMAQSLGVYFTIDWEEYPQTITKAL
2194 :     EAFGTVSCEGPLSLVALVGAKLASWSMSRVFEALHRTPVLCWSQTDTVINLIINKDFGVA
2195 :     VTELLHDCLFK
2196 :     >Cabo_Aa_|_CG-22
2197 :     MPPVVYKFGGTSLGTAESIRKVYDIVHKDTPWFIVVSAVAGITDLLDMFCSVSSEYREHI
2198 :     ILDIANKHNEIIHDLQLTFSIAPWMEKLQRCMHKEKISLRDRAEILAIGEDISASLFHAF
2199 :     CCSHDFSLEFLEARTVILTDGEYSCATPDIPRMRENWHALNFRSDVCYITQGFIGANAAG
2200 :     ETTLLGRGGSDYSGALIAEMSHAKEVRIYTDVNGIYTMDPRIIEDAQLIPELSFEEMQNL
2201 :     ATFGAKILYPPMLSPCVRSGIPIFVTSTFDLSKGGTWIYAMDKIMSHEPRVKALSLRQHQ
2202 :     RLWSIDCSGSSTVGFDKILSILDTHHVLPGLITSQDSTVSFTTDDDDVSDDVIRELYDQL
2203 :     SSIGTVHMLYDLALITMIGSGLASTKVVTTVTEKLRHYPSPIFCCCQSCMALSLVVPENL
2204 :     AGNVVEQLHNDYVKQKFSVV
2205 :     >Ccav_Aa_|_CG-22
2206 :     MSPVVYKFGGTSLGTAESIRKVYAIVCKNTPRFIVVSAVAGITDLLDMFCCVSSEYREQI
2207 :     VLDIAKKHDEIIHELQLAFSLSPWIEKLNKWVDKKEISLGDRAEILALGEDISASLFQAF
2208 :     CHSNNFPIEFLEARTVILTDDEYHRATPDISRMRENWHTLNLKGDACYITQGFIGASTSG
2209 :     KTTVLGRGGSDYSGALIAEMSCAEEVRIYTDVNGIYTMDPRIIEDAQLIPELSFEEMQNL
2210 :     ATFGAKILYPPMLSPCVRAGIPIFVTSTFDVSKGGTWIYAMDKTVSYEPRVKALSLRQHQ
2211 :     RLWSVDCGILGAVSLDKILPILDTYRILPGLITSQDAKVSFTTDDDDISEEIIQDLYSQL
2212 :     SNIGTVHMLYDLALITMIGSGLASTKVVTTVTDKLRNYPAPVFCCCQSCMALSLVVPENL
2213 :     AGSIVEQLHNDYVKQKFSVV
2214 :     >Cfel_Aa_|_CG-22
2215 :     MLPVVYKFGGTSLGTAESIKKVYDIVCKNTPRFIVVSAVAGITDLLDLFCAVSRESREQI
2216 :     IFDIAKKHNEIIRDLQLIFSISPSMERLYNCVDKEEISPSDRAEILALGEDISASLFQAF
2217 :     CRSNNFSLEFLEARTVILTDDEYDRATPDVFRMHSNWQTLNLQRDVCYITQGFIGANSSG
2218 :     KTTLLGRGGSDFSGALIAEMSNAREVRIYTDVNGIYTMDPRIIKDAQLIPELSFEEMQNL
2219 :     ATFGAKILHPPMLSPCVRAGIPIFVTSTFDVSKGGTWIYAMDKIVGYEPRVKALSLRLHQ
2220 :     RLWSVDCGNLGAASLDKVLSILESYRVFPGLITSQDSAVSFTTDDDDVSDNVIRDLYGQL
2221 :     SSIGSVHMLYDLALITMIGSGLASTKVVTTVTEKLRNYLSPVFCCCQSCMALNLVVPENL
2222 :     AGSIVEQLHNDYVKQKFSVV
2223 :     >Cpne_Aa_|_CG-22
2224 :     MSKIVYKFGGTSLATAENICLVCDIICKDKPSFVVVSAIAGVTDLLVDFCSSSLREREEV
2225 :     LRKIEGKHEEIVKNLAIPFPVSTWTSRLLPYLQHLEISDLDFARILSLGEDISASLVRAV
2226 :     CSTRGWDLGFLEARSVILTDDSYRRASPNLDLMKAHWHQLELNQPSYIIQGFIGSNGLGE
2227 :     TVLLGRGGSDYSATLIAELARATEVRIYTDVNGIYTMDPKVISDAQRIPELSFEEMQNLA
2228 :     SFGAKVLYPPMLFPCMRAGIPIFVTSTFDPEKGGTWVYAVDKSVSYEPRIKALSLSQYQS
2229 :     FCSVDYTVLGCGGLEEILGILESHGIDPELMIAQNNVVGFVMDDDIISQEAQEHLVDVLS
2230 :     LSSVTRLHHSVALITMIGDNLSSPKVVSTITEKLRGFQGPVFCFCQSSMALSFVVASELA
2231 :     EGIIEELHNDYVKQKAIVAT
2232 :     >Hmar_Aa_|_CG-23
2233 :     MRVVAKFGGTSLGSGDRINRAADSIAAAVQQGHEVAVVASAMGNTTDELLEEINYDADSA
2234 :     DRAEIVSMGERTSVRMLKGALAARGIEAVFLEPGSEDWPIITDEYGEVDVEETQKRAHAL
2235 :     AGQLKDVVPVITGFLAQDYQGNVTTLVRGGSDTSAVMMGDYMDADEVVIVTDVEGVMTGD
2236 :     PRVVEGARNVGKISVDELRSLSFRGAEVVAPSALSYKSEDLGVRVVHYQHGDLLSGGTSI
2237 :     EGEFQNLIDLQEQPIACVTVAGRAIRNSPGILADLSGAIADEDINIEANSSGMDSLTFYV
2238 :     DEDDAEEAEALLHARIVDDETLSSVTVEDEIAVIRVTGGDPSQSALAHQVVAPLADAHIH
2239 :     LYDVITSATSVSVFVPWEDREQALSLVQDVF
2240 :     >HALO-10a_|_CG-23
2241 :     VRVVTKFGGTSLGSGDRVERAADSIADAVAAGHEIAVVASAMGNTTDELLDDITFDADEP
2242 :     DRAEIVSMGERTSVRMLKAALAARGVDATFLEPGTTDWPIVTNERGEVDADATAAGVDRL
2243 :     AGRLGDTVPVITGFLAEDPQGNVTTLGRGGSDTTAVMLGRYLDADEVVIVTDVEGIMTGD
2244 :     PQVVEGARNVGRITVDELRNLSFRGAEVIAPSALSFKDDALDVRVIHYQHGDLLSGGTRI
2245 :     EGTFESMIDMRDSPLACLTVAGRAIRNRPGITSALSTALSDSDINVDAVASGMDSMTFYV
2246 :     DESVAERAENILHQEVIAVSELSSVTVTDDIAAIRVLGGELPNRPGVLCRIIDPLADRNI
2247 :     NVIDIISSATSVAVFVSWADREPALDVVQNGFGS
2248 :     >Hwal_Aa_|_CG-23
2249 :     MRIVTKFGGTSLGNGDRITRAADSIAAAIDAGHEIAVVASAMGSTTDYLLDEIHYDAADK
2250 :     DRAEIVSMGERTSVRMLKGALSARGVTAQFLEPGSDDWPIITNERGEVDVGETQRRAADL
2251 :     ASNLDDVVPVLTGFLAESHDGTTTTLGRGGSDTTAVMLGHYTDADEVVIVTDVEGVMTGD
2252 :     PRVVEGARNVGQITVDELRNLSFRGAEVVAPSALTYKNDDLGVRVVHYQHGDLLTGGTLI
2253 :     EGEFENLIDMQEDMLACVTVAGRSIRNSTGILADLSQSLRDDGINIDAVASGMDSITFYI
2254 :     SEDIASKAENLLHAKVINNQTLSSVTVDDGIAVIRVTGGELPNRPGVILDIVRPIAEAGI
2255 :     NIRDVITSATSVAVFVAWDDREETLSIVQSKF
2256 :     >Npha_Aa_|_CG-23
2257 :     MRVVAKFGGTSLGNGDRVNRAADSIAAAVEEGHEVAVVASAMGSTTDFLLDAIEFEADEA
2258 :     DEAEIVSMGERTSVRMLKAALGARDINAKFLEPGTEEWPVITDEHGEVDVEATQRRAKQL
2259 :     AADMAAEGYVPVITGFLAQDHAGNVTTLGRGGSDTTAVMLGNYMNADEVVIITDVEGVMT
2260 :     GDPRVVEGARNVGEITVDELRNLSFRGAEVVAPSALSYKTADMIVRVAHYQHGDLLDGGT
2261 :     TIEGQFQNLIDMREEPLACLTAAGRAIRNTPGILSDLSTELSEADINVDAVASGMDSVTF
2262 :     YVDAEVAEEAETVLHQAVIDLDELSSVTVDDDIAVIRITGGELPNNSGILEDIINPLADA
2263 :     HINVLDLVTSATSVAVFLEWDDREDALEIIQDAV
2264 :     >Msmi_Aa_|_CG-23
2265 :     MDLIVAKFGGTSVGDGSRIRKAAQSVVNEYMKGNQLVVVVSAVNNATDELIELSNEAIGG
2266 :     GLTDKQKAEIMAMGELTSSRLFAAAIESLGVKAEFIDPYNDKWPVITDSNSLNAKIDFAT
2267 :     TDKKCEGIKNLISQGIIPVICGFLGKGPSGEITTIGRGGSDVTAFLLGHCLSANNVVIVT
2268 :     DVDGVMSTDPNKIEEAELLDEISVEEMRDLATHGAQVLHPHALKYKDPLISAKIINFNNG
2269 :     DLSSEGTKITGPFEGDMLKTVSLYKNPISVIAIVGEEMLKKVGLLADLTSCLAENEINIF
2270 :     GISAGQNSITVFVEKKDSDKAYHLLHSWVIDEDVLSSLSLGDDTAMITVVSPEFIDEPGI
2271 :     ISNITNPLRKNDINIVEISSSQTAVVLFVDWKDGEKALELIKEVLK
2272 :     >Msta_Aa_|_CG-23
2273 :     MGIVVAKFGGTSVGSGERIYKAANSVVNEYMQGNQVVVVVSAINKTTDESIKLVNESIGE
2274 :     LVTEKQLAGILSMGEMQSVRIMAATIESLGVKAEFIDPFSEKWPVITDSNYLNAKIDKKE
2275 :     TQKRVTKYIKKLLNQGIIPVVCGFLGCDVDGSVTTLGRGGSDVSAFLIGHCLGADEVVIV
2276 :     TDVKGVMSTDPRKLNTARKLDKITVEEMIDLANYGAQVLHPNALRYKDPNIKAKIISFEY
2277 :     GDLRVQGTDIIGPAHEEYDVITITKCDDKLSVLAVVGENLMNQQCIIAQITQKVCENKLN
2278 :     IYGISTGESSITLFFKEDEAIKAHEKLHDLVIGGDTLSSISLGQKIAMISVVSHDFIDTP
2279 :     GIIASITKPLHENEINIVELSSSQTAVVVFVDWNDGDKAYDLIKETLQ
2280 :     >Mthe-5_Aa_|_CG-23
2281 :     MELIVAKFGGTSIGNGRRIKKAARSVVKEYMKGRKVVVVVSAINKTTDELLQIVDEAMED
2282 :     AVTEKQLAEIVSMGEMTSVRIFSSAIEALGVKSEYIDPFMDEWPIITDSNLLNAKVDFEA
2283 :     TEEKSRELLKLLDQGIIPVVCGFLGRDPNGYITTLGRGGSDITAFLLGHCLKADEVIIVT
2284 :     DVGGVMSTDPNKLQGAKKLDKISVEEMRDLATHGAQVLHPHALKYKDPDIKAKIIGFEHG
2285 :     DLSAPGTEIIGPSKNKMVKTTTLNPDPISVVAVVGEKILNKPGILARLTSRLAENSINII
2286 :     GISTGQNSVTIFVDKKDADEAHRLLHDVVIADDDLSSLSLGRDIAMITISSPDFIDTPGI
2287 :     ISEITKPLRDNDLNIVEISSSQTSVVIFVDWNDGKKAYELVRGVLE
2288 :     >Bant_Ab_|_CG-24
2289 :     MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
2290 :     QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
2291 :     MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
2292 :     EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
2293 :     EGTLIAAYDGATKGQDVEERPVTGIAHVSNVTQIKVLAKETAYDIQQHVFKEMANEGISV
2294 :     DLINISPTGVAYTVNDNVSARAVEVLKQLGYEPIVTEHCAKVSIVGAGMAGIPGVTAKIV
2295 :     TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
2296 :     >Bcer_Ab_|_CG-24
2297 :     MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
2298 :     QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
2299 :     MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
2300 :     EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
2301 :     EGTLISASDGATKGRDVEERPVTGIAHVSNVTQIKVLAKETAYDLQQHVFKEMANEGISV
2302 :     DLINISPTGVAYTVSDNVSNRAVELLQNLGYEPIVTEHCAKVSIVGAGMAGYPGVTAKIV
2303 :     TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
2304 :     >Bcla_Aa_|_CG-24
2305 :     MKIIIQKFGGTSVKTDESRLQAVRHVQKAVNDGYKVVVVVSAMGRKGDPYATDTLLSLVS
2306 :     KSRITKREQDLLVSCGETISAVVFSDLLNAHGVQATAMNGAKAGFRTNEEFGNAKIKEMK
2307 :     CEHLLKKLETEDVVVVAGFQGQSKSGDVTTLGRGASDTSATALGAALHAEWVDIFTDVEG
2308 :     VMTADPRIVSDARALEAMSYNEICNMAYQGAKVIHPRAVEIAMQAKIPIRIRSTYSDNEG
2309 :     TLVTALGASHSMDVNERMITGIAHVANVTQIKVAAKEGQLDLQENVFKSMAQAKISVDFI
2310 :     NISPSGVTYTVSDEAADKAKQVLEHLGYTPELRRGCAKVSAVGAGMSGVPGVAAKIVSAL
2311 :     SGENVQILQSADSHTTIWVLVKNEDMKKAVNALHKMFQLSEATTV
2312 :     >Bhal-1_Ab_|_CG-24
2313 :     MKIIIQKFGGTSVKTAEVREMAAKHVEKAVEGGYKVVVVVSAMGRSGDPYATDTLLQLVD
2314 :     TKTIAKREQDLLVSCGEIISSVVFTELLLKKGIQATAMTGAQAGFRTNEEFTNAKIVDMK
2315 :     VDRLKKTLVHQDVVVVAGFQGQSPTGETTTLGRGGSDTSATALGAALDAEWVDIFTDVEG
2316 :     IMTADPRIVSEARPLDTMTYNEVCNMAYQGAKVIHPRAVEIAMQAKIPIHIRSTYSDGKG
2317 :     TLVTSMLTEAGARDVQDRIITGIAHMSGVTQIKVHAKDGEFDLQEKVFRAMAAEKISVDF
2318 :     ININLTGVVYTVMDEVADRAIEVLRELGFDPEVKRHCAKVSAVGAGMTGVPGVTAKIVAA
2319 :     LSQENIRILQSADSHTTIWVLVSEDDLTKAVNALHRMFHLEQSEQTKQKQV
2320 :     >Blic_Aa_|_CG-24
2321 :     MKIIVQKFGGTSVKDDRGRKLALNHIKEAVNEGYKAVVVVSAMGRKGDPYATDSLLDLLY
2322 :     GGQDTITEREQDMLLSCGETISSVVFASMLLENGIKAAALTGAQAGFLTDNNHTNAKILE
2323 :     MKPERLVSMLADHDAVVVAGFQGATAKGDITTIGRGGSDTSAAALGAALDAEFIDIYTDV
2324 :     EGVMTADPRIVEKAKPLPVITYTEICNLAYQGAKVIHPRAVEIAMQAKVPIRVRSTYSNE
2325 :     TGTLVTSHHNSKAGSDVFERLITGIAHVKDVTQFKVPAKEGQYNVQTEVFKAMANAGISV
2326 :     DFFNITPSEIVYTVAGNMTDRAHSILKELGYEPAVTRNCAKVSAVGAGIMGVPGVTSKIV
2327 :     TALSEKGIPILQSADSHTTIWVLVHEKNMATAVNALHEVFELSK
2328 :     >Bsub_Ab_|_CG-24
2329 :     MKIIVQKFGGTSVKDDKGRKLALGHIKEAISEGYKVVVVVSAMGRKGDPYATDSLLGLLY
2330 :     GDQSAISPREQDLLLSCGETISSVVFTSMLLDNGVKAAALTGAQAGFLTNDQHTNAKIIE
2331 :     MKPERLFSVLANHDAVVVAGFQGATEKGDTTTIGRGGSDTSAAALGAAVDAEYIDIFTDV
2332 :     EGVMTADPRVVENAKPLPVVTYTEICNLAYQGAKVISPRAVEIAMQAKVPIRVRSTYSND
2333 :     KGTLVTSHHSSKVGSDVFERLITGIAHVKDVTQFKVPAKIGQYNVQTEVFKAMANAGISV
2334 :     DFFNITPSEIVYTVAGNKTETAQRILMDMGYDPMVTRNCAKVSAVGAGIMGVPGVTSKIV
2335 :     SALSEKEIPILQSADSHTTIWVLVHEADMVPAVNALHEEFELSK
2336 :     >Bthu_Ab_|_CG-24
2337 :     MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
2338 :     QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
2339 :     MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
2340 :     EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
2341 :     EGTLIAAYDGATKGQDVEERPVTGIAHVSNVTQIKVLAKETAYDIQQHVFKEMANEGISV
2342 :     DLINISPTGVAYTVNDNVSARAVEVLKQLGYEPIVTEHCAKVSIVGAGMAGIPGVTAKIV
2343 :     TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
2344 :     >Gkau_Aa_|_CG-24
2345 :     MKLIVQKFGGTSVRDERGRNLARRHIERALEDGYKVVAVVSAMGRCGDPYATDTLLSLIG
2346 :     GVHHHVTKREQDMLMACGEIISSVVFSNLLNEHGIKATAFTGAQAGFCTNSDHTNAKILE
2347 :     MRCDRLLEALRQYDVVVVAGFQGMAENGDITTLGRGGSDTSAAALGAALNAEWVDIFTDV
2348 :     DGVMTADPRIVESARPLDVVTYTEICNMAYQGAKVIHPRAVEIAMQAKVPLRIRSTYSDA
2349 :     PGTLVTSSVRGRKGSDVKERLVTGITYVADVTQIKVLAKEGHYELQSDVFQAMAHEGISV
2350 :     DFINISPYGVVYTVSGDMTEKAVAALRRIGYEPAVTPRCAKVSVVGAGIAGVPGVTAKIV
2351 :     TALSEQGIQILQSADSHTTIWVLVKQDDMEKAVNALHDAFCLSEADAGEDEAIWSEE
2352 :     >Gthe_Aa_|_CG-24
2353 :     MKIIVQKFGGTSVRDERGRNLARRHIEKALEDGYKVVVVVSAMGRNGDPYATDTLLHLIG
2354 :     GTGHHVTKREQDMLMACGEIISSVVFSNLLNEHGIKATAFTGAQAGFRTNGDHTNAKILE
2355 :     MRCDRLLEALEQYDVIVVAGFQGVAENGDITTLGRGGSDTSAAALGAALNAEWVDIFTDV
2356 :     DGVMTADPRIVESARPLEVVTYTEICNMAYQGAKVIHPRAVEIAMQAKVPLRVRSTYSDA
2357 :     PGTLVTSSVRGQKGSDVKERLVTGIAYVANVTQIKVLAKEGHYELQSDVFQAMAREGISV
2358 :     DFINISPYGVVYTVSGDMTEKAIAALRRVGYEPAVTPRCAKVSVVGAGIAGVPGVTAKIV
2359 :     TALSEQGIQILQSADSHTTIWVLVKQDDMEKAVNALHDAFCLSEEGGYEAIWNEE
2360 :     >Oihe_Aa_|_CG-24
2361 :     MQVMVQKFGGTSVQSSENREHVIRHIREALVQEYKLVVVVSALGRKPDPYATDSLLGLVD
2362 :     FPTNTNSSRELDLLMSCGEVISSVVLSNELQKNHISAVALTGAQAGFVTNEDFNRAKIKE
2363 :     VNPTRILKELETHDVVVVAGFQGQSESGEITTIGRGGSDTSAAALGVALSAERIEIFTDV
2364 :     EGIMTADPRVVKNARPLDVVTYTEICNLAYQGAKVIHPRAVEIAMQGKIPMRIRSTYSEQ
2365 :     LGTLVTSSRVHELGMDIPDRMITGIAHISPVTQIKVQTKESAYRVQSEVFKAMAEAGISV
2366 :     DFINISPTGVVYTVPDTLTTKAIEILEMLGFHPEVTKGCAKVSAVGAGMSGVPGVASKIV
2367 :     QALTDSGVQILQSADSHTTIWVLVHNDDLITAVNALHDVFGLSITEELLES
2368 :     >Linn_Aa_|_CG-24
2369 :     MKIIVQKFGGTSVQNEKIRLMAFNHIKNALKDGYKVVVVVSAIGRYGDPYATDTLLELIG
2370 :     AKDTKLTAREQDTLLSVGETISASVFTNMLREADIKAEAFSGGQAGIITSNNHLNAKITE
2371 :     VDTKRLKKALETLDVAVVAGFQGITENGDITTLGRGGSDTSAAALGVSLQADYIDIFTDV
2372 :     DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKVPMRIRSTYLES
2373 :     TGTLVTSLADDSGHFDVKERMVTGVAHVTNLTQIFVKTDTVKAQQQTFKILADAGISLDF
2374 :     INISTDSVIFTVPEEKRRVVKQLLEEANLQTTVREDCAKVSIVGAGITGVPGVTAKIVGA
2375 :     LSEKNIPILQSADSHTTIWVLVREEDLISAVNALHDVFCLEIK
2376 :     >Lmon_Aa_|_CG-24
2377 :     MKIIVQKFGGTSVQNEKSRLMAFNHIKQVLKEGYKVVVVVSAIGRYGDPYATDTLLELIG
2378 :     AKNTKLTAREQDTLLSVGETISASVFTNMLKEANIKAEAFSGGQAGIITSDDHLNAKITE
2379 :     VDTARLKDALTNLDVAVVAGFQGITANGDISTLGRGGSDTSAAALGVSLQADYIDIFTDV
2380 :     DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKIPMRIRSTYLES
2381 :     TGTLVTSLTNDSDHFDVKERIVTGVAHVTNLTQISVQTDTVKAQQLAFKILADAGISLDF
2382 :     INISTNSVIFTVPEEKSHVVKQLLEDADLQTTVRQACAKVSIVGAGITGVPGVTAKIVGA
2383 :     LSEKNIPILQSADSHTTIWVLVKEEDLISAVNALHDVFCLEIK
2384 :     >Lwel_Aa_|_CG-24
2385 :     MKIIVQKFGGTSVQNEKIRLMAFNHIKHALKDGYKVVVVVSAIGRYGDPYATDTLLELIG
2386 :     AKDTKLTPREQDTLLSVGETISASVFTNMLKEADIKAEAFSGGQAGIITSNHHLNAKITE
2387 :     VDTSRLKTALKTLDVAVVAGFQGKAKNGDITTLGRGGSDTSAAALGVSLQADYIDIFTDV
2388 :     DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKIPMRIRSTYLES
2389 :     TGTLVTSVADELGHFDVKERMVTGVAHVTNLTQISVKTDTVKAQQQAFKILADAGISLDF
2390 :     INILTDSVIFTVPEEKRLVVKLLLEEADLQTNVRENCAKVSIVGAGITGVPGVTAKIVGA
2391 :     LSEKNIPILQSADSHTTIWVLVREEDLISAVNALHDVFCLEIK
2392 :     >Lpla_Aa_|_CG-24
2393 :     MEIIVQKFGGTSVKDEAARIQALKHVQYAVDQGDKVIVVVSAIGRKGAPYATDSLLGLVG
2394 :     AEHSRLTNRELDMLVSVGETISTAVFTELARKQGLNVTAMTGHDAGIVTNDDFQNAKILR
2395 :     VDPKPITDAFIDADVVVVTGFQGATESGHVTTIGRGGSDTSAAILGAALKAKRVDIFTDV
2396 :     NGMMTADPRLVTHARFIKAISYEELANMAHEGAKVIHPRAVEIAEQAHVPMRIRSTYQEP
2397 :     DELGTLVTDRTTTQIEHYRTVTGIAHQTDLTQFTVPTDTLSSSAIFQLMAQHGLSVDFIN
2398 :     ITPHQVVFNLVDGDADVAKQLLTDAHVHCQSIANCAKVSVVGAGITGTPGVTARIVSALA
2399 :     AQHIDILQSTDSYTTIWVLVKEADLKAAMNALHDEFLGIE
2400 :     >Lsal_Aa_|_CG-24
2401 :     MKIMVQKFGGTSVQDDESRKSAMRHIEHAVNEGYKVAIVVSAIGRKGAPYATDSLLSLVG
2402 :     GERTKLTPRELDMIVSVGEVISTAVFTQMLKENGFNAVAMTGPDAGFRTNNDYQNAKVLE
2403 :     VKTDAVLDAFASHDVVVVSGFQGMSEEGHVTTLGRGGSDTSAALLAVALDAERVDIFTDV
2404 :     SGMMTADPRIVKNAHFLKTVSYDEVANMAHEGAKVIHPRAVEVAHQAHLPMRIRSTWDNV
2405 :     DELGTLVTDKNLSIEHYRTVTGIAHQTGLTQINLSVNNTEAEKIFKVLAENEVSIDFINI
2406 :     SPNQVVFNTSREDGLKAKKIFEEYNIPVNFVENCVKVSIIGGGMVGTPGVIAKMVTALSK
2407 :     TGVEILQTADSDTTVWILVTEDNFKLAVNTLHEAFLEN
2408 :     >Sthe-17_Aa_|_CG-24
2409 :     MRIIVQKFGGTSVATPEGREAVVRRVRQALDDGYATVVVVSAMGRQGDPYATDTLIQLAQ
2410 :     SAGPDLAPREMDLLLSCGEIISSVLMAATLTAAGIPAVALTGGQAGIQTDENYGNAQIVK
2411 :     VDPAPVLSRLKEGLVVVVAGFQGVNAAGEVTTLGRGGSDTTAAALGGALRAEVVEIYTDV
2412 :     DGVKTADPRLVAEARTLSVTTYDEIAQMAHYGAKVVHPRAVEIAMQHRVPIRVRSTFSDN
2413 :     PGTLITYSAEAGVIWSEPFSDRVVTAVTHVVGLAQVVVKTGRDWATPRLFRRLANAGISV
2414 :     DLISVSMESSAFSIPESRAAQAEMILTELGLVDLQVRHGCAKVTVVGSGMRGRPGVMATV
2415 :     AEALYAAEVPIWQTADSHVTISCLIPAADVQRAVQALHDAFELGRI
2416 :     >Cace_Aa_|_CG-24
2417 :     MKIIVQKFGGTSVSTPERRSFVVQKVSSAIKEGYSPIVVVSAMGRAGEPYATDTLLSLID
2418 :     NDFKETNKRASDLLMCCGEIISTVIMSNELKRAKIAAIPVTGGQAGIITDDEYSNASVKK
2419 :     VNPENLLKLLCHNEVPVVAGFQGKSQNGFFTTLGRGGSDVTASLIGCAVNAEKIEIYTDV
2420 :     DGIMTADPRIVQDAALIETISYNEVFEFAEQGAKVIHPRAVEVAMNGNIPLIIKNTLNDC
2421 :     KGTLINREGDSLNKNLITGITSLSGRVQVTTKFKDSKIKSTEFLSLLGERNINIDLINVF
2422 :     PKENIFTIDKKDLNKLKDTLIKTKVQYYLEDDCSKIAIIGNRICGVPGVMAKILKAITKE
2423 :     GIEVLQTADSHTTIWCLVKSNVRNKAINALHREFNLNNK
2424 :     >Cbot_Bb_|_CG-24
2425 :     MKILIQKFGGTSVSTAERRSLVVDKIVKAKKAGYYPVVVVSAMGRKGQPYATDTLRSLVE
2426 :     EDFLDKNTLAADLLMGCGELISTVVMSSELFNKGIDAVPLMGGQAGIITDNNFNNASVLR
2427 :     VEKDRIVDLLKKDKIPVVAGFQGKSEDGYITTLGRGGSDVTAALLGTALEAESVEIYTDV
2428 :     DGIMTADPRIVENASLIKEISYNEVFQFADQGAKVIHPRAVEIAMTSNIKLVIKNTMTDC
2429 :     KGTTINNIGIKNSNNVITGITHMSNRTQIIVDAEENKGNKNYTNLLNSLAENSISIDLIN
2430 :     VFPKEKIFTIDEKDFNEFSSIMEGLKIKFSYLKDCSKIAIIGSRMRGIPGVMAKILKALV
2431 :     ERNIEVLQTADSHTTIWCLVSKEDTEKAIKSLHCEFKLDCI
2432 :     >Cdif_Ab_|_CG-24
2433 :     MSILVQKFGGTSVESYEKMNEVCKIVKAYKKNDEELQLVLVVSAMGRKGAPYATDTLINL
2434 :     CSAVNDEPSKRELDLIMSCGEIISGTILANLLNAQGIDSVFFTGQQAGIITSDEYSNAKI
2435 :     KYINPKKVKRALDDGKVVVIAGFQGVTDDGEITTLGRGGSDTSAVAIGKALECETVEIYT
2436 :     DVDGIMTADPRVEPNAKVLSFIDYEEVFQMADKGAKVIHPRAVQLAKSGNITLAIKNTMN
2437 :     PTFEGTKIGSLCRHLEDNIEYEQERDFKVAVANKDSVAQVKIKSAEEVFTEVLNEIEKKL
2438 :     ITIDMINFFISEKAFVVEDADIKSLKEILDKFELDYEVNRDCAKVTLICSRIADEMSGIM
2439 :     SKVVRGLSKAGVSLLQTSDSNMTISCLVSEEDMHTAVHAIHQQFYLK
2440 :     >Cnov_Aa_|_CG-24
2441 :     MKILVQKFGGTSVSTSEKRKLVVKKVSNAIKAGFKPVVVVSAMGRKGDPYATDSLLGLLT
2442 :     DEFKENNSLATDLLMSCGEIISSVVMSNELNKNNINAIPLMGGQAGIHTDENFSDASVKS
2443 :     VDNANIMKILEEGKIPVVCGFQGVSEKGFITTLGRGGSDVTASLLGVALNAEQVEIYTDV
2444 :     DGIMTADPRIVKGASLIKEISYNEVFQFAEQGAKVIHPRAVEIAMKGSIPLVIKNTMSDC
2445 :     TGTTIDNIGDLNASNIITGITHMANRVQIRIKLEDNSGNENYYDLLPILAENSISIDLIN
2446 :     VFPNEKIFTIDKKDFFKFDGIMNSINVKYSHIDDCSKIAIIGSRMRGIPGVMAKILKSLV
2447 :     KEKIEVLQTADSHTTIWCLVESKYTETAINLLHEEFNLERL
2448 :     >Cper_Aa_|_CG-24
2449 :     MKIVVQKFGGTSVSTKERRTMVVEKVKGAINKGYLPVVVVSAMGRKGEPYATDTLLGLVS
2450 :     EEFKKENKLATDLLMGCGEIISTVVMSDELREAEIEAVPLTGGNAGILTDDNYSSADFID
2451 :     INPKLILEVLKEGKVPVVAGFQGVDRNGFLTTLGRGGSDTTAAVLGVALKAEEIEIYTDV
2452 :     DGIMTADPRIVGDAELINKISYNEVFQLADQGAKVIHPRAVEIAMKGNVTLVIKNTMSTC
2453 :     IGTMIDSLGDVDNNKFITGITHQGNRIQVSIKSDDNKDNINYKTILESLANNKISLDLIN
2454 :     IFPKEKVFTIDAGVKELFEDIMRKNNLKYSLVEDLSTIAIVGSRMRGIPGVMAKIVGALD
2455 :     NENIEVLQTADSHMTIWCLVESKNVREAIKALHRVFMK
2456 :     >Ctet_Aa_|_CG-24
2457 :     MKIIVQKFGGTSVSTKERRQRVVEKIIKAKNAGYSPVVVVSAMGRKGEPYATDTLLSLVS
2458 :     NELKKNNLAIDLLMSCGEIISTVVMADELLSKNIDAVPLTGGQAGILTDDNYSNASILKL
2459 :     ECDKILDVVEENKIPIVAGFQGISENGFITTLGRGGSDVTAVLLGGALKAEKVEIYTDVD
2460 :     GIMTADPRIVSDATLIKEISYNETFQFSHEGAKVIHPRAVEIAMNENIPIVIKNTLTNCD
2461 :     GTLINNISDLNLNNIITGITHTNDRTQIKIELEQNKENESYFRILDILAENSISIDLINV
2462 :     FPRESIFTIDGKDFEKFSSIMNKINLKYSHIDSCSKIAIIGNRMRGIPGVMAKIIYVLMN
2463 :     ENIEVLQTADSHATIWCLVKDIHTEKAIKALHNAFNLSNNK
2464 :     >Chyd_Ab_|_CG-24
2465 :     MAKKFIILKFGGTSLKTAELREKVAQKIINTFESGYQPVVVVSAIGRKGDPYATDTLLNF
2466 :     AYEVNRDLPPREADLLMACGEIISGVIMVNTLAKMGYKAKLFTGAQAGIITDDNFTSASI
2467 :     LKVKADKILKAVDEGFIPVVCGFQGVTEDGEVTTLGRGGSDTTAAALGVALKAEFIDIYT
2468 :     DVEGIKTADPRIVEDAKTLEVVTYNEISQLAHEGAKVIHPRAVEIAMQKNIPLRIKSTLT
2469 :     DGEGTLVTSHAEVYGEVIEVIRDRIITGIAHIPGVTQIKILREDTPEIVNLAQKVFKGLA
2470 :     LAEISVDFINISPEGLAFTVKGEVTEKAVDVLENMGFTPRIRRNCAKIAAVGAGMTGVPG
2471 :     VMAKIVEALTREQIEILQSTDSYTTIWVLVDGENMEKAVRAIHKAFKLNE
2472 :     >Dred_Aa_|_CG-24
2473 :     MRFIIQKFGGTSLVTQELRELVANKIIAAVDEGFSPVVVVSAIGRAGEPYATDTLLNFAL
2474 :     SINRDIPPREMDMLMSCGEIISGVAMANTLQRMGHQAVLLTGAQAGIITDDNFNDARIIR
2475 :     VEPQNVIKHVEQGKIVIVTGFQGICQGGDITTLGRGGSDTTASALGVALNAEYIDIYTDV
2476 :     EGIMTADPRIVEDARILDSVTYNEICQLAHEGAKVIHPRAVEIAMQKNIPLRVRSTFLDS
2477 :     PGTLVTSHHGVYGTIDITRDRLACGVTHIAGVTQLKIIAKDIAVEDPALRIFRALALADI
2478 :     SIDFINVSPELIMLTVKDEVAKKAVDVLENLSVFPQVKPNCAKVSTVGAGMTGVPGVMAS
2479 :     IIQALTEEGVEILQSSDSHTTIWVLVEKENMKKAIRALHRKFKLGQRE
2480 :     >Pthe_Ab_|_CG-24
2481 :     MKFIVQKFGGTSLVNDETRRMAAKKVIEAKNKGYLPVVVVSAIGRMGDPYATDTLLKLAC
2482 :     DGNWELSPRESDLLMSCGEVISGVVMAATIQKEGHPAVFLTGLQAGIITDNNHNDARILK
2483 :     VNPENIIKHARDGKIIVVAGFQGATENGEITTLGRGGSDTTAAALGVALDAEWVDIYTDV
2484 :     EGIMTADPRIVSDARLLEVVTYNEICQLAHEGAKVIHPRAVEIAMQKDIPLRIKSTFSSA
2485 :     PGTLVTSRGEAYKGSIDITRDRTITGITYISDITQFRIPMDGCGDTAGLQRRMFEALALA
2486 :     GISIDFINVHPDVVIFTVKNSVAAKAAQILENMGLRPSILPDCAKVAAVGAGMTGVPGVM
2487 :     ARIVGALADEKVQILQSSDSYTTIWVLVKKKDMEKSIRALHRQFGPGEKDIERR
2488 :     >Mthe-3_Ab_|_CG-24
2489 :     MKVLVQKFGGTSVASPEQRLVVTGHIERACRVGYQVVVVVSAMGRRGAPYATDTLLELLG
2490 :     DNEVEPRERDLLLACGEVISGVVLTGLLKSKDLPAVFLTGGQAGIITDAQFGDARILRVE
2491 :     PRRIQSYLDQGRVVVVAGFQGVTESGEVTTLGRGGSDTTAVALGVALGAEAVEIFTDVDG
2492 :     VKTADPHIVSDARTLSTITYNEVCQMAYEGAKVIHPRAVEIARQKNIPLRIKSTFNDGPG
2493 :     TLVVAWQPGVTGVHISRDRVITGITHMDGLTQLRVSLPSGEGAGEVFPLLAQNNISVDFI
2494 :     NIFPGELVFTVKSEVARQARELIEGLGLKVTARPGCAKVATVGAGMRGVPGVMATIVTAL
2495 :     EREGIKILQSADSYTSIWCLVDRKDMERAVQTLHREFKLNDGKTGEVKVYAVG
2496 :     >Tten_Aa_|_CG-24
2497 :     MKILVQKFGGTSVSSEEKREKAVSKVIEAVKNGYNVVVVVSAMGRNGDPYATDTLINMAK
2498 :     SIYSDIPKRELDLIMNCGEIISSVLFAATLSNKGYKAKALTGGQAGIITDDNFGNAEVIN
2499 :     VDPSRILEVLREGIIPVVAGFQGITQKGELTTLGRGGSDTTAALLGVALKAEAVEIYTDV
2500 :     DGIMTADPRIVSTAHIIDKISYNEVFQFAEQGAKVVHPRAVEIAMRGNIPLIIKNTMSDS
2501 :     GGTIITNYSDAYDSIYEVDKLVTGIANMNNRVQITIESTENVQDIFEKIGEEKISIDLIS
2502 :     IFPDKQVFTISEADFEKLRRLFEKYGVKYSYRTNCAKVSIIGNRIRGVPGVMARVIKALS
2503 :     KRNIEIYQTADSHNTISCLVSQDKVEEAIRVLHDEFSL
2504 :     >Acel_Aa_|_CG-25
2505 :     MPLIVQKYGGSSVADAERIKKVAQRIVATRKQGYDVCVVVSAMGDTTDELLDLAAQVSPM
2506 :     PPPRELDMLLTAGERISMALLAMAIANLGMEARSFTGSQAGVITDSRHGRAQIIDVTPGR
2507 :     IREALAAGHIAIVAGFQGVAQDTKDVTTLGRGGSDTTAVALAVALGAEVCEIYTDVDGVF
2508 :     TADPRIVPTARQIPRISYEEMLEMAAAGAKILHLRCVEYARRFKMPIHVRSSFSTKPGTW
2509 :     IVDIPPEEQMEAPIISGVAHERGEAKITVVGVPDKPGEAAQIFQVIADAGINVDMIVQNV
2510 :     SSTATGRTDITFTLPTSDLPTAMAALSKAKDRIGFEGLLSDDQIGKVSLIGAGMRTQPGV
2511 :     TAKFLTALADAGINVEMISTSQIRISVVIREDDLPAAVAALHRAFELDDPEGQAVVYGGT
2512 :     GR
2513 :     >Cglu_Aa_|_CG-25
2514 :     MALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGDTTDELLELAAAVNPV
2515 :     PPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLTTERHGNARIVDVTPGR
2516 :     VREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVY
2517 :     TADPRIVPNAQKLEKLSFEEMLELAAVGSKILVLRSVEYARAFNVPLRVRSSYSNDPGTL
2518 :     IAGSMEDIPVEEAVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNV
2519 :     SSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLYDDQVGKVSLVGAGMKSHPGV
2520 :     TAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEAVVYAGTG
2521 :     >Cdip_Aa_|_CG-25
2522 :     MALVVQKYGGSSLESAERIRRVAERIVATKKQGHDVVVVCSAMGDTTDELLDLAAQVNPV
2523 :     PPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVITTERHGNARIVDVTPGR
2524 :     VREALDEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVY
2525 :     TADPRIVPNAQKLEKLCFEEMLELAASGSKILVLRSVEYARAFGVPLRVRSSYSNDPGTL
2526 :     VAGSMEDIPVEEAVLTGVATDNSEAKITVLGIPDSPGSASAVFRALADAEINIDTVLQNI
2527 :     SSLEDNRTDITFTCPRADGPHAMELLRNLQAKNDWQNVLYDDQIGKVSLVGAGMKSHPGV
2528 :     TAEFCEALRDAGVNIELISTSEIRISVLIRESDVDVAARAIHEKFELGGETEAIVYAGTG
2529 :     >Ceff_Aa_|_CG-25
2530 :     MNERCARVALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGDTTDELLDL
2531 :     AAAVNPVPPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLTTERHGNARI
2532 :     VDVTPGRVREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAAALGADVCEIY
2533 :     SDVDGVYTADPRIVPNAQKLERLSFEEMLELAAVGSKILVLRSVEYARAFNVPMRVRSSY
2534 :     SNDPGTLIAGSMEDIPMEEAVLTGVATDKSEAKVTVLGIPDKPGEAAKVFRALADAEINI
2535 :     DMVLQNVSSVEDGTTDITFTCPRSDGPRAMELLKKMQQQGDWTNVLYDDQVGKVSLVGAG
2536 :     MKSHPGVTAEFMEALRDVNVNVELISTSEIRISVLIREDDLDKSAKALHEKFQLGGDEEA
2537 :     TVYAGTGR
2538 :     >Cjei_Aa_|_CG-25
2539 :     MALIVQKYGGSSLESAERIRRVAERIVETKKQGNDVVVVCSAMGDTTDDLLELAEQVNPV
2540 :     PPAREMDMLLTAGERISNALVAMAIASFGAEAQSFTGSQAGVLTTERHGNARIVDVTPGR
2541 :     VREALDEGKICLVAGFQGVNRETRDVTTLGRGGSDATAVALAAALEADVCEIYSDVDGVY
2542 :     TADPRIVPDAQKLDTISFEEMLEMAAVGAKVLMLRSVEYARAFDVPLRVRSSYSTDIGTL
2543 :     VSGSMEDIPMEEAVLTGVAHDRSEAKIAVLGIPDSPGEAAKVFRAVADAEINIDMVVQNI
2544 :     SKIDNNRTDITFTCPRTDATRAMQLLKGIKEQNDWQDLIFDDHVGKVSLVGAGMKSHPGV
2545 :     TADFCEALRDAGVNIELISTSEIRISVLIRDTDVDKAVRAIHERFQLGGDKEATVYAGTG
2546 :     >Mavi_Ba_|_CG-25
2547 :     MALVVQKYGGSSVANADRIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLMDLAQQVCPA
2548 :     PPPRELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVITTGTHGNAKIIDVTPGR
2549 :     LQAALDEGRIVLVAGFQGVSQDTRDVTTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
2550 :     SADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRYNIPVHVRSSYSDKEGTV
2551 :     VVGSIKDKPMEDPILTGVAHDRSEAKVTVVGIPDIPGYAARVFRAVADADVNIDMVLQNV
2552 :     SKVEDGKTDITFTCSREAGPTAVAKLDALKDEIGFTQLLYDDHIGKVSLIGAGMRSHPGV
2553 :     TATFCEALAQVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGAETATVYAGTG
2554 :     >Mbov_Aa_|_CG-25
2555 :     MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
2556 :     PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
2557 :     LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
2558 :     SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
2559 :     VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
2560 :     SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
2561 :     TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
2562 :     >Mlep_Aa_|_CG-25
2563 :     MALVVQKYGGSSVADADRIRRVAERIVQTKKQGNDIVVVVSAMGDTTDDLLDLAQQVCPE
2564 :     PPARELDMLLTAGERISNALVAMAIESFGAQARSFTGSQAGVITTGTHGNAKIIDVTPTR
2565 :     LQFALDEGRIVLVAGFQGVSQDTRDITTLGRGGSDTTAIAMAAALGADVCEIYTDVDGIF
2566 :     SADPRVVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYADKPGTV
2567 :     IVGSIKDVPMEDPILTGVAHDRSEAKVTIVGIPDIPGYAAKVFRAVADADVNIDMVLQNV
2568 :     SKVEDGKTDITFTCSRDSGPIAVAKLGSLRDEIGFTQLLYDDHIGKVSLIGAGMRSHPGV
2569 :     TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVFALHEAFGLGGEDEVTVYAGTG
2570 :     >Msme_Aa_|_CG-25
2571 :     MALVVQKYGGSSVADAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDLLDLARQVSPA
2572 :     PPPREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVITTGTHGNAKIIDVTPGR
2573 :     LRDALDEGQIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVAVAAALDADVCEIYTDVDGIF
2574 :     TADPRIVPNARHLDTVSFEEMLEMAACGAKVLMLRCVEYARRYNVPIHVRSSYSDKPGTI
2575 :     VKGSIEDIPMEDAILTGVAHDRSEAKVTVVGLPDVPGYAAKVFRAVAEADVNIDMVLQNI
2576 :     SKIEDGKTDITFTCARDNGPRAVEKLSALKSEIGFSQVLYDDHIGKVSLIGAGMRSHPGV
2577 :     TATFCEALAEAGINIDLISTSEIRISVLIKDTELDKAVSALHEAFGLGGDDEAVVYAGTG
2578 :     >Mtub_Aa_|_CG-25
2579 :     MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
2580 :     PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
2581 :     LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
2582 :     SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
2583 :     VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
2584 :     SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
2585 :     TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
2586 :     >Nfar_Aa_|_CG-25
2587 :     MALVVQKYGGSSVASAERIRRVAERIVETKKQGHDVVVVCSAMGDTTDELLDLAEQVAPA
2588 :     PPAREMDMLLTAGERISNALVAMAIHSLGAQARSFTGSQAGVITTGAHGNAKIIDVTPSR
2589 :     LREALDEGTIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALEADVCEIYTDVDGVF
2590 :     TADPRIVSDAQRLEQVSYEEMLEMAACGSKVLMLRCVEYARRYNVPVHVRSSYTDKPGTY
2591 :     VYGSMEDIPLEKAILTGVAHDRSEAKVTVVGLPDEPGYAAKVFRAVADAEINIDMVLQNI
2592 :     SKVETGKTDITFTLPKTEGARAVEMLTKRQGEIGFSQVLYDDHIGKVSLVGAGMKSHPGV
2593 :     TATFCEALADAGINIDLISTSEIRISVLVKDTELDDAVQVLHRAFDLGGDEVAVVHAGTG
2594 :     >RHOD-5a_|_CG-25
2595 :     MALVVQKYGGSSVATAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDELLDLAQQVCPA
2596 :     PPAREMDMLLTSGERISNSLVAMAIHSLGAEARSFTGSQAGVITTGAHGNAKIIDVTPGR
2597 :     VRDALDEGSIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALEADVCEIYTDVDGIF
2598 :     TADPRIVPDAQRLETVSFEEMLELAACGAKVLMLRCVEYARRYNVPVHVRSSYTTKPGTI
2599 :     VSGSMEDIPVEEAIITGVAHDRGESKITVVGLPDTPGYAAQVFRAVAEAEINIDMVLQNI
2600 :     SKVETGKTDITFTLPTADGPRAVEKLTKLQGDIGFTQVLFDDHIGKVSLVGAGMKSHPGV
2601 :     TATFCEALAKAGVNIDLISTSEIRISVLVKDVELDKAVKAIHDAFGLGGDEEAVVHAGTG
2602 :     >FRAN-2b_|_CG-25
2603 :     MALLVAKFGGSSVADADRIKRVAERIVENRRAGNDVVVVVSAMGDTTDELLDLAEQVSPL
2604 :     PPARELDMLLTAGERISMALLAMAITTLGAEARSFTGSQAGVITDSVHGKARIIDVTPGR
2605 :     IRAALDSGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALGADACEIYTDVDGVF
2606 :     TADPRIVPDARRIDTISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFSAKPGTW
2607 :     VTEIPEEQLVEQAIIRGVAHDLSEAKVTVVGCPDKPGVAAAVFRAVADTDVNLDMIVQVG
2608 :     SVAGSGRTDISFTLPKADGRTALTALTKVQSEIGFERTLYDDHIGKLSLIGAGMKSHPGV
2609 :     SARFFGSLADAGVNVEIISTSEIRISVVVRDTDLPLAVRAVHGAFDLGDPNGGAIVYAGT
2610 :     GR
2611 :     >Faln_Ab_|_CG-25
2612 :     MALLVAKFGGSSVADADRIKRVAERVVEARRDGNDVVVVVSAMGDTTDELLDLAEQVSPL
2613 :     PPARELDMLLTAGERISMALLAMAITTLGAEARSFTGSQAGVITDSVHGKARIIDVTPGR
2614 :     IRAALDEGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALHADACEIYTDVDGVF
2615 :     SADPRIVPDARRIDTISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFNAKPGTW
2616 :     VTEIPEAQLVEQAIIRGVAHDVSEAKVTVVGCPDKPGVAAAVFRAVADADVNLDMIVQVG
2617 :     SVAGSGRTDISFTLPKTDGRTALTALAKVQGEIGFERTLYDDHIGKLSLIGAGMKSHPGV
2618 :     SARFFGALADAGVNVEIISTSEIRISVVVRDTDLPGAVRAVHGAFELGDPDGGAVVYAGT
2619 :     GR
2620 :     >Cmic_Aa_|_CG-25
2621 :     MSLIVQKFGGSSVADAESIKRVAKRIVATRKAGNDVVVAVSAMGDSTDELLDLAHEVTPI
2622 :     PAPRELDMLLTAGERISMALLAMAIKSMGYDARSFTGSQAGMITDAQHGAARIVDVTPGR
2623 :     VRDALGEGAIAIVAGFQGFNRGTGDITTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
2624 :     TADPRVVPLARKIDRITSEEMLELAASGAKVLYIRAVEYARRHGVLLHVRSSFTHNEGTI
2625 :     VYNPTDGENVEEPVIVGVAADLSEAKVTVVGVPDVPGKAAQIFTIVAKTGANIDMIVQNV
2626 :     SAAATSLTDISFTLPKSDAQRVLTVLAAEKDEVGFTGLQHDDQIGKLALVGAGMRTNAGV
2627 :     SAQLFTALSDAGINIEMISTSEIRISVVTRADTIDEAVRVVHHAFGLDADDVAVVHAGTG
2628 :     >ARTH-1a_|_CG-25
2629 :     MSMPTTEVKTENQPYVLPVATARTKQLIVQKFGGSSVSDADGIKRVAKRVVDAQRAGNEV
2630 :     VVVVSAMGDTTDELLDLAAQVTDSAPAREMDMLLSSGERISMALVAMAINKLGASAQSFT
2631 :     GSQAGMITDGIHGKARIIDVDPHRIRTALDKGHIAIVAGFQGMSRTTNEITTLGRGGSDT
2632 :     TAVALAAALDADVCEIYTDVDGIYTADPRVVPSAQKIDRISSEEMLELAASGAKILHLRC
2633 :     VEYARRFGVPLHVRSSFSQNEGTWVMPGADDKITTQEGVALEQPIISGVAHDRSEAKVTV
2634 :     VGVPDIPGKAAAIFQVIADAHSNIDMIVQNVSTHGTGRTDISFTLPIVEGADALAALRAA
2635 :     QPEIGFENIEYNEQIGKLSLIGAGMRSHPGVSATFFKALSDAGININMISTSEIRISVVT
2636 :     HADLLDDAVRAIHKAFDLDSEDEATVYGGTGR
2637 :     >Lxyl_Aa_|_CG-25
2638 :     MALIVQKFGGSSVSDAESIKRVAKRIVETRKAGNEVVVAVSAMGDTTDELVDLAHEVTPI
2639 :     PAPRELDMLLTAGERISMALLAMAIKSMGSDARSFTGSQAGMITDAVHGSARIVDVTPGR
2640 :     IQDALSEGAIAIVAGFQGFSRESRDITTLGRGGSDTTAVALAVALGAEVCEIYTDVDGVF
2641 :     TSDPRQVPLARKIDRITSEEMLELAAAGAKVLHIRAVEYARRHDVTLHVRSSFSNREGTY
2642 :     VLNEAAAAAAAKKDGIVEEPIIAGVATDLSEAKITVVGVPDVPGKAAQIFKIVAKANANV
2643 :     DMIVQNVSAAATSLTDISFTLPKSEGQRVLTALTAEKYEVGFQSLQYDDQIGKLALVGAG
2644 :     MRTNTGVSAKLFEALFDAGINIEMISTSEIRISVVTCADTVAEAARVVHSAFRLDGDQQA
2645 :     IVYAGTGR
2646 :     >Stro_Aa_|_CG-25
2647 :     MALVVQKYGGSSVDNAERIKRVAERIVAARKAGDDVVVVVSAMGDTTDELTDLANQVSPL
2648 :     PPGRELDMLLTAGERISMALLAMAIHNLGYEARSFTGSQAGVITTSVHGRARIIDVTPGR
2649 :     LKGALDEGAVVIVAGFQGVSQDTKDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVF
2650 :     SADPRIVPDARHIRQITYEEMLELAACGAKILHLRSVEYARRAGLPVHVRSSYSTNTGTM
2651 :     VTGSMEDLPVEQALITGVAHDRSEAKITIVGVPDEPGAAAWIFDTVAGAEINIDMIVQNV
2652 :     STEGTGRTDISFTLPKTDGPTAMAALSKIQDSVKFKGLLYDDHVGKVSLIGAGMRSHPGV
2653 :     AAGFFAALGQAGVNIEMISTSEIRVSVVCRDTDLDDAVRAIHDAFELGGDTEAVVYAGTG
2654 :     >Mgil_Aa_|_CG-25
2655 :     MRAALILYGISPRIAKGSPVALVVQKYGGSSVSDADRIRRVAERIVETKKAGNDVVVVVS
2656 :     AMGDTTDELLDLAKQVSPAPPVREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQAG
2657 :     VVTTGTHGNAKIIDVTPTRLRSALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAV
2658 :     AAALNADVCEIYTDVDGVFTADPRIVPNARKLETVSFEEMLEMAAAGAKVLMLRCVEYAR
2659 :     RFNLPIHVRSSYTDRPGTLVTGSMEDIPMEDAILTGVAHDRGEAKVTVVGLPDVPGYAAQ
2660 :     VFRACADADVNLDMVLQNISKVEDGKTDITFTCSRESGPGAVEKLTSLQNEIGFTRVLYD
2661 :     DHIGKVSLIGAGMRSHPGVTATFCEALANAGINIDLISTSEIRISVLIKDTELDRAVAAL
2662 :     HEAFGLGGDEEAVVYAGTGR
2663 :     >MYCO-4a_|_CG-25
2664 :     MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDLLDLAKQVCPA
2665 :     PPARELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVVTTGTHGNAKIIDVTPTR
2666 :     LRSALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAVAAALNADVCEIYTDVDGVY
2667 :     TADPRIVPNARKLDTVSFEEMLEMAACGAKVLMLRCVEYARRYDLPIHVRSSYSDKPGTI
2668 :     VKGSIEDIAMEDAILTGVAHDRSESKVTVVGLPDVPGYAAKVFRAVADADVNIDMVLQNI
2669 :     SKIEDGKTDITFTCARDNAPGAVEKLTSLQDEIGFTRVLYDDHIGKVSLIGAGMRSHPGV
2670 :     TATFCEALAEVGVNIDLISTSEIRISVLVKDTELDKAVAALHEAFGLGGDEEAVVYAGTG
2671 :     >Mulc_Aa_|_CG-25
2672 :     MALVVQKYGGSSVGNAERIRRVAERIVETKKQGNDVVVVVSAMGDTTDDLMDLALQVCPV
2673 :     PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIEVTPGR
2674 :     LQAALDEGRIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
2675 :     SADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDKPGTL
2676 :     VVGSIKDIAMEDPILTGVAHDRSEAKVTIVGIPDIPGYAAKVFRAVAEADVNIDMVLQNV
2677 :     SKVEDGRTDITFTCSRDSGPTAVAKLDSLKDEVGFTQLLYDDHIGKLSLIGAGMRSHPGV
2678 :     TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGEETATVYAGTG
2679 :     >Mvan_Aa_|_CG-25
2680 :     MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDELLDLAKQVSPA
2681 :     PPARELDMLLTAGERISNALVAMAIESLGAEARSFTGSQAGVVTTGTHGNAKIIDVTPTR
2682 :     LRAALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAVAAALKADVCEIYTDVDGIF
2683 :     TADPRIVPNARRLDTVSFEEMLEMAAAGAKVLMLRCVEYARRFDLPIHVRSSYSDNPGTI
2684 :     VKGSIEDIPMEDAILTGVAHDRGEAKVTVVGLPDVPGYAAQVFRAVADADVNIDMVLQNI
2685 :     SKVEDGKTDITFTCSRESGPGAVEKLTALQDEIGFTRVLYDDHIGKVSLIGAGMRSHPGV
2686 :     TATFCEALADAGINIDLISTSEIRISVLIKDTELDRAVEALHDAFGLGGDEEAVVYAGTG
2687 :     >NOCA-3a_|_CG-25
2688 :     MGIVVQKYGGSSVADAAGIKRVAQRIVNTRKAGHDVVVVVSAMGDETDNLRDLAEQVTPL
2689 :     PPPRELDMLLTAGERISMALVAMAIAALGHEAKSFTGSQAGVITDSAHGKAKIIDITPGR
2690 :     IEKALKDGAIAIVAGFQGVSQDTKDVTTLGRGASDTTAVALAAALGAEVCEIYSDVDGVF
2691 :     TADPRIVPAARKLARVSTEEMLEMAASGAKILHLRCVEYARRYDMPIHVRSSFSQKEGTW
2692 :     VIPDSKAGEDEMEQAIIAGVAHDRSEAKITVVGVPDKVGEAARIFEALAATEVNLDMVVQ
2693 :     NVSAAATGLTDISFTLPRADGQSAMGALARIQDEVGYDKLLYDDQIGKVSLIGAGMRSHP
2694 :     GITARFFASLAAAGVNIEMISTSEIRISVIVDEAQVDEAVRATHTAFDLDAEEVEAVVYG
2695 :     GTGR
2696 :     >Tfus_Aa_|_CG-25
2697 :     MALIVQKYGGSSVADADAIKRVAERIVAQKKAGYDVVVVVSAMGDTTDELLDLAKQVSPL
2698 :     PPGRELDMLLTAGERISMALVAMAIGNLGYEARSFTGSQAGVITTSLHGNAKIIDVTPGR
2699 :     IRDALAEGAICIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALNADLCEIYTDVDGVF
2700 :     TADPRIVPSARRIPQISYEEMLEMAASGAKILHLRCVEYARRYNIPLHVRSSFSQKPGTW
2701 :     VVSEVEETEGMEQPIISGVAHDRSEAKITVVGVPDRVGEAAAIFKALADAEINVDMIVQN
2702 :     VSAASTSRTDISFTLPADSGQNALAALKKIQDKVGFESLLYNDRIGKVSLIGAGMRSYPG
2703 :     VTARFFDAVAREGINIEMISTSEIRISIVVAQDDVDAAVAAAHREFQLDADQVEAVVYGG
2704 :     TGR
2705 :     >Pacn_Aa_|_CG-25
2706 :     MTRVVQKFGGSSVADAASIKRVARRIAATKQAGNDIVVVISAMGDTTDDLMDLALEVSPQ
2707 :     PAPRELDMLLTTGERQSAALLAMALSDVGIPARSYTGSQAGVITTAAHGNARIIDITPGR
2708 :     IEKSLEAGDLVIVAGFQGVSQTTKDVTTLGRGASDTTAVALASSLGADFCEIYSDVDGVF
2709 :     TADPRIVKGARRIPEISYEEMLEMAACGAKILHLRCVEYARREDVPVHVRSSFSDKPGTW
2710 :     VKDPTDITKGSDMEEAIISGVAHDRSEAKITIAGLPDAVGRAAQIFEIIAHADINIDMIV
2711 :     QNASRVMNGRTDLSFTLPMNDGPTAVRALTAVKDELGYEQILYNDQIGKVSVVGVGMRTH
2712 :     PGVTSTFFRALADCGINLQMISTSEIRISVVVDADQVDEAVRVAHTAFGLDAEGEAVVYA
2713 :     GTGR
2714 :     >Sery_Aa_|_CG-25
2715 :     MALVVQKYGGSSLESADRIKRVAERIVETRKAGNDVVVVCSAMGDTTDELLDLAQQVNPA
2716 :     PPERELDMLLTAGERISNALVAMAIEALGAEARSFSGSQAGVITTSAHQNARIIDVTPGR
2717 :     VQEALKQGQVVLVAGFQGVAQDTKDITTLGRGGSDTTAVAVAAAMNADVCEIYTDVDGVY
2718 :     TADPRIVSDAKHLDRITYEEMLEMAATGAKVLHLRAVEYARRYGVPLHVRSSYSPKSGTI
2719 :     VSGSVEDLSVEQAMITGVAHDRSEAKVTVRGVPDNPGIAGRIFRVIADAEIDIDMVLQNV
2720 :     SGTASGRTDITFTVARSNGALAVTELEKIKDELGFDQVVYDDHVGKVSLVGAGMRSHPGV
2721 :     TATFCEALSHAGVNIEIINTSEIRISVLIRDTQLEDAVAALHAAFELGGDEEAVVYAGSG
2722 :     >Save_Aa_|_CG-25
2723 :     MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGHQVVVVVSAMGDTTDELIDLAEQVSPM
2724 :     PSGREFDMLLTAGERISMALLAMAIKNLGHSAQSFTGSQAGVITDSVHNKARIIDVTPGR
2725 :     IRTALDEGNIAIVAGFQGVSQDKKDITTLGRGGSDTTAVALAAALDAEVCEIYTDVDGVF
2726 :     TADPRVVKKAKKIDWIAFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
2727 :     VSNTPLVQKAQQQGEQKVEQAIISGVAHDTSEAKVTVVGVPDKPGEAASIFRAIADAEVN
2728 :     IDMVVQNVSAASTGLTDISFTLPKTEGRKAIDALEKAKSVIGFDSLRYDDQIGKISLVGA
2729 :     GMKTNPGVTAGFFEALSDAGVNIELISTSEIRISVVTRADDVPEAVRAVHTAFGLDSDSD
2730 :     EAVVYGGTGR
2731 :     >Scoe_Aa_|_CG-25
2732 :     MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGNQVVAVVSAMGDTTDELIDLAEQVSPI
2733 :     PAGRELDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
2734 :     IRTSVDEGNVAIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALDADVCEIYTDVDGVF
2735 :     TADPRVVPKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
2736 :     VSSEPIKQGEKHVEQALISGVAHDTSEAKVTVVGVPDKPGEAAAIFRAIADAQVNIDMVV
2737 :     QNVSAASTGLTDISFTLPKSEGRKAIDALEKNRPGIGFDSLRYDDQIGKISLVGAGMKSN
2738 :     PGVTADFFTALSDAGVNIELISTSEIRISVVTRKDDVNEAVRAVHTAFGLDSDSDEAVVY
2739 :     GGTGR
2740 :     >Sgri_Aa_|_CG-25
2741 :     MGLVVQKYGGSSVADAEGIKRVAKRVVDAKKNGNQVVVVVSAMGDTTDELIDLAEQVSPM
2742 :     PTGREFDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
2743 :     IRTSIDEGNIAIVAGFQGVSQEGKNITTLGRGGSDTTAVALAAALDAEVCEIYTDVDGVF
2744 :     TADPRVVKKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLRGTW
2745 :     VSNEPQGDQQVEHAIISGVAHDVSEAKVTVVGVPDKPGEAAAIFRAIANAEVNIDMVVQN
2746 :     VSAASTGLTDISFTLPKAEGRKAIDALERARGVIGFDSLRYDDQIAKISLVGAGMKTNPG
2747 :     VTAGFFEALSDAGVNIELISTSEIRISVVTRADDVNEAVRAVHTAFGLDSDSDEAVVYGG
2748 :     TGR
2749 :     >Tmar_Ab_|_CG-26
2750 :     RVAKYKVLGGAEKFSVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTT
2751 :     DHLIELAKTIDENPDPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKR
2752 :     YGSARIIDINTDIISRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGAD
2753 :     LCELYKDVDGVYTADPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVL
2754 :     IKNAHKETRGTLIWEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGV
2755 :     NIDMIIQGMKSGEYNTVAFIVPESQLGKLDIDLLKTRSEAKEIIIEKGLAKVSIVGVNLT
2756 :     STPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDRE
2757 :     >Tpet_Ab_|_CG-26
2758 :     RVAKYKVLVGAEKFSVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTT
2759 :     DHLIELAKTIDENPDPRELDLLLSTGEIQSVALMSIALRKRGYKSISFTGNQLRIITDKR
2760 :     YGSARIIDINTDIISRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGAD
2761 :     LCELYKDVDGVYTADPRIVKNARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVL
2762 :     IKNAHKETRGTLIWEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGV
2763 :     NIDMIIQGMKNGEYNTVAFIVPESQLGKLDIDLLKTRSDAKEIIIEKGLAKVSIVGVNLT
2764 :     STPEISATLFETLANEGINIDMISASNSRISVIIDGKYVEDAVKAIHSRFELDRE
2765 :     >Bbac_Aa_|_CG-27
2766 :     MKPLIVQKYGGATLADPEKIKSVSSRIAAQSKENSLIVVVSAMGKTTNSLIDLANQVSSH
2767 :     PQRREMDMLLTVGERISMSLVSMALNDLGCPAISFTGSQAGIFTDDSHVNAFIKDVKPMR
2768 :     LDEALKNNRVVILAGFQGVSPVTKEITTLGRGGSDTSAVAMAAAFNAERCEILKDVPAVF
2769 :     TADPNIVKSARPLSELNYDQLMEMTFWGAKVLHYRSVELAKMRDVTLYIGPASSKTSDGT
2770 :     IVKKGLNMFESCKALSLNSHELVLGIHCREKNPAKALQGLQNLLDKNQIAFPQLLSCETS
2771 :     LDKTEIFLTGPQEIMFAVKKELEKHPDFTLLPTDYSTVTLTCTGATSPEMTQKVLNTLTG
2772 :     KNLETQKILISAMSLTVLVEAPLRKQVIECLHPLI
2773 :     >Adeh_Aa_|_CG-27
2774 :     MPVVVQKYGGSSVGTVEKMRKVAEKVAAARRAGKDVCVVVSAMGDTTDDLLSLAKQISPA
2775 :     PARRELDMLLSAGERISMALLSMALNDLGVPAISFTGSQSGIITTDSHSAARILEVRAFR
2776 :     VQEELAKGKVVIVAGYQGVSTRKEVTTLGRGGSDTTAVALAAALGADCEIYSDVAGVFTA
2777 :     DPRVVPSAARLEALSYEEMQELAAAGAKVLNAQAVEFAKERGIAIHARSTFGGPEETVVK
2778 :     GGAHPERIAGVAMQKGLALLGFPAARLGDVLAILERHGAVALEIAVPGERAGVALDLENV
2779 :     HDWPVLRAQLAAEVPGLAAEDEAIGAVSVVGTGISAGHRVLRAVTATLAELGARPRALFT
2780 :     SPLRVTAYCDAAVLKDAARRLHEQLVG
2781 :     >Mxan_Aa_|_CG-27
2782 :     MPIVVQKYGGSSVAGVEKLRKVAQRVKDKREAGYQVVVVVSAMGDTTDELLALAKGVSVD
2783 :     PPRRELDMLLTCGERISMALLSMALQEMDVPAISFTGSQSGIITTDAHAQARIVEVRPYR
2784 :     IHDELARGKVVIVAGYQGVSFKKEVTTLGRGGSDTTAVALAAALDAEACEIYSDVDGVFS
2785 :     ADPRVVPDARKLESLSYDEMQELASAGATVLNAQAVEWAKARGITILARTAHGQGTGTAV
2786 :     QELAVPTDHRLKGVTADAEMAVLSASEPIRLAELLEFLDARAVRGRTLDCEGSVGGVRRT
2787 :     VITVPLADIHGADALRRELATRFGDAVSWREDLGTVTCVGVGLNADWAPLRRALAAAEEL
2788 :     GAHVHAAHTSPLQLTLLVDKAHLKALTARLHRELLGG
2789 :     >Cbot_Ba_|_CG-28
2790 :     MATIVQKYGGTSVATVEKIKNVAKFIVKRKREGNDIVIVVSAMGHTTDNLINLAKDISNV
2791 :     PDKRELDALISTGEMVSSSLLSMAIKELGEDAISYTAYQINISTNGQHGKSLINDIDKKK
2792 :     IDKSLKEGKVVVVAGFQGINCDGNITTLGRGGSDTSAVAIAAKLNNAICEIYTDVDGIYS
2793 :     VDPRVYDRAKKLDYIDYEEMLELSSLGAQVMHSRSIELAEKYNIPIYVGLSNSNIKGTVI
2794 :     RRMNNMNMEMKSVTGLATSDDDVAITMEDINENINIVADIFSKLAEKQINVDMISQTAPI
2795 :     NSRISLSFTIPKEDLQEGMKIIRNYASKDKIKIDENLTKFSIVGIGMKNTSGVAAKMLKI
2796 :     FSDNNIKVKMITTSEIRITCAINVRDKINAINLVVKEFNL
2797 :     >Cdif_Aa_|_CG-28
2798 :     MSIIVQKYGGSSVADTEKIKSIAENIIERRKENPQMVIVVSAMGKSTDEYITLAKELSNE
2799 :     PSKRELDALMSTGEMISASLLSIALNALGCKAISYNAYQLNIKTSGLHGKSQIDDINVNR
2800 :     IKNSLDEGNVVIVTGFQGINEDGDVTTLGRGGSDTSAVALAVKLNGKCEIYTDVDGIYFT
2801 :     DPRKYSKASKLDEIEYEEMLELASLGAQVMHSRSIELAQKYGVEIYVGRTCGTEKGTYIR
2802 :     GGKDMKLEDKVITGLATSDDDSSITIKDFKAENISSLFEDIATIGISVDMISQTAPILDK
2803 :     ISVSFTVPKEELGECKKIVSKYTDEEHVVIDNNITKFSLVGLGMKNTSGVAAKVFKIFNE
2804 :     NGIMIKLITTSEIRITCAINSDDKQVAIEKIAEVFNI
2805 :     >Tmar_Aa_|_CG-29
2806 :     MNVVVQKYGGSSVATPERIKNVAQRIKKKVDEGYKVVVVVSAMGKTTDNLIKLAKEISPR
2807 :     PDSRELDMLLATGEQVSAALLSMALKDLGVKAKSLNAFQVKIKTTPHHTSARIVDIDDSV
2808 :     IRENLKDYDVLVVTGFQGVNEHGDLTTLGRGGSDTSAVALAAKLRVPCEIYSDVDGIYTC
2809 :     DPRVHPRAKKLAYITYDEALELTALGAKVLHSRSVEIAKKYGIPIYCASSFTEEEGTMVV
2810 :     ERLPEWLEEPVVTGATISHGQIKVSISFLPKDVKYITAIFEEVGKRALNVDMISLVPSNG
2811 :     KVFLSFTILEDHKEDLDEALKEALRDVEGWKSTYEGGFAKLSIVGVGMRTSPGVAARFFE
2812 :     ALERAGVTPELVTTSEIKISCLVPEEKAEEALKSVIEEFEL
2813 :     >Tpet_Aa_|_CG-29
2814 :     MNVVVQKYGGSSVATPERIKNVAQRIKKKVDEGYKVVVVVSAMGKTTDNLIKLAKEISPK
2815 :     PDSRELDMLLATGEQVSAALLSMALKDLGIKAKSLNAFQVKIKTTSHHTSARIVDIDDSV
2816 :     IWENLKDYDVLVVTGFQGVNEHGDLTTLGRGGSDTSAVALAAKLRVPCEIYSDVDGIYTC
2817 :     DPRVHPRAKKLAYITYDEALELTALGAKVLHSRSVEIAKKYGIPIYCASSFTEEEGTMVV
2818 :     ERLPEWLEEPVVTGATISHGQIKVSISFLPKDVKYITAIFEEVGKKALNVDMISLVPSNG
2819 :     KIFLSFTILEDHKEDLDEALKEALRDVEGWKSTYEGGFAKLSIVGVGMRTSPGVAARFFE
2820 :     ALERAGVTPELVTTSEIKISCLVPEEKAEEALKSVIEEFEL
2821 :     >Saur_Aa_|_CG-30
2822 :     MVTRSVLKFGGSSVSDFTKLKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTK
2823 :     APKQQELALLLTTGEQQTVSYLSMVLNDIGMNAKAMTGYQAGIKTIGHHLKSKIAQINPQ
2824 :     TFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYA
2825 :     TDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWI
2826 :     MSNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLD
2827 :     GLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFL
2828 :     TLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI
2829 :     >Sepi_Aa_|_CG-30
2830 :     MNRSVLKFGGSSVSDFKKIKNIAEMLKTRIEDGEELIVVVSAMGKTTDQLMNNVSSLTST
2831 :     PKDQELALLLTTGEQQTVSYLSMVLNDIGVNAKAMTGYQAGIKTVGHHLKSKIAEINPNI
2832 :     FDEAFKDHDILVVAGFQGINDDFELTTLGRGGSDTTAVALAASNQIPCEIYTDVDGVYAT
2833 :     DPRILNEAKRLEYVSYEEMMEMSALGAGVLETRSVELAKNYDIPLYLGRTLSNMKGTWIM
2834 :     SKSDLLEKKAVTGVALDTHMMHVTISYPLPDNQLLTQLFTALEEESVNVDMISQIVNLEG
2835 :     LQLSFSIKDSDAHQISSILENLSIHFSALDYKINEAYVKISLIGSGMRDMSGVASKAFMT
2836 :     LINSDIPFYQTTTSEISISYVIDEENGEKAVEELYHAFEI
2837 :     >Shae_Aa_|_CG-30
2838 :     MKRSVLKFGGSSVADFTKIKNIAEMLKNRVDDGEQLIVVVSAMGKTTDQLMDNVSNLTAT
2839 :     PKDEELALLLTTGEQQTVSYLSMVLNDIGVNARAMTGYQAGIKTIGHHLKSRIAEINPET
2840 :     FDKAFTDKDVLVVAGFQGINDAFELTTLGRGGSDTTAVAIAASNQIPCEIYTDVDGVYAT
2841 :     DPRILSKAKRLDYFSYEEMMEMSALGAGVLETRSVELAKNYDIPLYLGRTLSNEKGTWIM
2842 :     SRTDLLEKKAVTGVALDKHMMHVTISYPLPDNRLLTQLFTALEEGSVNVDMISQIVNIEG
2843 :     LQLSFSIKDSDVQQISTILSNLSSSFNALDYKINEEYVKISLIGSGMRDMSGVASKAFIT
2844 :     LINANIPFYQTTTSEISISYVIDADNGEKAVEVLYNAFDI
2845 :     >Ssap_Aa_|_CG-30
2846 :     MNLERSVLKFGGSSVSDFTKIKNIAEMLSLRIAQGEQLIVVVSAMGKTTDELMANVSTLT
2847 :     TSPKDQELALLLTTGEQQTVSYLSMVLNDIGVRAKAMTGYQAGIKTVGHHLKSRIAEINP
2848 :     ETFEQAFEENDVLVVAGFQGINDDLEVTTLGRGGSDTTAVALAASNHTPCEIYTDVDGVY
2849 :     ATDPRLYKDAKRLDYVSYEEMMEMSALGAGVLETRSVELANNYNIPLYLGRTLSNVKGTW
2850 :     IMPQTEILEKKAVTGVALDTHMMHVTISYPLPDNKLLTKLFSQLEDGSVNVDMISQIVNL
2851 :     EGLQMSFTIKDTDVAQISSILETLKEDFSALDFRINEEYVKISLIGSGMRDMSGVASKAF
2852 :     ITLIENDISFYQTTTSEISISCVIDAENGERAVQTLYQAFDI
2853 :     >Lbor_Ba_|_CG-31
2854 :     MPNIIVQKYGGTSVGTPERIQNVARRIKSYHDKGQQIAVVVSAMGHTTDDLVELAAKISA
2855 :     NPPKREMDMLLSTGEQISTALLAMALWEIGVPATSFTGSQIKLLTDGNFSNAKIKMIDRS
2856 :     RIDAALNEGKVAIIAGFQGIDEEENITTLGRGGSDTSAVAVAAVLGAKECEIYTDVDGVY
2857 :     TADPRIVPNAKKHTQITYEEMLELASLGAGVLHSRSVELGMNYDVVIHVRSSFNENQGTL
2858 :     VMSEDKIMEKLKVSGVTAKSDQARITIAEVPDKPGLAARLFGELNSKHILVDMIVQSSPH
2859 :     NGINTISFTISKKDVLQAKPILQGFSKTHNAKEPEINESIAIVSAVGVGMKSHVGVAAGM
2860 :     FQALADNGINIEMISTSEIKISCVIPEDQAKIAINKIHDVFGLSG
2861 :     >Lint_Aa_|_CG-31
2862 :     MTNIIVQKYGGTSVGTPERIQNVAKRIKSYHDKGQQVAVIVSAMGHTTDELVDLAAKISS
2863 :     NPPKREMDMLLSTGEQISTALLAMALWEIGVPATSFTGSQIKLLTDGNFSNAKIKMIDRS
2864 :     RIDSALNEGKVVIIAGFQGIDAEENITTLGRGGSDTSAVAVAAILGAKECEIYTDVDGVY
2865 :     TADPRVVPSAKKHKQITYEEMLELASLGAGVLHSRSVELGMNYDVVIHVRSSFNDNIGTL
2866 :     VVSEDKIMEKLKVSGVTAKNDQARITIAGVPDKPGLAAGLFGELSSKHILVDMIVQSSPH
2867 :     NGINTISFTIPKKDVHEAKPILEGFSKSHNAKEPEINENIAIVSAVGVGMKSHVGVAAGM
2868 :     FKALADNGINIEMISTSEIKISCVIAESQAKIAVNKIHDVFGLSS
2869 :     >Avar_Aa_|_CG-32
2870 :     MALIVQKFGGSSVGSVERIQAVAQRVYKTVKAGNSLVVVVSAMGKTTDGLVKLANEISRN
2871 :     PNRREMDMLLSTGEQVTIALLSMALQELGQPAISMTGAQVGIVTEAEHTRARILHIETER
2872 :     VEGHIQEGKVVVVAGFQGISSNGSLEITTLGRGGSDTSAVALAAALQADFCEIYTDVPGI
2873 :     LTTDPRIVPEAQLMGEITCNEMLELASLGAKVLHPRAVEIARNYGMPLVVKSSWTDDPGT
2874 :     WVTTPKPQGRSLINLELARPVDDVELDTDQAKVALLRVPDKPGVAAKLFGEISRQKVDVD
2875 :     LIIQSIHEGNSNDIAFTVTTPILKRAEAVAAAIAPSLRSPSHPKSDEAEVMVEQNIAKVS
2876 :     IAGAGMIGRPGVAAKMFTTLAEAGVNIQMISTSEVKVSCVIDAQDGDRAIIALRKAFEIE
2877 :     TPLHSPTPPTLSTHNSPPVRGVALDLNQARLAIRQVPDRPGMAAQLFGILAQNNISVDMI
2878 :     IQSQRCRIVDGVPRRDIAFTVPRMDGETAQKLLCQVAPELGWGDVVLDSAIAKVSIVGAG
2879 :     MVGQPGVAAKMFEALAKHQINIQMIATSEIKISCVVSQEQGVQALQVIHTAFELAGTEKF
2880 :     VVPV
2881 :     >NOST-3a_|_CG-32
2882 :     MALIVQKFGGSSVGSVERIQAVAQRVYKTVKAGNSLVVVVSAMGKTTDGLVKLANEISRN
2883 :     PNRREMDMLLSTGEQVTIALLSMALQELGQPAISMTGAQVGIVTEAEHTRARILHIETER
2884 :     VEGHIKEGKVVVVAGFQGISSNGSLEITTLGRGGSDTSAVALAAALQADFCEIYTDVPGI
2885 :     LTTDPRIVPEAQLMGEITCNEMLELASLGAKVLHPRAVEIARNYGMPLVVKSSWTDDPGT
2886 :     WVTTPKPQGRSLINLELARPVDDVELDTDQAKVALLRVPDKPGVAAKLFGEISRQKVDVD
2887 :     LIIQSIHEGNSNDIAFTVTTPILKRAEAVAAAIAPSLRSPSHPKSDEAEVMVEQNIAKVS
2888 :     IAGAGMIGRPGVAAQMFATLAEAGVNIQMISTSEVKVSCVIDAQDGDRAIIALRKAFEIE
2889 :     TPLHSQLPTPSSLSTHNSPPVRGVALDLNQARLAIRQVPDRPGMAAQLFGILSQHNISVD
2890 :     MIIQSQRCRIVDGVPRRDIAFTVPRMDGETAQKLLCQVAPELGWGDVVLDSAIAKVSIVG
2891 :     AGMVGQPGVAAKMFEALAKHQINIQMIATSEIKISCVVSQEQGVQALQVIHTAFELAGTE
2892 :     KFVVPA
2893 :     >Pmar_Aa_|_CG-32
2894 :     MALLVQKFGGSSVGNVERIQAVAERIATSKDLGHDLVIVVSAMGQTTDELTALAKVISSN
2895 :     PPQREMDMLLATGEQVSISLLSMALHELGIPAISMTGAQVGIVTESAYGRARILDVRTER
2896 :     LQSLLSTGKVVVVAGFQGTSLSSVGTAEITTLGRGGSDTSAVAIAAALGADACEIYTDVP
2897 :     GVLTSDPRQVSDAQLMQEVSCDEMLELASLGASVLHPRAVEIARNFGVALVVRSSWSNEA
2898 :     GTKLTSKSKRPIGREGLELGRPVDGVELAEGQAVIALSHVPDQPGVAATLFENLSSDGVN
2899 :     VDLIIQSTHEGNSNDIAFTVAEADLAKAHSLCEGLLKSVGGQLSAEAGMSKLSISGAGIM
2900 :     GRPGIAASLFDTISRAGINLRLIATSEVKVSCVIDATLGSKALRAVSTAFELSDSQVRIN
2901 :     PLGNGKGEPEVRGVALDQGQAQLSVRGVPNRPGTAAALCSAMAEAGISLDAIVQSERQHD
2902 :     DGSRDISFTLKRDEREQANKTLAPLLAQWPGANLEDGPAIARVSAVGAGMPATAGTAGRM
2903 :     FRALADAKINIAMIATSEIRTSCVVAEPDGVKALQSVHKGFGLGEEADHPVQSNS
2904 :     >Pmar_Ba_|_CG-32
2905 :     MALLVQKFGGTSLGSIERIKAVAQRIKSSKEKGDDLVVVVSAMGHQTDELTRLASEITVD
2906 :     PPHREMDMLLSTGEQVSISLLTMALNELGTPAISLTGTQAGIITESAHGRARILEIRTER
2907 :     IKNLLDQGQTIVIAGFQGTTLGIGGIAEITTLGRGGSDTSAVALAASLEAAKCEIYTDVP
2908 :     GVLTTDPRIVKNAKLMKSISCDEMLELASLGAAVLHPRAVEIARNFGVTLVVKSSWDNLD
2909 :     GTTLTSNKKPDFSQGGIEHRSPVDGLELLENQAVVALSNIPDRPGIAAELFESLSEGGVN
2910 :     VDLIIQATHQIDSNDITFTVAENELHNALTQCKKLVNTIGGDISFQKDLTKLSIYGAGIM
2911 :     GRPGIASSLFQILSDSGINIRLIATSEVKVSCVIDAELGKKALRNVSEVFKLTDKQITVN
2912 :     PTIENNNEPEVRGIALDKDQIQISVKNVPDKPGTASTICSTLAEKNISLDTIVQSERKHK
2913 :     DKTKDISFTLKKNDRSDAKYALKELIGNWKGSNLEEGESIVRISAVGSGMPFTKGTAGKI
2914 :     FRALANQKINIEMIATSEIRTTCIISEKYGEKALNEIHSCFKLGKNES
2915 :     >Pmar_Ca_|_CG-32
2916 :     MALLIKKFGGTSVEDITKIKAIAQSIIQSKEAGNDIVVVVSAMGHSTDHLNKLAESISKN
2917 :     PNSRELDMLLSTGEQVTMALLSMSLNEYGIPAISLTGSQVGIVTESIHGKARILDIKTER
2918 :     IQNYINQGYVVVVAGFQGSTLSHTGSMEITTLGRGGSDTSAVALSTALGAETCEIYTDVP
2919 :     GVLTTDPRIVPNAKLLDIISCEEMLELASVGASVLHPRAVEIARNYGIKLYVKSSQALSN
2920 :     GTLLHSKIKPLALKRGGLELTKTVNSLEVLEKQTVFSISKLPDRPGIAAQIFETLSKANI
2921 :     NVDLIIQATHDGKSNDIAFTVNDFELTKTIDQCKLITKQLGGEYDFKKNMTKLSIQGAGI
2922 :     MGRPSVSADLFDTLFQANINVRLIATSEIKVSCVIDIENISKAIRFVSEKFKLSDKQIFI
2923 :     NPVIESEDQPEVRGIALDKNQVQVSIRNLPDKPGVAASICLALAENNLIFDTIVQSERLT
2924 :     SLKTKDISFTMSKQDRERANTIFHSLTKKLAGSFIEDGPAIAKVSTVGAGMAFKVGTAGK
2925 :     IFRALANKNINIEMIATSEIRTSCIVLEQDCDQAVNAIHSYFQLDK
2926 :     >Gvio_Aa_|_CG-32
2927 :     MGLIVQKYGGTSVGSAERMRSVAERIARTHRQGHDLVVVVSAMGHTTDALVKMACEMHGE
2928 :     PDPREMDMLLTTGEQQSVALLTMALHALGCKAISLTGAQVGVVTEPNHTRARIRRVQTGR
2929 :     INELLAAGYVLVVAGFQGICHSRFWEITTLGRGGSDTSAVALAAVLKANRCEIYTDVPGV
2930 :     LTTDPRLVGDAALLEEITSEEMLELASLGAQVLHPRAVEIARNYAVPLVVRSSWSDAPGT
2931 :     IVLSPRLPVDRAIDNLETERPVDAVYIDNHQAKIALLRVPDRPGVAAALFGHLAKAGIDV
2932 :     DLIIQSIHHPNAPEPTNDIAFTVQRSDLAAAVATSETAAAALGGCAVVVDPVPTKVSIRG
2933 :     AGIIGRPGVVAQMFKALAEARINIQMISTSETSLSCVIAGEQAEKAGEVLCGQFGLRAPV
2934 :     YEEPPVVSGARPVAQAVRGVALDTNQAQVAILQIPDRPGVAAEIFQCLAQEGIAVDMIVQ
2935 :     SQRGADTNDIGFTVSRSAVRAAQRALASLCMGFAGCGGVVVRESVAKLSLVGAGIVGTPG
2936 :     VAARMFETLASLGTNIEMISTSTIKVSCIVEAACCEASLQAVHRAFGLGSGAMVAVEGRS
2937 :     >Selo_Aa_|_CG-32
2938 :     MALIVQKYGGTSVGSVERITAVAQRIAQTVAAGNQVVVVVSAMGHSTDELLKLANGISAN
2939 :     PSRRELDMLLATGEQVSIALLSMALHEQGCDAISMTGAQVGIITEAHHSRARILEIDPQR
2940 :     LQSQLDAGRVVVVAGFQGIASSDRTALTEITTLGRGGSDTSAVALAAALNADRCEIYTDV
2941 :     PGILTTDPRLVPEAHLLEEITCDEMLELASLGASVLHPRAVKIARNYGVRLVVRSSWTQE
2942 :     PGTGVVAPPRRSDRSLQGLEIGRPVDGLALDTDQAKVALLHVPDRPGIAASLFGEMAQRG
2943 :     VNVDLIIQSIHEGNSNDISFTVSQADLEKAEAGTTQLLADLGGEQQSEAAVAKVSISGVG
2944 :     IVGRPGIAAQMFSALAQGGINIQMISTSEVKVSCVIAAADQQRAIAALQESFELEEAIAA
2945 :     TATDACTTDLPAVRGVALDRDQARLAILNVPDLPGMAATIFQILADRQISVDMIIQSQRG
2946 :     RIHNGQPCRDIACTLPPADAELAAAALQAFADQHGCSLEIQTEIAKVSIVGSGMVQQPGV
2947 :     AAQMFAALANHGINIHMIATSEIKVSCIVDASQAVEALQTVHAAFGLASDRRIEVPA
2948 :     >SYNE-11a_|_CG-32
2949 :     MALLVQKYGGTSVGSVERIQAVAKRVAAARLDGHDLVVVVSAMGHTTDELTALARALNPD
2950 :     PPQREMDMLLATGEQVSIALLSMALQAEGVAATSMTGPQVGIVTESAHGRARILEVRTER
2951 :     VKRRLHDGHVVVVAGFQGTSTGSAGTPEITTLGRGGSDTSAVALAAALGADACEIYTDVP
2952 :     GVLTTDPRKVPEAQLMTQVSCDEMLELASLGAAVLHPRAVEIARNYGVPLIVRSSWSDEP
2953 :     GTRLFSQPSRRIGSEGLELGKPVDRAELLEGQAVVALAHVPDEPGVAARLFEGLGAAGLN
2954 :     VDLIVQATHDGSSNDIAFTLAEAELPAAEAFCREHLGEGSQLQVQSGLAKLSIGGAGIMG
2955 :     RPGVAAQLFDGLSKMGISLRMIATSEVKVSCLIQGEQAAKALRTAAQVFELDDHQLQHNP
2956 :     LPGGEGEPDVRGVALDRDQAQLTVTAVPDRPGSAAALCRALADGGISLDTIVQSERQRQT
2957 :     DLGLCRDIAFTLPRDDLSRASEALRPLLKLWPGAELVEGKAIARVSAVGAGMPSTPGSAA
2958 :     KMFRALADAGINIEMIATSEIRISCVVPEDDGIGALQAVHQAFGLNGESQHQAQGSEWAG
2959 :     >SYNE-4a_|_CG-32
2960 :     MALIVQKFGGTSVGTVERIQAVAQRIKRTVQGGNSLVVVVSAMGKSTDVLVDLAQQISPN
2961 :     PCRREMDMLLSTGEQVSIALLSLALQEIDQPAISLTGAQVGIVTEAEHSRARILEIRPDR
2962 :     LEHHLREGKVVVVAGFQGISSVEHLEITTLGRGGSDTSAVALAAALKADFCEIYTDVPGI
2963 :     LTTDPRLVPEAQLMAEITCDEMLELASLGAKVLHPRAVEIARNYGIPLVVRSSWSDEPGT
2964 :     KVVAPPVQNRSLVGLEIAKAVDGVEYDADQAKVALLRVPDRPGVASKLFRDIAQQQVDID
2965 :     LIIQSIHDGNSNDIAFTVVKDLLNTAEAVTSAIAPALRSYPEADQEAEIIVEKGIAKIAI
2966 :     AGAGMIGRPGIAAKMFKTLADVGVNIEMISTSEVKVSCVIDQRDADRAIAALSNAFGVTL
2967 :     SPPKNQTDTSHLPAVRGVALDQDQAQIAIRHVPDRPGMAAQLFTALAEANISVDMIIQSQ
2968 :     RCRINQGTPCRDIAFMVAEGDSSQAEAILQPLIKDWLDAAIVVNKAIAKVSIVGSGMIGH
2969 :     PGVAAHFFAALAQENINIEMIATSEIKISCVVPQDRGVDALKAAHSAFNLAGTKTVTVPA
2970 :     >Telo_Aa_|_CG-32
2971 :     MGLIVQKYGGTSVGSVERIQAVARRVKATVAAGHQVVVVVSAMGKTTDSLVQLAYAISDR
2972 :     PSQREMDMLLSTGEQVSIALLTMALHALGEPAISLTGAQVGIVTEPAHTRARILHIETQR
2973 :     LERHLKAGQVVVVAGFQGITAATDFEVTTLGRGGSDTSAVALAAALRADCCEIYTDVPGI
2974 :     LTADPRLVPNAQLMSEITCDEMLELASLGAKVLHPRAVEIARNYGVDLVVRSSWTDDPGT
2975 :     RVIAPARPPRPVENLELGKPVDGVALDTDQAKVALLRVADRPGVAAQLFGELARQNLDVD
2976 :     LIIQSIHEGQTNDIAFTVQKSVLKQAEAIAVAFYPRLSPRVEETDVLVDADIAKVSITGA
2977 :     GMIGRPGVAAQMFSALAAAGINLQMISTSEVNVSCTVAAADAGRAIAVLSQTFDVEAATT
2978 :     VPQNPPAAPPVRGVALDPKQARIAIRDVPDRPGMAAAIFQTLADAAISVDMIIQSQRSRS
2979 :     LGGVMTRDIAFTVASTDAEDATELLRKVQAQLGYGDVLVDTAIAKVSIVGVGMIHRPGIA
2980 :     AQMFAALARENINIQMIATSEIRVSCVVAESEGVRALRAVHRAFGLDGEAPVAIPDVGK
2981 :     >Tery_Aa_|_CG-32
2982 :     MLIVQKYGGTSVGSVERIKAVAQRIAKTASDRSVVVVVSAMGKTTDTLVKLANDISPNPC
2983 :     RREMDMLLSTGEQVTIALVSMALQELGVPAISLTGAQVGIVTEAQHSRARILHIQTERIE
2984 :     EHLQLGEVVVVAGFQGISQTRHQEITTLGRGGSDTSAVALAAALQAQRCEIYTDVPGILT
2985 :     TDPRIVPEAQLMSEITCDEMLELASLGAKVLHPRAVEIARNYGMPLVVLSSWSDAPGTRV
2986 :     VSAIPKRPALQDLELTKPVDAVEYDTNQAGISMLRLPDRPGVAAQLFSGIALQNIDVDLI
2987 :     IQSIHESNTNDIAFTVSKDVLKQAAAVADAMLPALGKNAHPSLGEPEVKTEERPIAKVSL
2988 :     VGAGMIGRPEVAAKMFEALAAAGVNIIMISTSEVKVSCVVDAEDCKKTVNSLCQAFDVDV
2989 :     ADISSSSTAGESEEVPPPVRGVALDIKQARLAVRQVPDHPGMAAKIFGLLAQQNISVDMI
2990 :     IQSQRCHSVDGVLTRDIAFTVSQPEGETAYQILANTAADFGWGEVVLESSIAKVSVVGSG
2991 :     MISHPGVAAQMFEALAASQINILMITTSEIKISCVVEEEDGVKALQAIHKAFCLSANEVV
2992 :     KVPA
2993 :     >Bant_Aa_|_CG-33
2994 :     METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVSVVSAMGKSTDELVALANAITEN
2995 :     PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITEINTDR
2996 :     IQSYLTKGTIVIVAGFQGVSEDLEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
2997 :     TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSMEQENGTIV
2998 :     KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
2999 :     VHLSFSIHSNDLRETLAVLEQNQEALHYESVEYENHLAKVSIVGSGMVSNPGVAANMFTT
3000 :     LKEEDIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIEPLVQMS
3001 :     >Bcer_Aa_|_CG-33
3002 :     METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVSVVSAMGKSTDELVALANAITEN
3003 :     PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITEINTDR
3004 :     IQSYLTKGTIVIVAGFQGVSEDFEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
3005 :     TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSMEQENGTIV
3006 :     KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
3007 :     VHLSFSIHSNDLRETLEVLEQNQEALHYEAVEYENHLAKVSIVGSGMVSNPGVAANMFTT
3008 :     LKEENIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIVPLVQMS
3009 :     >Bhal-1_Aa_|_CG-33
3010 :     MSIIVQKYGGTSVGSVQRIEHVANRIIATAASGKKVVVVVSAMGKTTDELVGLASEITDE
3011 :     PRKREMDMLLATGEQVTIALLAMALHKRGQEATSLTGWQAGMITESHHGNARILEVERAR
3012 :     MDELLDKVHVVIVAGFQGIDQQGEIMTLGRGGSDTSAVAIAAALKAERCEIYTDVTGVFT
3013 :     TDPRVVKQARKLQTISYDEMLEMANLGASVLHPRAVEFAKNYEIPLLVASSMVDEPGTMI
3014 :     EEEGTMEQNLLVRGIAFENDVTKVTVHGLPNEIHTLPTLFAHLSAAGINVDIIIQNQTDS
3015 :     GMAISFSITQSSLKETLARLEELKGELSFQGIDYEEELAKVSIVGSGMVSNPGVAAKMFE
3016 :     ILAANDIAIKMVSTSEIKVSAVIDEELMVLAVEMLHEQFKLHEEEPAVAVKV
3017 :     >Blic_Ab_|_CG-33
3018 :     MGLIVQKFGGTSVGSVEKILNVAYRVIEEKQRGHDVVVVVSAMGKSTDSLVALAKEITEQ
3019 :     PSSREMDMLLTTGEQVTISLLTMALQNKGYDAVSYTGWQAGIETENIHGNARITNIDTAK
3020 :     LKERLNEGKIAVVAGFQGVTAEGEITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFT
3021 :     TDPRYVKTARKLAGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTEKEAGTLI
3022 :     EEESSMEQNLIVRGIAFEDQITRVTVCGLASGLTTLSTIFTTLAKQNINVDIIIQSVTGT
3023 :     SKTSISFSVKTEDLKRTVEVLEEYKDALDYEQIETENRLAKVSIVGSGMISNPGVAAEMF
3024 :     AVLAEKNIQVKMVSTSEIKVSTVVNEGDMVKAVEALHDAFELSKQTAVI
3025 :     >Bsub_Aa_|_CG-33
3026 :     MGLIVQKFGGTSVGSVEKIQNAANRAIAEKQKGHQVVVVVSAMGKSTDELVSLAKAISDQ
3027 :     PSKREMDMLLATGEQVTISLLSMALQEKGYDAVSYTGWQAGIRTEAIHGNARITDIDTSV
3028 :     LADQLEKGKIVIVAGFQGMTEDCEITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFT
3029 :     TDPRYVKSARKLEGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTETEAGTLI
3030 :     EEESSMEQNLIVRGIAFEDQITRVTIYGLTSGLTTLSTIFTTLAKRNINVDIIIQTQAED
3031 :     KTGISFSVKTEDADQTVAVLEEYKDALEFEKIETESKLAKVSIVGSGMVSNPGVAAEMFA
3032 :     VLAQKNILIKMVSTSEIKVSTVVSENDMVKAVESLHDAFELSKHPSAV
3033 :     >Bthu_Aa_|_CG-33
3034 :     METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVTIVSAMGKSTDELVALANAITEN
3035 :     PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITDIHTDR
3036 :     IQSYLAEGTIVIVAGFQGVSENHEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
3037 :     TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSTEQENGTIV
3038 :     KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
3039 :     VHLSFSIHSNDLRETLKVLEQNQEALHYESVEYENHLAKVSIVGSGMVSNPGVAANMFTT
3040 :     LKEEDIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIEPLVQLI
3041 :     >Linn_Ab_|_CG-33
3042 :     MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGKSTDKLVAMAEEISEA
3043 :     PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIETEAVHSNARIADIDSAR
3044 :     IESALEAGQIVIVAGFQGITTDGEITTLGRGGSDTTAVAIASALKAEKCAICTDVVGVFT
3045 :     TDPRYVKKAQKLEQLTYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHELEPGTMI
3046 :     EEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
3047 :     GHGNLSFTIKTSELLATLAVLEESKELLQIEKLESEQELAKVSIVGSGMVSNPGVAAKMF
3048 :     EALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQFELDK
3049 :     >Lmon_Ab_|_CG-33
3050 :     MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGKSTDKLVAMAEEISEA
3051 :     PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIETEAVHSNARIADIDSAR
3052 :     IESALDAGQIVVVAGFQGFTTDGEITTLGRGGSDTTAVAIASALNAVKCAICTDVVGVFT
3053 :     TDPRYVKKAQKLEQITYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHEQVPGTMI
3054 :     EEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
3055 :     GHGNLSFTIKTSALLATLAVLEESKELLQIEKLESEQDLAKVSIVGSGMVSNPGVAAQMF
3056 :     EALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQFELDK
3057 :     >Lwel_Ab_|_CG-33
3058 :     MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNRVIIVVSAMGKSTDKLVAMAEEISET
3059 :     PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISLTGWQAGIETEAVHSNARIAEIDSSR
3060 :     IESALDLGQIVVVAGFQGFTSDGEITTLGRGGSDTTAVAIASALNAEKCAICTDVVGVFT
3061 :     TDPRYVKNAQKLEQITYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHEKEPGTMI
3062 :     KEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
3063 :     GHGNLSFTIKTSALLATLAVLEESKELLQIEKLESEQELAKVSIVGSGMVSNPGVAAQMF
3064 :     EALTENNIPIKMISTSEIKVSTVVSARNMVEAAQALHDQFELDK
3065 :     >Dole_Aa_|_CG-34
3066 :     MGLVVQKFGGTSVADIEKIRNVANRVIRTATAGNRVVVVLSAMAGITDSLINLANQAAED
3067 :     PDGRELDSLLSTGEQTTVALLAMMLTDMGYKARSLLGFQAGIRTNAAATKARIISIDAEK
3068 :     IRTLLAGGYIVVVAGFQGIDDDGNITTLGRGGSDTSAVALAAAIKADVCEIYTDVDGVYT
3069 :     TDPSICEKARKLSRISYDEMLEMASLGAKVLQIRSVEFAKKYNVPVHVRTSFGEEEGTMV
3070 :     LQEDTGMEELVISGVTCSKGEARITFKKVADVPGVASEIFGPIAEARILVDMIIQNTRAG
3071 :     GQTDLTFTVPRGDYKKALAIAQETGKAIGAEEVMGAENLAKVSIIGVGMKNHSGVASTMF
3072 :     STLAAEGINIQMISTSEIRISCVVEEKYAELAVRVLHTAFGLDKKE
3073 :     >Ddes_Aa_|_CG-34
3074 :     MRILVQKFGGTSVANLECMQQVKQKVLHARENGYKVIAVLSAMSGETNRLLNMAGQWSQC
3075 :     PDEAEVDALISTGEQVSVSLFAMLLQNEGIKARSVLGFQIPLKTNTAYSRARILDIRKDT
3076 :     LVELLEAHDVLAVAGFQGINDDNRITTLGRGGSDTSAVALAAALGCECEIYTDVDGVYTT
3077 :     DPNMCSAARKLDRISYDEMLEMASMGAKVLQIRSVEFAKKYKVPVRVRSTFTNDSGTLLT
3078 :     QEDSQMEAVMVSGIAYDKDQARITLRGVPDTPGVAASLFCPLADAGIVVDMIVQNPSLDG
3079 :     VTDMTFTVPRKDLTRALELVEKTRAEVGAKEVLHDLNVCKVSAIGVGMRNHSGVASKTFA
3080 :     TLRRENINILMISTSEIKITCLIEEKYTELAVRTLHDAFGLDKDQSQAG
3081 :     >Dvul_Aa_|_CG-34
3082 :     MRILVQKFGGTSVANLECMKQVRAKVLAARERGYKVVVVLSAMSGETNRLLALADEWSSE
3083 :     PDPAETDALVVTGEQVSIALFSMLLKDSGIKARSFLGFQIPIVTSDTFGSARILSIDDSR
3084 :     LRAELETHDVLVVAGFQGCTADGRLTTLGRGGSDTSAVALAAALGSVECEIYTDVDGVYT
3085 :     TDPNLCSTARKLDRITYDEMLEMASMGAKVLQIRSVEFAKKYNVPVHVRSTFTDTTGTLV
3086 :     TQEDSSMEAVLVSGIAYDKDQARITLRSVPDRPGVAAAIFVPLSTNGVVVDMIVQNPSRE
3087 :     GVTDMTFTVPRKDLKKTLTLMEGIREETEALEVLHDVSVAKVSAIGVGMRNHSGVAAKAF
3088 :     AALRKENINILMISTSEIKITCLIEEKYTELAVRVLHDAFGLSSNTEH
3089 :     >Lint_Aa_|_CG-34
3090 :     MQILVQKFGGTSVATLECLKQVQQKVTNALNNGFKVVVVLSAKAGKTNTLLELAHSCAEN
3091 :     PDPLELDSLLSTGEHASITLFSLLLNKQGIKTRSLLGWQIPILTNNDFGQARIISINGDM
3092 :     LYKQLKNYDALIIAGFQGVTQEGQITTLGRGGSDTSAVAIAASLGSCKCEIYTDVEGVYT
3093 :     TDPNLCTKARKLAYVSYDEMLEMASMGAKVLQIRSVEFAKKYNVPIKVLSTFSNASGTMV
3094 :     TQENSIMEAVLVSSIAYDNDQARVTLCDIPHHIGTAASIFGPLAEQHILVDMIIQASSRN
3095 :     NLTDITFTVSRKDLTRACNLMEELIKSIGGKSVECATNVAKVSLIGVGMRNHAGVAAKAF
3096 :     NALKDENIDILLISTSEIKISCLIEEKYTELAVRTLHDVFELQNDVASLS
3097 :     >Saci-5_Aa_|_CG-34
3098 :     MALVVQKYGGTSVANLEKIENVARKVIKTKKEGNDVVVVLSAMAGETNRLIELARQAAED
3099 :     YDVREYDTLISTGEQVTISLLAMVLNRMGYPARSFLGHQVRIMTDQAYTQARILDVEDRL
3100 :     LRGELEKGKIAVVAGFQGVDQDNNITTLGRGGSDTSAVALAAALHADVCEIYTDVDGVYT
3101 :     TDPNICSNARLLEKISYDEMLEMARAGAKVLQPRSVELAKKYEVPVYVKSSFKDEVGTLV
3102 :     TKEDKDMEREVVSGVTYDRDQAKITVVHVPDKSGVAARLFTPLAEHNIVVDMIIQNASLE
3103 :     GYTDLSFTVSRKDIKETKRLIEEAAKEVGASKVEVDEQVAKVSIIGVGMISHSGVAARMF
3104 :     AALAQEGINIMMISTSEIKVSCVIQSKYTELAVMVLHEVFGLDKKS
3105 :     >Cjej_Aa_|_CG-35
3106 :     MLIVQKYGGTSVGTLERIEAVANRVIQSAQQGNQLVVVVSAMSGVTNTLIEQAEYFSKTP
3107 :     NGKDMDMLLSSGERVTSALLSIALNEKGCPAISFSGRKAGIITDSVFTKARIHHIDTKAI
3108 :     KSELQNGKIVVIAGFQGVDEEGNVTTLGRGGSDLSAVAVAGALNADLCEIYTDVDGVYTT
3109 :     DPRIEPKAKKLDKISYEEMLELASLGAKVLQNRSVELAKKLNVNLVTRSSFNNNEGTMIT
3110 :     KEDGMEQALVSGIALDKNQARVTLRNIEDKPGIAAEIFSVLANENINVDMIIQNVGVDGA
3111 :     TNLGFTVPQNELELAKNAMQKILSSKTTIESDSAVLKVSIVGVGMKSHSGVASKAFKALA
3112 :     DEGINIGMISTSEIKISMIVHEKYGELAVRALHECYGLDK
3113 :     >Haci_Aa_|_CG-35
3114 :     MLIVQKYGGTSMGSVERIHNVAQRVLESVKLGHQVVVIVSAMSGETDRLLEFGKNFSHNP
3115 :     SKREMDRIVSVGELISSAALSMALERYGYKAISLSGKEAGILTNSHFQSAVIQSIDNKRI
3116 :     RELLEKNYIVVIAGFQGADTHGETTTLGRGGSDLSAVALAGALKADLCEIYTDVDGVYTT
3117 :     DPRIEEKAQKIAQISYDEMLELASMGAKVLLNRSVELAKKLSVKLVTRNSFNHSEGTLIV
3118 :     AEKDFKGERMETPIVSGIALDKNQARVSMEGVEDRPGIAAEIFGALAEYRINVDMIVQTI
3119 :     GRDGKTDLDFTIVKTQIEETKYALKPFLSQIDSIDYDENIAKVSIVGVGMKSHSGVASTA
3120 :     FKALAKDNINIMMISTSEIKISVLIDIKYAELAVRTLHAVYELDK
3121 :     >Hhep_Aa_|_CG-35
3122 :     MLIVQKYGGTSMGDCDRIHNVAKRVIKSKAQGHKLVVVVSAMGGETDRLINFTQHFTPLP
3123 :     NTREVDMALSAGERVSAALLAIALESMGVKAISLSGRGAGIITDEFHTKARISYIDTTKI
3124 :     FHLLNEDYVVVVAGFQGISQQGEVTTLGRGGSDLSAVALAGALNATVCEIYSDVDGIYTT
3125 :     DPRIVKNARKLEKISYDEMLELASMGAKVLLNRSVELAKKLNVNLICASSFSEAQGTLIT
3126 :     KEEDIMEKPVVSGVALDKNQARVSLADVQDRPGIAADIFGLLADNNINVDMIVQTIGRDG
3127 :     KTDIDFTIPKTEVTLTQQVLEKFKDDLGNIEYDNNIAKVSIVGVGMKSHSGVASTAFKAL
3128 :     AQDDINIMMISTSEIKISMIINAQFAELAVCKLHSVYELDK
3129 :     >Hpyl_Aa_|_CG-35
3130 :     MLIVQKYGGTSMGSIERIHNVAQRVLESVKLGHQVVVVVSAMSGETDRLLEFGKNFSHNP
3131 :     NKREMDRIVSAGEWISSAALSMALERYGHRAISLSGKEAGILTSSHFQNAVIQSIDTQRI
3132 :     TELLEKNYIVVIAGFQGADIQGETTTLGRGGSDLSAVALAGALKAHLCEIYTDVDGVYTT
3133 :     DPRIEEKAQKIAQISYDEMLELASMGAKVLLNRSVELAKKLSVKLVTRNSFNHSEGTLIV
3134 :     AEKDFKGERMETPIVSGIALDKNQARVSMEGVEDRPGIAAEIFGALAEYRINVDMIVQTI
3135 :     GRDGKTDLDFTIVKTQIEETKQALKPFLAQMDSIDYDENIAKVSIVGVGMKSHSGVASIA
3136 :     FKALAKDNINIMMISTSEIKISVLIDIKYAELAVRTLHAVYQLDQ
3137 :     >Sden-1_Aa_|_CG-35
3138 :     MLIVQKFGGTSVGDLERIQNVASRVCETKKAGNDVVVVVSAMSGETNKLLAYAEHFSKNP
3139 :     QRAEVDMLLSSGERVTASLLAIALSEMGCEAVSMTGRKAGIVTDNIHTKARIEEIDPTAM
3140 :     NKAIKDGKIVVVAGFQGISQDGNVTTLGRGGSDLSAVAIAGAIKADLCEIYTDVSGIFTT
3141 :     DPRIEPRAKKLDKISYDEMLELASLGAKVLQNRSVELAKKLNVNLVTRTSFSNEEGTLIT
3142 :     KEENIMEKPLVSGIALDKNQARVSLVGVKDRPGIASDIFTKLSNNSVNIDMIIQNVGHDG
3143 :     KANIDFTVPVNDLADAKKVMDSFVKESEVDEVSYDENICKVSIVGVGMKSHTGVAAKAFS
3144 :     VMAAENININMISTSEIKISMIIAEKYAELAVRALHSAYELDK
3145 :     >Wsuc_Aa_|_CG-35
3146 :     MLIVQKYGGTSVGDLDRIQNVANKVAKTKKEGHRLVVVVSAMSGETDKLLGYAKHFSQIP
3147 :     DPRELDMILSSGERVTSALLALALQAMGFKSISLSGRGAGMITDKSHSKARIDHIDTARI
3148 :     DSLLEDDTIVVVAGFQGITPDGEVTTLGRGGSDLSAVALAGALKADLCEIYTDVEGVYTT
3149 :     DPRIEPKAKKIDKISYDEMLELASMGAKVLLNRSVELAKKLNVNLITKSSFSDNPGTLIT
3150 :     KEEEIMENPVVSGIALDKNQARVSITNVQDRPGIAAEIFGALAEANINVDMIVQTIGYDS
3151 :     LTDMDFTIPKTELESAKLVLKRFEGSVGGIEFDDNIAKVSIVGVGMKSHTGVASKAFKAL
3152 :     AQDNINIMMISTSEIKISMIINLKYAELSVRTLHATYELDK
3153 :     >Gmet_Aa_|_CG-36
3154 :     MALVVQKYGGTSMGSIERIRNVAKRVAKTYDAGNDMVVVVSAMSGETNKLVALANEVCEF
3155 :     PDNREYDVLVASGEQVSIALLAMCLKSMGYKAKSYHGWQVPIITDSVFSKARIEEIPDAK
3156 :     VRADLKDGTIVVVAGFQGIDKDGNVTTLGRGGSDTSAVAMAAAMKADVCEIYTDVDGVYT
3157 :     TDPNICEDARKIDKISYDEMLELASLGAKVLQIRSVEFAKKYNVDIHVRSSFNDNQGTMV
3158 :     TKEDKDMEAVLVSGIAYDKNEAKIAVLGVPDKPGIAAKILSSLSDANISVDMIVQNVSGG
3159 :     DLTDFTFTVTKADFKKALAITKEIATEIKATGVSADESISKVSIVGVGMRSHAGVATKMF
3160 :     QTLANEGINIQMISTSEIKVSVVIDAKYTELAVRVLHEAFGLSGK
3161 :     >Gsul_Aa_|_CG-36
3162 :     MALVVQKYGGTSMGSIERIRNVAKRVAKTYDAGNDMVVVVSAMSGETNKLVALANEICEF
3163 :     PDTREYDVLVASGEQVSIALLAMCLKSMGYKAKSYHGWQIPIITDSAFSKARIESIDDTK
3164 :     VRADLKDGSIVIVAGFQGVDKDGNITTLGRGGSDTSAVAVAAAFKADVCEIFTDVDGVYT
3165 :     TDPNICQDARKIEKVSYDEMLELASLGAKVLQIRSVEFAKKYNVDVHVRSSFNENPGTMV
3166 :     TKEDKDMEAVLVSGIAYDKNEAKIAVMGVPDKPGIAAKILSPLSDANISVDMIVQNVSGG
3167 :     DLTDFTFTVTKADFKKALAITKEVAKEISAKEVAEDENISKISIVGVGMRSHAGVATKMF
3168 :     QTLAKEGINIQMISTSEIKVSVIVDAKYTELAVRVLHEAFGLSGK
3169 :     >Gura_Aa_|_CG-36
3170 :     MALVVQKYGGTSMGSVERIRNVAKRVAKTYDAGNDMVVVVSAMSGETNKLVALANDICEF
3171 :     PDNREYDVLVASGEQVSIALLAICLKSMGYKAKSYHGWQIPIITDNAYSKARIESIDDTK
3172 :     IRADIKDGTILVVAGFQGVDKDGNITTLGRGGSDTSAVAMAAALKADVCEIFTDVDGVYT
3173 :     TDPNICEDAKKIEKISYDEMLELASLGAKVLQIRSVEFAKKYDVDVHVRSSFNDNPGTMV
3174 :     TKEDKDMEAVLVSGIAYDKNETKIAVMQVPDKPGIAAKILSPLSDANISVDMIVQNVSEA
3175 :     GFTDFTFTVTKADFKKALAITKEVARDIDAKEVLTDENISKVSVVGVGMRSHAGVATKMF
3176 :     QALAKEGINIQMISTSEIKVSVVVDAKYTELAVRVLHDAFGLSGKAA
3177 :     >Pcar_Aa_|_CG-36
3178 :     MALVVQKYGGTSVGDVDRIRNVARRVAKTYDDGNDVVVVVSAMSGETNKLVALANELCDF
3179 :     PSEREYDVLVSTGEQVTIALLSMCLQSMGYKAKSYLGHQIPIFTDSTFSKARIESIDDKN
3180 :     IREDLNNGTIIVVAGFQGIDHDGNLTTLGRGGSDTSAVAVAAALKADVCEIYTDVDGVYT
3181 :     TDPRIVADATKIEKISYDEMLEMASLGAKVLQIRSVEFAKKYGVIVHVRSSFNDNPGTLV
3182 :     TKEDEDMETVLVSGVTYNKDEAKISVMGVPDKPGVAAKLFTPLTTSNITVDMIIQNVSND
3183 :     GLTDLTFTVPRGDFKKALKAVEETAREIGAAGVRSDENIAKVSIVGVGMRSHSGIASKMF
3184 :     RVLSQEGINIQMISTSEIKVSCVIDAKYTELAIRVLHQAFGLDKKDSKAE
3185 :     >Ppro_Aa_|_CG-36
3186 :     MALVVQKYGGTSVGNPDRIRNVAKRVARTCDAGNELIVVLSAMSGETNRLVSLANEMCEL
3187 :     PHGREYDTLVSTGEQVTIALLAMHLKSMGYKAKSYLGWQVPIITDDTATKARIERIEDAR
3188 :     IRADLNEGTIVIVAGFQGIDANGNITTLGRGGSDTSAVALAAALKADVCEIYTDVDGVYT
3189 :     TDPNICKEARKMESISYDEMLELASLGAKVLQIRSVEFAKKYNVNVHVRSSLNDNTGTMV
3190 :     TRENKDMEGILVSGVAYDKNEAKIVVMGVADKPGTAARILSALSDASIPVDMIVQNVSQA
3191 :     GLADFTFTVNKTDLKQAMQITNQVAGELQAREVISDEKISKISIVGLGMRSHAGVATTMF
3192 :     SALAAANINIQTISTSEIKISVIIDDKYTELAVRVLHEAFNLQG
3193 :     >Ccre_Aa_|_CG-37
3194 :     MSRLVMKFGGTSVADLERIRRVARLVAAEVATGKQVAVVVSAMSGKTNELVAWTDGAGRA
3195 :     AAGLPESDDEYDAVVASGEQVTAGLLAMTLRNMGHKARSFLGWQVPILTDEAHGRARIEE
3196 :     IPPENLEECFANGEIAVIAGFQGVTPNRRITTLGRGGSDTSAVAIAAAVKGDCDIYTDVD
3197 :     GVYTTDPRIESKARRLAKISYEEMLEMASLGAKVLQTRSVEMAMAHRVPVRVLSSFVEPG
3198 :     EAPGQGTIVCDEEEIMEKRIVSGVAYSRDEAKITLLGLPDHPGVSSQIFGRLAEANVNVD
3199 :     MIVQSRARSADTANMEFTVGKRDATRAVEIVQAAQKEIGFEAVAVNEDVAKVSVIGVGMR
3200 :     SHAGVAQSMFQALAEKNINIQVISTSEIKISVLIDAAYTELAVRALHAVYGLDQL
3201 :     >Bhen_Aa_|_CG-37
3202 :     MARIVMKFGGTSVANIERIYNVAQHVKREVDAGNEVAVVVSAMAGKTNELVQWTCDASPI
3203 :     HKDAYEYDVVVASGEQVTAGLLALTLQEMGVNARSWLGWQIPIHTDSAHGSARITDIDGS
3204 :     FLIQRFQEGQVAVIAGFQGLAPDNRISTLGRGGSDTSAVAMAAAIQADRCDIYTDVDGVY
3205 :     TTDPRVEPKARRLPKVAFEEMLEMASLGAKVLQVRSVELAMVHNVRTFVRSSFEDPNALG
3206 :     MGDPMNSSGTLICDEDEIVEQQNVTGIAFAKDEAQISLRRLADRPGISAAIFGPLAEARI
3207 :     NVDMIVQNISEDGSKTDMTFTVPSADVDKAVALLEKNRKEIGFDVIQSESGLAKISVIGV
3208 :     GMRSHAGVAATAFRALAEKGINIQAITTSEIKISILIDSVYTELAVRTLHAVYGLDKG
3209 :     >Bqui_Aa_|_CG-37
3210 :     MARIVMKFGGTSVANIERIHNVARHIKREVDAGNEVAVVVSAMAGKTNELVQWTRDASPM
3211 :     HKDADEYDVVVASGEQITAGLLALKLQAMGVNARSWLGWQIPIHTDNVHGSARITDINGS
3212 :     FLIQRFQEGQVAVIAGFQGLAPDNRISTLGRGGSDTSAVAIAAAVQADRCDIYTDVDGVY
3213 :     TTDPRIEPKARLLPKVAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFEDPDALG
3214 :     MDDPINSSGTLICDEDEILEQQNVTGIAFAKDEAQISLRRLADRPGISAAIFGPLAEERI
3215 :     NVDMIVQNISEDGSKTDMTFTVPSVDVEKAVTLLEKNRKEIGFDVLQFERNLAKVSVIGI
3216 :     GMRSHAGVAATAFKALSEKGINIQAITTSEIKISILIDHAYTELAVRTLHALYGLDKG
3217 :     >Bjap_Aa_|_CG-37
3218 :     MSRLVMKFGGTSVANIERIRNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPM
3219 :     HDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKTSDAHASARIEDIDGSE
3220 :     IIKRFRDRKEVAVIAGFQGINPETNRITTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGV
3221 :     YTTDPRIVPKAKRLGKIAFEDMLELASQGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
3222 :     DPHANQPPGTLICSEEEIMESHVVTGIAFSKDEAQISVRQIEDKPGVAASIFGPLADANI
3223 :     NVDMIVQGVSEDGKTTDLTFTVPAADFTRARDTITAAKGKIGYARLDTATDVAKISVIGS
3224 :     GMRSHAGVAAQAFSALAGRNINIRAITTSEIKFSVLIDTAYTELAVRTLHTLYGLDQA
3225 :     >BRAD-1a_|_CG-37
3226 :     MGRLVLKFGGTSVANIDRIRNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPM
3227 :     HDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKTSDAHASARIVDIDGSE
3228 :     LIQRFQERKEVAVIAGFQGINPATNRITTLGRGGSDTSAVAIAAAIKADRCDIYTDVDGV
3229 :     YTTDPRVVPKAKRLDKIAFEDMLELASQGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
3230 :     DPHAKQPPGTLICSEEQIMENHVVTGIAFSKDEAQISVRQIEDKPGIAASIFGPLADANI
3231 :     NVDMIVQNVSEDGKTTDLTFTVPATDYNRARETIAAAKDKIGYQRLDTATDVAKVSVIGS
3232 :     GMRSHAGVAAKGFAALAARNINIRAITTSEIKFSVLIDAVYTELAVRTLHTLYGLDQA
3233 :     >Nham_Aa_|_CG-37
3234 :     MSRLVMKFGGTSVANLDRIRNVARHVKREVDAGHDVAVVVSAMAGKTNDLVAWCRDASPM
3235 :     HDAREYDAVVASGEQITSGLLAIALQALGIQARSWQGWQIPIRTSDAHASARILGIDGSE
3236 :     LVNRFTERKEVAVIAGFQGINPQTGRITTLGRGGSDTSAVAIAAAIHADRCDIYTDVDGV
3237 :     YTTDPRVVPKARRLDRIAFEEMLELASQGAKVLQVRSVELGMTQNMPIFVRSSFDKPEDI
3238 :     DPHGTPPGTLICGEEEIMESHVVTGIAFSKDEAQISLRQIEDKPGVAASIFVPLADANIN
3239 :     VDMIVQSVSEDGKTTDLTFTVPAADYARARETITRAKDKIGYARLDSATDLAKISVIGSG
3240 :     MRSHAGVAAQAFKALSEKSINIRAITTSEIKFSLLIDTAYTELAVRTLHTLYGLDHT
3241 :     >Nwin_Aa_|_CG-37
3242 :     MSRLVMKFGGTSVANLDRIRNVARHVKREVDAGHDVAVVVSAMAGKTNELVAWCRDASSM
3243 :     HDAREYDAVVASGEQITSGLLAIALQALGIQARSWQGWQIPIRTSDAHASARILEIDGSE
3244 :     LISRFTERKEVAVIAGFQGISPQTGRITTLGRGGSDTSAVAIAAAIRADRCDIYTDVDGV
3245 :     YTTDPRVVSKARRLDRIAFEDMLELASQGAKVLQVRSVELGMTQNMPIFVRSSFDAPEEI
3246 :     DPHGTPPGTLICGEEDIMESHVVTGIAFSKDEAQISVRQIEDKPGVAASIFVPLADANIN
3247 :     VDMIVQNVSEDGKTTDLTFTVPASDHARAKETITRAKDMIGYARLDSATDVAKISVIGSG
3248 :     MRSHAGVAAQAFKALSDKGINIRAITTSEIKFSLLIDTAYTELAVRTLHTLYGLDQT
3249 :     >Rpal_Aa_|_CG-37
3250 :     MGRLVMKFGGTSVANIERIQNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPL
3251 :     HDAREYDAVVASGEQVTSGLLAIALQSLGIQARSWQGWQIPILTSDAHASARIVGIDGSE
3252 :     IIKRFSERKEVAVIAGFQGIHAETGRITTLGRGGSDTSAVAIAAALKADRCDIYTDVDGV
3253 :     YTTDPRVVPKARRLDKVSFEEMLELASLGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
3254 :     DPHGTPPGTLISSEENSMENHVVTGIAFSKDEAQISVRRIEDKPGVAASIFGPLADANIN
3255 :     VDMIVQNVSEDGKTTDLTFTVPASDFARAKQTITSAQDKIGYARFDSETDVAKVSVIGSG
3256 :     MRSHAGVAAQAFAALAARNINIRAITTSEIKFSVLIDAAYTELAVRTLHTLYGLDQV
3257 :     >Babo_Aa_|_CG-37
3258 :     MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
3259 :     CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
3260 :     QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
3261 :     DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFT
3262 :     DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
3263 :     LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
3264 :     ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
3265 :     LDK
3266 :     >Bmel_Aa_|_CG-37
3267 :     MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
3268 :     CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
3269 :     QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
3270 :     DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFT
3271 :     DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
3272 :     LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
3273 :     ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
3274 :     LDK
3275 :     >Bsui_Aa_|_CG-37
3276 :     MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
3277 :     CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
3278 :     QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
3279 :     DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVFQVRSVELAMVHKVRTFVRSSFT
3280 :     DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
3281 :     LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
3282 :     ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
3283 :     LDK
3284 :     >Mlot_Aa_|_CG-37
3285 :     MARIVMKFGGTSVADIARIRNVARHVKREVDAGHEVAVVVSAMAGKTNELVGWTREASPM
3286 :     HDAREYDAVVASGEQVTAGLLAITLQNMGVHARSWQGWQIPIKTDNAHGAARILDIDGAF
3287 :     LIKRFGEGQVAVIAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYTDVDGVYT
3288 :     TDPRIEPKARRLAKISFEEMLEMASLGAKVLQVRSVELAMVHRVRTFVRSSFDDPDAPGM
3289 :     GDLLNPPGTLICDEEEIVEQQVVTGIAYAKDEAQISLRRVGDRPGVAAGIFGPLAEANIN
3290 :     VDMIVQNISEDGKFTDMTFTVPSGDVDKALAVLDRLKAEVGYDVVQSEAGMSKVSVIGIG
3291 :     MRSHAGVAATAFKALADKAINIRAITTSEIKISILIDGPYTELAVRTLHSVYGLDKQ
3292 :     >MESO-1a_|_CG-37
3293 :     MARIVMKFGGTSVADLDRIHNVARHVKREVEAGHQVAVVVSAMSGKTNELVGWVQGMPKA
3294 :     AGAKSPFYDAREYDTVVASGEQVTSGLLAIALQSIGIDARSWQGWQIPIRTDNAHGAARI
3295 :     TDIDGSDIIERMERGQVAVVAGFQGLAPDNRVATLGRGGSDTSAVAVAAALRADRCDIYT
3296 :     DVDGVYTTDPRIEPRARRLAKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
3297 :     DPDAPGMGDFDNPPGTLICDEEEIVEQQVVTGIAYAKDEAQISLRRVADRPGVSAGIFGP
3298 :     LAEANINVDMIVQNVSEDGSKTDITFTVPTGDVEKALSVLEKVRGTVGFDAIQSEAGLVK
3299 :     VSVIGIGMRSHAGVAATAFSALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHSVYG
3300 :     LDKH
3301 :     >Atum_Aa_|_CG-37
3302 :     MVLVKAMARIVMKFGGTSVANLERIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVDWV
3303 :     QNAAKVAGTNAASFYDAREYDAVVASGEQVTSGLLAITLQSMGINARSWQGWQIPIRTDN
3304 :     AHGAARILEIDGSDIVHRMGEGQVAVVAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKA
3305 :     DRCDIYTDVDGVYTTDPRIEPKARRMKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRT
3306 :     FVRSSFEDPDAPGMGDLINPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRVADRPGV
3307 :     SAAIFGPLAEAHINVDMIVQNISEDGSRTDMTFTVPSGDVAKALRVLDENKGQIGFDVAQ
3308 :     NETGLAKVSVIGIGMRSHAGVAASAFKALAEKNINIKAITTSEIKISILIDGAYAELAVR
3309 :     TLHSAYGLDKA
3310 :     >Retl_Aa_|_CG-37
3311 :     MARIVMKFGGTSVADLDRIKNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVQGTPKV
3312 :     IGANSPFYDAREYDAVVASGEQVTSGLLAIALQAMDINARSWQGWQIPIRTDNAHGAARI
3313 :     LEIDGSDIIKRMGEGQVAVIAGFQGLGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYT
3314 :     DVDGVYTTDPRIVPQARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
3315 :     DPDAPGMGDLLNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
3316 :     LAESHINVDMIVQNISEDGSKTDMTFTVPSGDVEKAIKVLGDHKEKIGYDVVQNESGLVK
3317 :     VSVIGIGMRSHAGVAATAFRALAEKGINIKAITTSEIKISILIDGPYAELAVRTLHSCYG
3318 :     LDKN
3319 :     >Rleg_Aa_|_CG-37
3320 :     MARIVMKFGGTSVADLDRIKNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVQGTPKV
3321 :     IGANSPFYDAREYDAVVASGEQVTSGLLAIALQAMDINARSWQGWQIPIRTDNAHGAARI
3322 :     MEIDGSDIVKRMGEGQVAVISGFQGLGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYT
3323 :     DVDGVYTTDPRIVPKARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
3324 :     DPDAPGMGDLLNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
3325 :     LAESHINVDMIVQNISEDGSKTDMTFTVPSGDVEKAIKVLGDHKEKIGYDVVQNESGLVK
3326 :     VSVIGIGMRSHAGVAATAFRALAEKGINIKAITTSEIKISILIDGPYAELAVRTLHSCYG
3327 :     LDKN
3328 :     >Smel_Aa_|_CG-37
3329 :     MARIVMKFGGTSVADLNRIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVENMPKV
3330 :     AGSNAPFYDAREYDAVVASGEQVTSGLLAIALQSMGINARSWQGWQLPIKTDNAHGAARI
3331 :     LEIDGADVIRRMGEGQVAVVAGFQGLGPDNRLATLGRGGSDTSAVAIAAAVKADRCDIYT
3332 :     DVDGVYTTDPRIEPKARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
3333 :     DPDAPGMGDLMNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
3334 :     LAEAHINVDMIVQNISEDGSKTDMTFTVPSGDVDKALRVLGDNKEKIGYDVIQSESGLVK
3335 :     VSVIGIGMRSHAGVAASAFRALADKGINIKAITTSEIKISILIDGPYAELAVRTLHSVYG
3336 :     LDKS
3337 :     >Hnep_Ab_|_CG-37
3338 :     MARTVLKFGGTSVGDLDRIANVAEIVAARAAKGEKMAVIVSAMSGETNKLVALADGAAGK
3339 :     DLPRSLYDDEYDVVVASGEQVTAGLLALALRRRGLKARSWLGWQLRLKTDNSHGRARIMG
3340 :     FDDSSLPDSIDSGEIAVVAGFQGVTDDFRVTTLGRGGSDTSAVAVAAALGAQVCDIYTDV
3341 :     DGVYTTDPRIVPKARRIDKISYEEMLEMASLGAKVLQTRSVELAMNHGVPVRVLSSFVKP
3342 :     GEESPGTLVCSEEEIVEKQVVSGVAYSRDEAKVTLYGVPDKPGSSAKIFSALARAGVNVD
3343 :     MIVQASSREASKANLVFTCTDRDSPFARETLEGLQAEVGYDRIEVIRDVSKISIIGVGMK
3344 :     SHTGVAEKMFTALSEKSINIDVIATSEIKISVLIAAPYTELAVRALHTAFGLDAD
3345 :     >JANN-1a_|_CG-37
3346 :     MPLLVMKFGGTSVATLDRIRRAAKRVGREVANGYDVIVIVSAMSGETNKLVGFVEETGPF
3347 :     YDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPLLTTDAHASARIEEIPTDN
3348 :     LNAKFGEGMKVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAASFGAERCDIYTDVDGVY
3349 :     TTDPRITTKARKLDKISFEEMLELASLGAKVLQTRSVELAMRYRVRLRVLSSFEEMSDNA
3350 :     GTLVCAEEDIVEKNVVAGVAYSRDEAKMTLQSVEDRPGIAAAIFGPLAEAGVNVDMIVQN
3351 :     ISDGGITDMTFSCPVGEVARAEKAMGDAKASGDIGFASLIADTDVAKVSIVGIGMRSHAG
3352 :     VAAKMFQTLRDEGVNIKVITTSEIKVSVLIDRKYMELAVQALHDAFGLEKAA
3353 :     >Pden_Aa_|_CG-37
3354 :     MPLLVMKFGGTSVADLDRIKNAALKVQREVERGYDVIVIVSAMSGKTNELVGWVEATSPL
3355 :     FDAREYDAVVASGENITAGLMALTLQELGVPARSWQGWQVPINTTSQHSAARFVSIPRDN
3356 :     IDQKFAEGMRVAVVAGFQGLGSDNRITTLGRGGSDTTAVAFAAAFGAERCDIYTDVDGVY
3357 :     TTDPRITSKARKLKKIAFEEMLELASLGAKVLQTRSVELAMRYKVRLRVLSSFEETDENS
3358 :     GTLVCDEDEIMESKVVNGVAYSREEAKITLVTVEDRPGISAAIFAPLAEAGVNVDMIVQN
3359 :     ISEKDYEDHPGSVTDMTFSCPVNQVARARKAMEDAKAAGHIAYDDLVVDTEVAKVSVVGI
3360 :     GMRSHAGVAARMFKALADENINIKVISTSEIKISVLIDRKYMELAVQALHDAFELEKP
3361 :     >Rsph_Aa_|_CG-37
3362 :     MPLLVMKFGGTSVADLARIKNAAQKVKREVERGYDVIVIVSAMSGKTNELVGWVEQTSPL
3363 :     FDAREYDAVVSSGENVTAGLMALTLQEMEVPARSWQGWQVPIRTTSQHSAARFLEIPREN
3364 :     LDAKFAEGFKVAVVAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFAAERCDIYTDVDGVY
3365 :     TTDPRIASKARKLEKIAYEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEDTDETS
3366 :     GTLVCDEEDIMESKVVSGVAYSRDEAKMTLVTVEDRPGVAAAIFGPLAEAGVNVDMIVQN
3367 :     ISEKDYGSHPGSVTDMTFSCPINQVARARKALEDAKAEGTIVYDDLVVDTEVAKVSVVGI
3368 :     GMRSHAGVAATMFKALAADGVNIKVIATSEIKISVLIDRKYMELAVQALHDAFALETAN
3369 :     >Rden_Aa_|_CG-37
3370 :     MPVLVMKFGGTSVATLDRIRRVAKRVGVEVAKGYDVIVIVSAMSGKTNELVGWVNEISPL
3371 :     HDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPVRTTNAHSSARIEEIPTEN
3372 :     IRAKFAEGMRVAVVAGFQGLSPEGRITTLGRGGSDTTAVAFAAAFEAERCDIYTDVDGVY
3373 :     TTDPRVSAKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDTA
3374 :     GTLVCDEEEIMESNVVAGVAFSRDEAKMTLLSVADRPGIAANIFTALSDAGVNVDMIVQN
3375 :     IAEEGRTDMTWSCPTDHVARAQKAVENAKSEGVINYHEVIADLDVAKVSVVGIGMRSHTG
3376 :     VAAKMFQVLSAEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELEKAA
3377 :     >Spom_Aa_|_CG-37
3378 :     MPTLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYDVIVIVSAMAGKTNELVGWVNETSPL
3379 :     FDAREYDAVVSSGENITAGLMALTLQEMDIPARSWQGWQVPLMTNSAHSQARIEEIPPHN
3380 :     INQKFAEGMKVAVIAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFEADRCDIYTDVDGVY
3381 :     TTDPRICTKARKLEKISFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDTA
3382 :     GTLVVDEEEIMESNVVSGVAYSRDEAKMTVVSVQDRPGVAATIFNALSEGGVNVDMIVQN
3383 :     VSEEGITDMTFSCPTDQVARAEKAMNAVKDAGELEFEDLLVDYDVCKVSVVGIGMRSQSG
3384 :     VAAKMFKILSDEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELDKAA
3385 :     >SILI-1a_|_CG-37
3386 :     MPLLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYDVIVIVSAMSGKTNELVGWVGETSPL
3387 :     YDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPLKTNSAHSQARIEEIGTEN
3388 :     INQKFGEGMKVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAAAFGAERCDIYTDVDGVY
3389 :     TTDPRICEKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDEA
3390 :     GTLVCDEEEIMESNVVNGVAYSRDEAKLTCLSVADRPGIAATIFGCLSDAGVNVDMIVQN
3391 :     ISEDGRTDMTFSCPTDQVQRAEMALNAYKEKGELNFAELVADTGVAKISVVGIGMRSQSG
3392 :     VAAKMFKVLSDEGINIKVITTSEIKISVLVDRKYMELAVQALHDAFELDKAS
3393 :     >Acry_Aa_|_CG-37
3394 :     MARIVMKFGGTSVADLDRIRNVAARVKRVVDEGHEVAVVTSAMAGATNQLVAWCQELSPL
3395 :     YDAREYDTVVATGEQVTIGLLAVALQTIGVDARSWTGWQIPIRTDGQHGKARIDAIDGAE
3396 :     LIRRMQMGQVPVIAGFQGIGPDNRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
3397 :     TDPRIVPKARKLPAIAYEEMLELASVGAKVLQTRSVELAMKERVRVQVLSSFTDAPGTLV
3398 :     VDEDEIVEQEIVAGIAYSRDEAKVTVRRVPDRPGVAASVFGPLAEAGINVDMIVQNVSAD
3399 :     GTTDMTFTLNKTELPRARLVLDEKRDEIGFAELATDPDVAKISVVGVGMRSHAGVAGTMF
3400 :     RSLAARGINIQVISTSEIKVSVLIDAEYTELAVRALHTAYGLDVA
3401 :     >Goxy_Aa_|_CG-37
3402 :     MSLPYPMPDPSAQRQTRTGALSAMSMPDTPVHDQVSGRADPHAAIKGESGKRKTVVMKFG
3403 :     GTSVGNIERIRNVAKRVKAEHDRGRRVAVVVSAMAGVTNRMVGYCAELDPLADPKEYDAV
3404 :     VAAGEQVTSGLVSIALQALGVKARSFQGWQIPLVTDDAHGKAAIESVDGTALLACLDDDV
3405 :     VPVVAGFQGVGPDGRIATLGRGGSDTSAVAVAAAINADQCDIYTDVDGIYTTDPRIVKRA
3406 :     KKLDRITYEEMLELASVGAKVLQTRSVGLAMREGVRVRVLSSFAETDDDSGSIVVDEDEI
3407 :     MEKELVAGIANSHDEAKISVRNIPDRPGIAAAIFDPLAAANINVDMIVQSVGVDNMTNMT
3408 :     FTVSKADEAAARAVLEKAREYVQYGELITSHNVVKISVVGIGMRSNAGLAARMFRTLADR
3409 :     GINVQVISTSEIKISVLIDSEYTELAMRALHTAYGLDAKEGADA
3410 :     >Gbet_Aa_|_CG-37
3411 :     MARIVMKFGGTSVGDLDRIRNVARLVKREVDAGNEVSVVVSAMSGVTNQLVGYCQSLSPL
3412 :     HDAREYDTVVATGEQVTTGLLSIALQEAGVDARSWLGWQLPIRTDNAHGKARIESIEGGE
3413 :     LINRMQAGQVPVVAGFQGIGPDHRITTLGRGGSDTSAVAVAAAVRADRCDIYTDVDGVYT
3414 :     TDPRIVARARKLDRISYEEMLELASVGSKVLQTRSVELAMKERVRVRVLSSFADPEGENV
3415 :     GTLVVDEDEIVEKEIVSGIAYSRDEAKITVRRVPDRPGVAAHVLGPLTEANVNVDMIVQN
3416 :     VAEDGTTDMTFTVGTSDLPRAQAALSAAQVEIGFAEMSADPQVCKISVVGVGMRSHVGVA
3417 :     TTMFRTLAEKGINIQVISTSEIKVSVLIAEEYAELAVRALHTAYGLDAA
3418 :     >Mmag_Aa_|_CG-37
3419 :     MARIVMKFGGTSVADIERIKNVANRVKREFDAGNQVAVVVSAMSGATNQLVAWCNQVAPL
3420 :     HDAREYDAVVATGEQVTTGLLAIALQELGVNARSWCGWQLPIRTDGVHGKARIMSIETDE
3421 :     MIARMGKGEVAVVAGFQGLGPDNRIATLGRGGSDTSAVALAAALHADRCDIYTDVDGVYT
3422 :     TDPRIVSVAKKLDKITYEEMLELASVGAKVLQTRSVEMAMKHRVRVQVLSSFEDKPGTLV
3423 :     CDEDEIVEKELVSGIAYSRDEAKITLVRVADRPGVAASIFGPLAEAAVNVDMIVQNVSED
3424 :     GKSTDLTFTVGNADLERAKKVLEDAKGNLGFEKLLADPNVVKVSVIGVGMRSHAGIAQKM
3425 :     FQTLASEGINIQVISTSEIKISVLIEEKYTELALRALHTAYGLDAA
3426 :     >Rrub_Aa_|_CG-37
3427 :     MARIVMKFGGTSVGDVDRIRNVARRVKAEVDAGNEVAVVVSAMSGETNRLVGFCDSMTNM
3428 :     YDAREYDAVVATGEQVTIGLLAIALQDIGVEARSWMGWQIPIHTDEAHGKARILSIDTTV
3429 :     LEQRLASGQVAVVAGFQGLGPNNRVTTLGRGGSDTSAVALAAALKADRCDIYTDVDGVYT
3430 :     TDPRIVPKARKLDRITYEEMLEQASLGAKVLQTRSVEMAMKHRVRVRVLSSFSDAPGTLV
3431 :     CDEDEIVEKELVSGIAYSRDEAKITLVKVSDRPGVAARIFGPLADANINVDMIVQNVSED
3432 :     GHSTDLTFTLPRSDLARALKVLEGARDDINYRELTTSSAVVKVSVIGVGMRSHAGVAQTM
3433 :     FRALSEKGINIHVISTSEIKVSVLIAEEYMELAVRALHSAYGLDAA
3434 :     >Elit_Aa_|_CG-37
3435 :     MKFGGTSMAGTERIRRVANIVRKQAAGGDEVAVVVSAMAGETDRLVNFCREANALYDPAE
3436 :     YDVVVASGEQVTSGLLALTLQSLGCKARSWLGWQLPVHTVEAHAKARIEDIENDALLESM
3437 :     RGGTIAVIPGFQGLSDDGRITTLGRGGSDTSAVAVAAAIDADRCDIYTDVDGVYTTDPRI
3438 :     VARARKQKAVTYEEMLELASVGAKVLQTRSVGLAMKEGVRVQVLSSFVDDDATPADDLPG
3439 :     TMIVSEEEMDRILEEGDMERQLVTGIAHDKNEAKIILTRVPDKPGAVAHIFEPLAAASIN
3440 :     VDMIIQNVGRDKGETDVTFTVPQADLARAQALLEDRREEIGFNRIITDSQIAKISVVGVG
3441 :     MKSHAGVASTMFRALSDRGINIQAISTSEIKVSVMIDEDETELAVRVLHTAYGLDAEDAA
3442 :     >Naro_Aa_|_CG-37
3443 :     MARIVMKFGGTSMAGTERIRRVARIVQRQQAAGHEVAVVVSAMAGETDRLVNFCREANPL
3444 :     YDPAEYDVVVASGEQVTSGLLAMHLQALGCKARSWLGWQLPIHTDDAHSKARIEGIDSEA
3445 :     LLASMGAGEIAVIPGFQGLTADNRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
3446 :     TDPRIVAKARKLKNVTYEEMLELASVGSKVLQTRSVSLAMKEGVRVQVLSSFIDDDAPAA
3447 :     DTIPGTMIVSDEELEGLDMERQLITGIAADKNEAKVTLTRIADRPGAVAAIFGPLAAANI
3448 :     NVDMIIQNIAKDKGETDVTFTVPISDLARTQALLEERKDTIGYYRMLANSKVAKISVVGV
3449 :     GMRSHAGVASTMFRALADRGINIQAITTSEIKVSVLIDEDETELAVRVLHTAYGLDGE
3450 :     >Swit_Aa_|_CG-37
3451 :     MARIVMKFGGTSMAGIERIRNVANRVKHEVELGNEVAVVVSAMSGETDRLVNFCREASPL
3452 :     YDPREYDVVVASGEQVTSGLLAIVLQSLGVKARSWLGWQLPIRTSDAHASARIETINSEA
3453 :     IGKAMAAGEVAVIPGFQGMTGDDRVTTLGRGGSDTSAVAVAAAMKADRCDIYTDVDGVYT
3454 :     TDPRIVPKARKLAKVTYEEMLELASVGAKVLQTRSVGLAMKEKVRLQVLSSFDQPTDNPT
3455 :     PGTMIVGEEEIEGTTMERQLITGIAYDKNETKVTLTAVPDRPGAVASIFAPLADANINVD
3456 :     MIVQNVAHDTGSTDVTFTVPTAELARSLDVLERERGTIGYEKLIHDTNVAKISVVGVGMR
3457 :     SHAGVASKMFDALAARGINVLAITTSEIKVSVLINEDYTELAVRVLHTAYGLDAEDAA
3458 :     >Sala_Aa_|_CG-37
3459 :     MARIVMKFGGTSMAGTERIRTVARLVAREVADGNEVAVVVSAMAGETDRLVGFCREANPR
3460 :     YDPAEYDVVVASGEQVTSGLLALTLQAMGVPARSWLGWQLPIRTEEAHARARIADIDTGA
3461 :     LGAAMAKGEVAVIPGFQGMMDDGRISTLGRGGSDTSAVAVAAAIKADRCDIYTDVDGVYT
3462 :     TDPRIVARARKLDYVTYEEMLELASVGAKVLQTRSVGLAMKMGVRVQVLSSFVEGDEAPK
3463 :     KGTMIVSDEEIEEHQMERQLITGIAHDKNEAKIIVTRVPDRPGAVANIFGPLAAAGINVD
3464 :     MIIQNVGREKGETDVTFTVPGADLLRSIDLLESAKDKIGFNRVISDDKVAKVSVVGVGMK
3465 :     SHAGVASTMFRALADRGINIQAISTSEIKVSVLIDEDETELAVRVLHTAYGLDAE
3466 :     >Zmob_Aa_|_CG-37
3467 :     MARIVMKFGGTSVAGLERIRNVARRVQKEVEDGNEVAVVVSAMSGETDRLVGFCREAAPL
3468 :     YDPAEYDAVVSSGEQVTSGLLAIVLKSMGVKARSWFGWQIPIHTTDAYANSRIESIDTER
3469 :     LIKAMSSKEVAVVAGFQGVSDEGRVTTLGRGGSDTSAVALAAALDADRCDIYTDVDGVYT
3470 :     TDPRIVSRARRLDRVTYEEMLELASVGAKVLQTRSVGLAMKAKTRLRVLSSFGDPDLSPE
3471 :     GGTLIVSEDEIKENTMERQIITGIAYDKSEAKVTLTGVPDKPGAVAQIFSLLADANIHVD
3472 :     MIVQIAYEGHITDVTFTVPKAQLSQVLDILEKGKEKIGFQKALKNDNVCKVSIVGVGMRS
3473 :     HPGVAATMFDALAKRGINILAITTSEIKVSVLIDDAYTELAVRVLHTAYGLDADNKPVEE
3474 :     AIA
3475 :     >Amar_Aa_|_CG-38
3476 :     MGRILVKKFGGTSLKDVECILRVANIVRQSVERGHKLVVVVSAMGRFTDEAVTTAQEVSE
3477 :     LASEAQLSEYDVVVSSGEQVSCGLLALALQRIDIKATSIMGWQIPINTTGEHSRARIIEI
3478 :     KPDRILSLLNEHDVVIVAGFQGIHNARITTLGRGGSDISAVAIAAALRLDACYMYTDVAG
3479 :     VYTANPCLVPSARKLDHVTYNDMVEISASGRAILNVRSVEMAMRCGVRIHVMSSSQEAKG
3480 :     TLVSFGCEREMESRIITGIAISKKIASVSLGGVPAVPGIAAALLPIAEGNIDVDMIMQTV
3481 :     DGELRNITFTVQEEDLQKTQDILLQHKHNILYESLAVTDSLAKVSLVGACMISRPGVASR
3482 :     VFSALASGGIAVLAVSTSEIKITVLMHEQSAAPALSLLHEEFALDRESVLCT
3483 :     >Ecan_Aa_|_CG-38
3484 :     MERILVKKFGGTSLQDIKCINKVVEIIKQDINNNYKVVVIVSAMGKFTDNIISQIKQISD
3485 :     VKSPSERSEYDLIISSGEQISCGLLSLALQKVGINAQSWLGWQLPIVTTEDHTKARIIDI
3486 :     NVNSLQDSLANNDVAIVAGFQGMHKNNRVTTLGRGGSDTSAVAIAVALGVDLCYIYTDVD
3487 :     GIYTADPNLVPKAHKLDYITYDEMIEMSSLGAKVLQVRSVEIAMKYNIKLCILSTFNPGK
3488 :     GTMLCKKGESHMESQLITGVTCNNKTASITLKQVKTLSGITTVFNAIAEKNINVDMIIQN
3489 :     MNDNNANDITFTISEEDLPTTKKFLTEIQSELMYQDLIINSEVAKVSIIGVGMISHSGIA
3490 :     YKMFDTLTSNNIKILAVTTSEIKISVLIYRKDSQLATVALHSAFELDSTESNLYTIS
3491 :     >Echa_Aa_|_CG-38
3492 :     MKRILVKKFGGTSLQDIECINRVAEIIKQDVNNNYKVVVVVSAMGKFTDNIISQIKQISD
3493 :     VKSQSERSEYDLIISSGEQISCGLLSLALQKIGINAQSWLGWQLPIVTTEDHTKARIIDI
3494 :     NTCSLQDSLANNDVAIVAGFQGMHKNNRVTTLGRGGSDTSAVAIAAALKVDLCYIYTDVD
3495 :     GIYTADPNVVPKARKLDYITYDEMIEMSSLGAKVLQVRSVEIAMKYNIKLCILSTFNPGK
3496 :     GTILRKKGESDMESQLITGVTCNNKTASITLKEVKAISGVTTVFNAIAEKNINVDMIIQS
3497 :     VNDNNANDITFTISEEDLPTTTKFLTEIQTELMYQDLIINSEVAKVSIIGVGMISHSGVA
3498 :     YKMFDTLTSNNIKILAVTTSEIKISVLISRKDSQLATIALHSTFGLDNTESDLHIIS
3499 :     >Erum_Aa_|_CG-38
3500 :     MTKILVKKFGGTSLQNIKCINQVTEIIKQDVCSNHKVVVIVSAMGKFTDNIISQIKKISD
3501 :     VKSYNELSEYDLIISSGEQISCGMLSLALQKLGIKAQSWLGWQLPIVTTDDHTKARIMEI
3502 :     NTSALQDFLANNDVAIIAGFQGMHKENRVTTLGRGGSDTSAVAIAAALGIDLCYIYTDVD
3503 :     GIYTSDPNIVPKARKLDYIAYDEMIEMASLGAKVLQVRSVELAMKYNIKLHVLSTFNSIK
3504 :     GTILCKKGEIKMESQLITGITYNSNTASITLKKVRALFGITTLFSIIADNGINVDMIIQN
3505 :     MDNNANDITFTIPEEDLSITETLLIKTKDKLMYEELIINPDVAKVSVIGVGMISHPGIAY
3506 :     KMFDTLTSNNITILAVTTSEIKISVLVLRKDGQLATQYLHSSFKLDSQSNLHTTS
3507 :     >Otsu_Aa_|_CG-38
3508 :     MNIIVQKFGGACVSDTAKIANLVTKVQREIDASNKVIVVVSAMAGITKKLISFCYNLNSE
3509 :     LYTPETLAEYDSALSSGEIMTASLFALALQQKSIKSRSLHSWQIPIKTNNYHSKAIIIDI
3510 :     NTNLIHDMLLQGIVPVISGFQGITNHNRITTLGRGGSDITAVAIAAALQAKRCDIYTTVD
3511 :     GVFSADPELIPQACKHDKITYTEMLELASLGSRVVHYRAVQMGMRYNVPIKVIHAFGKGQ
3512 :     GTIIQEITTMEQPQITGITYNKDIILVTICINDNKQFFLVINHMLKYSVSIEQITNYQLN
3513 :     KVSIIIPLSDLTASKKAFDELQNQCIINSYQINNVASVSVVGYAIKYNPSIFQQITMVLS
3514 :     KFEVQILGILALEARISIILNKIDVEPIVAELHHHLISTASSAI
3515 :     >Rbel_Aa_|_CG-38
3516 :     MALIIQKFGGTSVTTIDRIKKIIPIIKAEIAKNNQVIIVVSAMAGVTNQLVTLCNEVSSL
3517 :     NKSSQLAEYDVALSSGEIVTASLLALALQEENINARSFLAWQLPILTDDNHSKALVESVD
3518 :     TNLLNECLQQNIIPIIAGFQGINKHNRLATLGRGGSDTTAALIAAAMKADRCDIYTDVEG
3519 :     VFAADPRIIPKAKKIDEIDFSEMLELALSGAKVLHSRAAEIVMRYQIDMRILSTFAPEAG
3520 :     CTLITSKDKIMEKRIISGITSNKNLLYITIESSSLNFIQVASIIAQNNNHIEVMQEIEPN
3521 :     KRYSFITNLTDKNSLHILLTNLKNNNQISNFTFDTEIATVSIIGHGIKNDLKLLEVILSK
3522 :     LAKDNINVQMVQISEIKIILLINDKQVEKTVLDLYDLLKISETGHC
3523 :     >Rcon_Aa_|_CG-38
3524 :     MALIIQKFGGTSVANIDRIKKIVPIIKTEIAKNNQVIVVVSAMAGVTNQLVTLCNELSSL
3525 :     NNISQFAEYDVALSSGEIVTASLLALALQEEDIKARSFLAWQLPMLTDNNHSKALVESIT
3526 :     TDLLEKYLQLNTIPIIAGFQGINKSNRLTTLGRGGSDTTAALIAAAMKADRCDIYTDVEG
3527 :     IFTADPRIIPNAKKIKEIDFLEMLELASSGAQVLHPRAGELVMRYKIDMRVLSTFSPDTE
3528 :     GTLITSKDKNMENGIINSITSNKNLLKISVKSMSLSFLQVANMITQNNNHIEFMQEIKNN
3529 :     EEYSFITNLTDKNNLQALLTNLKDDKQIQYFTFDTEIATISLIGYGIKNDCKLLETILSK
3530 :     LTNDNINVHMIQLSEVKITLFINDQDTEKTIFNLYNLFKIS
3531 :     >Rfel_Aa_|_CG-38
3532 :     MALIIQKFGGTSVANIDRIKKIAPIIKAEIAKNNQVIVVVSAMAGVTNQLVTLCNEVSSL
3533 :     NNISQFAEYDVALSSGEIVTASLLALALQEEDIKAQSFLAWQLPILTDNNHSKALVESIT
3534 :     TDLLEKYLQLNTVPIIAGFQGTNKSNRLTTLGRGGSDTTAALIAAAMKAKRCDIYTDVEG
3535 :     IFTADPRIIPNAKKIKEIDFLEMLELASSGAKVLHPRAVELVMRYKIDMRVLSTFSPNTE
3536 :     GTLITSKDKNMENGIINSITSNKNLLKISVKSISLSFLQVANMITQNNNHIEFMQEIKNN
3537 :     EEYSFITNLTDENNLQALLTNLKNDKQIQDFTFDAEIATISLIGYGIKNDCKVLEMILSK
3538 :     LTKDNINVNMIQLSEVKITLLINDQDAEKTIFNLYNLFKIS
3539 :     >Rpro_Aa_|_CG-38
3540 :     MALIIQKFGGTSVANVERIKKLVPIIKAEIAKNNQVIVVVSAMAGVTNQLVTLCNEVSSL
3541 :     NKRSQFAEYDVALSSGEIVTASLLALALQEEEIKAQSLLAWQLPIRTNNNYSKALVEFIT
3542 :     TDLLEKYLQLKIIPIIAGFQGINKSNRVTTLGRGGSDTTAALIAAAMKADRCDIYTDVDG
3543 :     IFTADPRIIPNAKRIKEIDFLEMLELASSGAKVLHPRAVELVMRYKIDMRVLSTFSPNTE
3544 :     GTLITSKDTIPLVKSTYMEESALNTKHSTKIDIPEDASGSTYKLPIELALQNRYNMENCV
3545 :     VRCITSNKNLLKVSVNSISLSFLQVANMITYNNNCIEFMQEIENNIEYNFITNLTDKNNL
3546 :     QTLLTKCKNNKQIQDFTFDTEIATISLIGYGIKNDCKLLTMILSQLTQDNINVHMMQLSE
3547 :     VKITLLINDKDVEKTIFNLYNLFKIS
3548 :     >Rtyp_Aa_|_CG-38
3549 :     MALIIQKFGGTSVANIERIKKLVPIIKAEITKNNQVIVVVSAMAGVTNQLVTLCSEVSSL
3550 :     NKISQFAEYDVALSSGEIVTAALLALALQEEEIQAQSLLAWQLPILTNNNHSKALVEFIT
3551 :     TDLLEKCLQLKIIPIIAGFQGINKSNRITTFGRGGSDTTAALIAAAMKADRCDIYTDVDG
3552 :     IFTADPRIIPNAKRIKEIDFLEMLELASSGAKVLHPRAVELVMRYKIDMRVLSTFLPNTE
3553 :     GTLITSKDTTPLVKSTYMDMEESAKNIKRSTKINIPDDTSGLTYKLPIELALQNRYNMEN
3554 :     CIIRGITSNKNLLKVSVNTITLSFLQVANMITYNNNCIEFMQEIKNNIEYNFITNLTDKN
3555 :     NLQTLLTNCKNNKQIQNFTFDTEIATISLIGYGIKNDCKLLEMILSQLTQDNINVNMMQL
3556 :     SEVKITLLINDKDVEKTISNLYNLFKIS
3557 :     >Wend_a_|_CG-38
3558 :     MDKIIIKKFGGTSLTDLNRVANLIKNDIEKGCNVIVVVSAVAGFTDQMVFQARQISNLSY
3559 :     RQELSEYDVMLSAGEQISCGLLAITLQSIGVNAKSWLAWQLPIVTDDFYSESKIKTIKIE
3560 :     RVKRSFAEGYTAAIIAGFQGINDDRITTFGRGGSDISAVAFAVAFGVRTCEIFTDIDGIY
3561 :     TADPRIVPKARKLKFISYDEMLEMSSSGAKILHNRSVQLAMKHNIKVQVLSTFKEVEGTT
3562 :     VLHKRDVLERYLITGITYSTNEALVTFTNLANNLRTLRDIAGANVKIDMIHGSSFVISKF
3563 :     DIDLMEKLLNKNENYAINDNVAKISIIGIGVMSNTEVMHRTLKVLSEKKIEILAITTSEI
3564 :     KISIIVQKECAVALVKDLHTEYELDMQH
3565 :     >Sama_Aa_|_CG-39
3566 :     MTKIYVKKFGGTSVGTFERIEAVADAIAKAHFEGERQVLVLSAMAGETNRLYAMAANIDP
3567 :     LAPARELDMLVSAGEQVSIALMSIALARRGVNARSLLGSQVKVRTNSQFGRASIESVDTG
3568 :     LLMQLLDEGAVPVIAGFQGVNEQGDVTTLGRGGSDTTAVAIAAALEAAECQIFTDVTGVF
3569 :     TTDPNIDPDAQKLDSISFEAMYEMARQGAKVLHPDSVACARRHGVVLRVLSSFESGSGTL
3570 :     IRFDEPEHSGSGIVGIAVTRGQGLVSVAGLVDQPQAEVALFQALANASVDTDLVVQLAEE
3571 :     KALAFTLAQGALDKVLTLIDRLALEQPLADVRHESPLAKVSLVSTGKAVMAEVGARVTEL
3572 :     LEAQNIRVKLLSTSEIKLSVVIDEVHLQHAVRSLHRAFDLNKV
3573 :     >Sbal_Aa_|_CG-39
3574 :     MPQKRKLSGSKLFVKKFGGTSVGSIERIEAVAEQITKSAHNGEQQVLVLSAMAGETNRLF
3575 :     ALAAQINPRASARELDMLVSTGEQVSIALMSMALQRRGIKAKSLTGDQVQIHTNSQFGRA
3576 :     SIERVDTEYLQSLLADGVVPIVAGFQGIDPQGEVTTLGRGGSDTTAVALAAALEADECQI
3577 :     FTDVAGVFTTDPNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAERFRVPLRVLSS
3578 :     FEAGQGTLIQFGDESELTIASLVQGIAINKALATLTIEGLFTTSERYQALLGCLTRLEID
3579 :     VEFISPLRIHEDDPSGRVSFMLAEAKVDTLLNELEGLSESLALGPLIIERQRAKVSLVGK
3580 :     GLQAKMGLLTKMLEVLGNETIHAKLLTTSESKLSTVIDERDLHKAVRALHHAFELNKV
3581 :     >Sone_Aa_|_CG-39
3582 :     MLEKRKLSGSKLFVKKFGGTSVGSIERIEVVAEQIAKSAHSGEQQVLVLSAMAGETNRLF
3583 :     ALAAQIDPRASARELDMLVSTGEQISIALMAMALQRRGIKARSLTGDQVQIHTNSQFGRA
3584 :     SIESVDTAYLTSLLEQGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALRADECQI
3585 :     FTDVSGVFTTDPNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAQRFKVPLRVLSS
3586 :     FEAGQGTLIQFGDESELAMAASVQGIAINKALATLTIEGLFTSSERYQALLACLARLEVD
3587 :     VEFITPLKLNEISPVESVSFMLAEAKVDILLHELEVLSESLDLGQLIVERQRAKVSLVGK
3588 :     GLQAKVGLLTKMLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELNKV
3589 :     >Sput_Aa_|_CG-39
3590 :     MPEKRKLSRSKLFVKKFGGTSVGSIERIEVVAEQIAKSARSGEQQVLVLSAMAGETNRLF
3591 :     ALAAQVDPRASARELDMLVSTGEQVSIALMAIALQRRGIKAKSLTGDQVQIHTNSHFGRA
3592 :     SIENVDTGYLESLLDDGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALNADECQI
3593 :     FTDVAGVFTTDPNIDSNARCLDVIGFDVMLEMAKLGAKVLHPDSVEYAERFRVPLRVLSS
3594 :     FEVGQGTLIQFGTESDVISASLVQGIAINKALATLTIDGLLTTSEHYQALLACLSRLEID
3595 :     VEFITPLRLNEDAPAGCVSFMLAEAKVDILLHELEALSTSLELGQLIVERQRAKVSLVGK
3596 :     GLQAKMGLLTKMLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELNKV
3597 :     >SHEW-3a_|_CG-39
3598 :     MLEKRKLSGSKLFVKKFGGTSVGSIERIEVVAEQIAKSAHNGELQVLVLSAMAGETNRLF
3599 :     ALAAQIDPRASARELDMLVSTGEQISIALMAMALQRRGINARSLTGDQVQIHTNSQFGRA
3600 :     SIERVDTAYLTSLLNDGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALKADECQI
3601 :     FTDVPGVFTTDPNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAQRFKVPLRVLSS
3602 :     FEAGHGTLIQFGDESELAMAASVQGIAINKALATLTIKGLFTSSEHYQALLACLARLEID
3603 :     VEFITPLKLNETSAAECVSFMLAEAKVDILLHELELLSESLDLGQLIVERQRAKVSLVGK
3604 :     GLQAKVGLLTKMLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELNKV
3605 :     >Ppro_Bb_|_CG-39
3606 :     MTLLVQKFGGTSVGSIDRIEAVADRVMKTYQQGHQIVVVLSAMAGETNRLLGLAKQIDEI
3607 :     PTARELDVLLSAGEQVSIALLAMALNRRGIKAQSLIADQVTIRTDNVFNNASITDVETER
3608 :     LTALLEQDNVVVVAGFQGRDSDNNITTLGRGGSDMTAVAIASALNATECQIFTDVDGVYS
3609 :     TDPRLVPDAKRLDVVHFEHMRTMASKGAKVLQLQSVEYALQHSVPLRVLSSFDDGEGTLV
3610 :     TFDIASTSSIVGIAILGNQVLLDVELSKEELQRQLSLFGVNVWSVTAKADSTQIVASNDD
3611 :     LARLRLVLDEKMRHIGDVSTLSMIGNDILEYSDEIRIFLSEAGIIVHNNQQQTDCLSFLI
3612 :     DKDNHKLAVNIIHKRFVVDQQRLDNPPLLAIY
3613 :     >Vcho_Fe_|_CG-39
3614 :     MKKPLIVQKFGGTSVGSIERMQTVAEHIIKAKNDGNQVVVVVSAMAGETNRLVGLAQQVD
3615 :     SVPNARELDVLLSAGEQVSMALVAMTLHKMGYAARSLTGAQANIVTDNQHNDATIKHIDT
3616 :     RTITELLEQDFIVIVAGFQGINENGDITTLGRGGSDTSAVALAGALNADECQIFTDVDGI
3617 :     YTCDPRIVPSARKLDVIDFPSMEEMARKGAKVLHLPCVQYAWKHAVPLRVLSTFEVNQGS
3618 :     LIKGSAATHAVCGIALQRDMALIRVESESFPSIIKQCQMLGIEVCTTIDEPTHSAFVIKR
3619 :     DAYAKLQLVGADKIRGSEPVSLITKVGIQAGALVAHARQTLAQHGIDVRYVSASEQSSML
3620 :     MLDPANVDRAANILHETYVTSEIPQEFGLKQTFLG
3621 :     >Vfis_Aa_|_CG-39
3622 :     MALIVQKYGGTSVGSVERIQSVSERIISTLQQGHDVVVAVSAMAGETNRLLHLANQISEV
3623 :     PEPRELDMLLSAGEQVSIALLAMSLNQKGIKAISLTADQAGIHTNNSFNDATIKHIETDL
3624 :     ITQWVDKGYVVIVAGFQGRDDQGNITTLGRGGSDTTAVALAAALDADECQIFTDVDGVYT
3625 :     SDPRFVSNTRRLEEVSFSDMHALAKSGAKVLQEHSVAHAWNSSVALRVLSSFEDGEGTLI
3626 :     CENPKQPLAVTGLALKQDLSLVECENISSEEQAELYKQYRVLNERCDCFQIVVPKATFLQ
3627 :     LKLAFDTKIRNISSLSILTLVGDNVEGMAESACNQLLANDIDVHQYDIEPKSVSVIVNQA
3628 :     DLHRAAEILHKTFVITEQSQDNDLLVAVS
3629 :     >Vpar_Aa_|_CG-39
3630 :     MKKPLIVQKFGGTSVGSIERIHQVAEHIIKAKNDGNQVVVVVSAMSGETNRLMDLAKQVD
3631 :     SVPTARELDVLLSAGEQVSMALLAMTLNKLGYVARSLTGAQANIVTDNQHNDATIKHIDT
3632 :     STITDLLEQDQIVIVAGFQGVNENGDITTLGRGGSDTSAVTLAGALRADECQIFTDVDGI
3633 :     YTCDPRVVKNAQKMAVIDFPSMEAMASRGAKVLHLPSVQFAWKNNVPLRVLSTFEVNEGS
3634 :     LVKGESGHQAVSGIAIQRDLAIIEVDKEHLSSATKQCQMLGIDIWNVIEETERTGIMIKQ
3635 :     EACAKFDLVFSDKIRNSEAVSLLTAVGLEANGMVEHACGLLAQQDIAINFCATNALTMML
3636 :     VLPPESVDTAANILHDAYITSSEALNIQQKHAFLG
3637 :     >Vvul_Ad_|_CG-39
3638 :     MKKSLIVQKFGGTSMGSIERIHTVAEHIIKAKNDGNQVVVVVSAMAGETNRLLDLAKQVD
3639 :     SVPTARELDVLLSAGEQVSMALLAMTLNKLGYAARSLTGAQANIVTDTQHNDATIKHIDT
3640 :     TPINELLEQDQIVIVAGFQGVNENGDITTLGRGGSDTSAVTLAGALAADECQIFTDVDGI
3641 :     YTCDPRVVKTAQKLDIIDFPSMEEMARKGAKVLHLPCVQFAWENEVPLRVLSTFEINEGS
3642 :     LVKGETGTQAVCGIALQRDLAMIKVSKESLSSLTKQCQMLGIEIWNVIEEADWAGIMIKQ
3643 :     DACAKLDLVFSDKIRNSEAVSLLTVVGLEANSLMQHACDALTTQGIAIRHQCVTPLSSML
3644 :     VVSPESVDQAANYCTMLILVLTKP
3645 :     >Bbro_Aa_|_CG-40
3646 :     MRACQPEYEMSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLL
3647 :     SLAREISPQPDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKA
3648 :     RIKSIDDKRVLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLI
3649 :     FTDVDGVYTTDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSS
3650 :     LTDPLIPLEEEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILG
3651 :     PVAAANIDVDMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVA
3652 :     KVSIVGIGMRSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAF
3653 :     GLDQVPGDQV
3654 :     >Bpar_Aa_|_CG-40
3655 :     MRACQPEYEMSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLL
3656 :     SLAREISPQPDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKA
3657 :     RIKSIDDKRVLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLI
3658 :     FTDVDGVYTTDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSS
3659 :     LTDPLIPLEEEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILG
3660 :     PVAAANIDVDMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVA
3661 :     KVSIVGIGMRSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAF
3662 :     GLDQVPGDQV
3663 :     >Bper_Aa_|_CG-40
3664 :     MSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLLSLAREISPQ
3665 :     PDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKARIKSIDDKR
3666 :     VLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLIFTDVDGVYT
3667 :     TDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSSLTDPLIPLE
3668 :     EEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILGPVAAANIDV
3669 :     DMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVAKVSIVGIGM
3670 :     RSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAFGLDQVPGDQ
3671 :     >Bcen_Da_|_CG-40
3672 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
3673 :     PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
3674 :     VKDDLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
3675 :     TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
3676 :     EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
3677 :     DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVQGHVSAERVQGDPKVSKVSVVGVGM
3678 :     RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKVFELDQAS
3679 :     >Bamb_Aa_|_CG-40
3680 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
3681 :     PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDNAYTKARIHSIDDER
3682 :     VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALDAAECLIYTDVDGVYT
3683 :     TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
3684 :     EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
3685 :     DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVSAERVQGDPKVSKVSVVGVGM
3686 :     RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQAA
3687 :     >Bmal_Ca_|_CG-40
3688 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
3689 :     PSPRELDMIASTGEQVSVGLLSIALQDIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
3690 :     VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
3691 :     TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
3692 :     EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
3693 :     DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
3694 :     RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
3695 :     >Bpse_Ga_|_CG-40
3696 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
3697 :     PSPRELDMIASTGEQVSVGLLSIALQDIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
3698 :     VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
3699 :     TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
3700 :     EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
3701 :     DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
3702 :     RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
3703 :     >BURK-1a_|_CG-40
3704 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
3705 :     PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
3706 :     VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
3707 :     TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKFQVKTRVLSSLTDPLIALD
3708 :     EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
3709 :     DMIIQNQSVQGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVQGDPKVSKVSVVGVGM
3710 :     RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQAS
3711 :     >Btha_Aa_|_CG-40
3712 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
3713 :     PSPRELDMIASTGEQVSVGLLSIAMQEIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
3714 :     VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
3715 :     TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
3716 :     EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
3717 :     DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
3718 :     RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
3719 :     >Bvie_Aa_|_CG-40
3720 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
3721 :     PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
3722 :     VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
3723 :     TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
3724 :     EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
3725 :     DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAERVQGDPKVSKVSVVGVGM
3726 :     RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQAP
3727 :     >Bxen_Aa_|_CG-40
3728 :     MALIVHKYGGTSMGSVERIKNVARRVAKWHKAGHKMVVVPSAMSGETNRLLGLAKEITAQ
3729 :     PSPRELDMIAATGEQVSSGLLAIALQEAGVDAVSYAGWQVPVKTDSAFTKARISEIDGER
3730 :     VLRDLDAGKVVVITGFQGIDPDGNITTLGRGGSDTSAVAVAAALKADECLIYTDVDGVYT
3731 :     TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIPLD
3732 :     AEMKSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
3733 :     DMIIQNQSVDGKTAFTFTVGRGDYQRAMDILTGQVKGHVQAEQVLGDPKVSKVSVVGVGM
3734 :     RSHVGIASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
3735 :     >POLY-1a_|_CG-40
3736 :     MALIVHKYGGTSMGSVERIANVAKRVAKWMRAGHQVVVVPSAMSGETNRLLGLAKEINPE
3737 :     AKPRELDQIASTGEQVSSGLLALALMREGIDAVSYAGWQVTVHTDSAFTKARIKSIDDQK
3738 :     ILNDLNAGRAVVVTGFQGVDPDGNITTLGRGGSDTSAVAMAAALKADECLIYTDVDGVYT
3739 :     TDPRVCEDARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYKVKTRVLSSLTDPLMPLD
3740 :     QEMKSGTLITFEEDSTMEAAVISGIAFARDEAKITVLGVPDRPGIAYQILGPIADANIDV
3741 :     DIIIQNQSVEGKTDFTFTVPRADYQKALDILRNNVQAHIEAKEISGDPKVSKVSVVGVGM
3742 :     RSHVGIASKMFRTLSEEGINIVMISTSEIKISVVIDEKYMELAVRALHKAFELDQK
3743 :     >Cnec_Ba_|_CG-40
3744 :     MALIVHKYGGTSMGSTERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLAKEISPQ
3745 :     PNPRELDMLASTGEQASVALLAIALHGEDIDAVSYTGWQVPVKTDSAYTKARIESIDDER
3746 :     ILADLDAGRVVVITGFQGIDDDGNITTLGRGGSDTSAVAIAAAIEADECLIYTDVDGVYT
3747 :     TDPRVVEDARRLDQITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
3748 :     QEMHSGTLITFEEDSTMEAAVISGIAFARDEAKITVLGVPDKPGIAYQILGPVADANIDV
3749 :     DMIIQNQSVDGKTDFTFTVPRGEYQRALAILNDGVKSHIGAGSVSGDPKVSKVSVVGVGM
3750 :     RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQA
3751 :     >Rmet_Aa_|_CG-40
3752 :     MALIVHKYGGTSMGSTERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLAKEISAQ
3753 :     PDPRELDMLASTGEQASVALLAIALHGEGIDAVSYTGWQVPVKTDSSYTKARIESIDDER
3754 :     ILGDLDAGKVVVVTGFQGIDGDGNITTLGRGGSDTSAVAIAAAIEADECLIYTDVDGVYT
3755 :     TDPRVVEDARRLDQITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
3756 :     QEMHSGTLITFEEESEMEAAVISGIAFARDEAKITVLGVPDKPGIAYQILGPIADANIDV
3757 :     DMIIQNQSVDGKTDFTFTVPRGDYQRALTILNDNVKGHIGAESVSGDPKVSKVSVVGVGM
3758 :     RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKVFELDQA
3759 :     >Rsol_Aa_|_CG-40
3760 :     MALIVHKYGGTSMGSVERIKNVAKRVAKWHRAGHQIVVVPSAMSGETNRLLGMAKEISAQ
3761 :     PDPRELDMIASTGEQVSVGLLAIALHAEGIDAISYTGWQVPVQTDSAYTKARIQSIDDER
3762 :     VRADLEAGRVVVITGFQGIDGEGHITTLGRGGSDTSAVAVAAALEAEECLIYTDVDGVYT
3763 :     TDPRVVDDARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
3764 :     VEMHSGTLITFEEDSNMEAAAISGIAFARDEAKITVIGVPDKPGIAYQILGPVADANIDV
3765 :     DMIIQNQSVDGKTDFTFTVPRGDYQRALGILNDSVKGHIGAANVSGDPKVSKVSVVGVGM
3766 :     RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
3767 :     >Aave_Aa_|_CG-40
3768 :     MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKDLAPS
3769 :     RASSAYHRELDMLAATGEQASSALLAIALQAEGMESVSYAGWQVPIRTDSSYTKARIESI
3770 :     DDQRVRADLAAGKVVIVTGFQGIDEHGHITTLGRGGSDTSAVAVAAAMKAAECLIYTDVD
3771 :     GVYTTDPRVVAEARRLHTVSFEEMLEMASLGSKVLQIRSVEFAGKYKVPLRVLSSFTPWD
3772 :     IDIEEEARSGTLITFEEDEKMEQAVVSGIAFNRDEAKISVLGVPDKPGIAYQILGAVADA
3773 :     NIEVDVIIQNLSKDGKTDFSFTVNRNDFARTVDLLKEKVVPALGAQEVVGDAKICKVSIV
3774 :     GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYVELAVRTLHKAFELDQP
3775 :     SAA
3776 :     >ACID-3a_|_CG-40
3777 :     MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELTPS
3778 :     RITSAYHRELDMLAATGEQASSALLAIALQAEGMESVSYAGWQVPVRTDSSYTKARIESI
3779 :     DDKRVRADLDAGKVVIVTGFQGIDEGGNITTLGRGGSDTSAVAIAAAMKAHECLIYTDVD
3780 :     GVYTTDPRVVPEARRLTTLSFEEMLEMASLGSKVLQIRSVEFAGKYKVPLRVLSSFTSWD
3781 :     IDINEEAKSGTLITFEEDEQMEKAVVSGIAFTRDEAKISVIGVPDTPGIAYQILGAVADA
3782 :     NIDVDVIIQNMGKEGKTDFSFTVNRNDYQRTIDLLKDKVLPQLGAEEIVGDAKIAKVSIV
3783 :     GIGMRSHVGVASKMFRALSEEGINIKMISTSEIKTSVVIDEKYVELAVRTLHKAFELDQA
3784 :     AA
3785 :     >Pnap_Aa_|_CG-40
3786 :     MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELAPA
3787 :     QSDDTYSRELDALAATGEQASSALLAIALQAEGMPAVSYAGWQVTIKTNSAYTKARIESI
3788 :     DDEKVRADLDAGKVVIITGFQGMDEGGNVTTLGRGGSDTSAVAIAAALKAHECLIYTDVD
3789 :     GVYTTDPRVVPEARRLQTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVPLRVLSSFTDWN
3790 :     IDINEEARSGTLISFEEDEKMEKAIVSGIAFNRDEAKISVLGVPDTPGIAYQILGAVADA
3791 :     NIEVDVIIQNISKDGKTDFSFTVHRNDFAKTLDLLKSKVVPALGAQEVTGDARICKVSIV
3792 :     GIGMRSHVGIASKMFRVLAEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDQP
3793 :     VA
3794 :     >POLA-1a_|_CG-40
3795 :     MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELAPA
3796 :     RPGDDYHRELDALAATGEQASSALLAIALQSEGMQAVSYAGWQVTIKTNNAYTKARIESI
3797 :     DDERVRADLDAGKVVIITGFQGVDEGGNVTTLGRGGSDTSAVAIAAALKAHECLIYTDVD
3798 :     GVYTTDPRVVPEARRLHTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVPLRVLSSFTDWD
3799 :     IDINEEARSGTLISFEEDENMEQAIVSGIAFNRDEAKISVLGVPDTPGIAYQILGAVADA
3800 :     NIEVDVIIQNISKDGKTDFSFTVHRNDYSKAVDLLKTQVLPKLGAQEVTGDAKICKVSIV
3801 :     GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDQP
3802 :     AA
3803 :     >Rfer_Aa_|_CG-40
3804 :     MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLALAKELAPA
3805 :     KATESYSRELDMLAATGEQASSALLAIALQAEGLESVSYAGWQVPIRTNSAYTKARIESI
3806 :     EDTKVRADLDAGRVVIVTGFQGLDELGNITTLGRGGSDTSAVAVAAAMKADECLIYTDVD
3807 :     GVYTTDPRVVPEARRLQTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVKLRVLSSFTPWD
3808 :     IDINEEAASGTLITFEEDEHMEQAIVSGIAFSRDEAKISVLGVPDKPGIAYQILGAVADA
3809 :     NIDVDVIIQNISKDGKTDFSFTVNRGEYAKTVDLLKEKVLPKLGAQEVVGDTKICKVSIV
3810 :     GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFELEQA
3811 :     PA
3812 :     >Veis_Aa_|_CG-40
3813 :     MALIVHKYGGTSMGSPERIRCVAKRVAKWARAGHQMVVVPSAMSGETNRLLALAKELAPA
3814 :     RATDAYHRELDMLAATGEQASSALLAIALQAEGLGSVSYAGWQLPIRTDSSYTKARIESI
3815 :     DDQRVRADLAHGKVVIVTGFQGIDDEGNITTLGRGGSDTSAVAVAAAMKAHECLIYTDVD
3816 :     GVYTTDPRVVPQARRLQTVSFEEMLEMASLGSKVLQIRSVEFAGKYRVRLRVLSSFTPWD
3817 :     MDIDEEARSGTLITFEEDEKMEQAVVSGIAFNRDEAKLSVLGVPDKPGIAYLILGAVADA
3818 :     NIDVDMIIQNLSKDGKTDFSFTVHRNDYARAIDLIKEKVLPVLGAHEVVGDTNICKVSIV
3819 :     GIGMRSHVGVASKMFRVLSEESINIQMISTSEIKTSVVIDEKYMELAVRSLHQAFGLDQE
3820 :     AA
3821 :     >Hars_a_|_CG-40
3822 :     MALIVHKYGGTSMGSTERIKNVARRVAKWHDAGYQIVVVPSAMSGETNRLIGLAKELMPH
3823 :     PNPRELDMLASTGEQVSVALLAMALHSIGKEAVSYTGWQAGIKTDSAFTKARIQSIDDVK
3824 :     VKKDLDAGRIVIITGFQGVDEDGNIATLGRGGSDTSAVAVAVALEAKECLIYTDVDGVYT
3825 :     TDPRVVSEARRLNTVTFEEMLEMASLGSKVLQIRSVEFAGNYKMPTRVLSSLTDPMMSLE
3826 :     EEAKSGTLISFEEDTKMEQAAITGIAFSRDEAKITVLGVPDRPGIAYQILGPIAAANIEV
3827 :     DMIIQNQSVDGKTDFTFTVPRADYAKAVDVLNDSVKAHIGAASIQGDTKVSKVSVVGVGM
3828 :     RSHVGIASQMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKTFDLEKSN
3829 :     >Mpet_Aa_|_CG-40
3830 :     MPRRPAKMPGSRRRAPRPTDFPAAAFLMALIVHKYGGTSMGSTERIRNVAKRVAKWARAG
3831 :     HQMVVVPSAMSGETNRLLGLAKELSPASHTPQLARELDMIAATGEQVSVGLLAIALQAEG
3832 :     LQAVSYTGWQVPVRTDSAYTKARIESIDDVRVRADLAAGKVVVITGFQGIDGDGHITTLG
3833 :     RGGSDTSAVAVAAAMKAAECLIYTDVDGVYTTDPRVVPEARRLSAISFEEMLEMASLGSK
3834 :     VLQIRSVEFAGKYRVPLRVLSSFTPWDIPLDEEAKSGTLITFEEDENMEQAVVSGIAFNR
3835 :     DEAKITVMGVPDKPGIAFQILGPVAEANIDIDVIIQNVSHDGKTDFSFTVHRNDYARTME
3836 :     LLKGTVQPVINAAQVLGDPKICKVSIVGIGMRSHVGVASRMFRVLSEEGINIQMISTSEI
3837 :     KTSVVIDEKYMELAVRALHKAFDLDAPAAVPAA
3838 :     >Tden_Aa_|_CG-40
3839 :     MALIVQKYGGTSVANVERIRAVAERVAKFKMLGHQVVVVLSAMSGETNRLIGLAKQIQAE
3840 :     PDPRELDMMVSTGEQVTIALLAMALKDLGLKAKSYTGAQVRILTDDAFTKARILSIDEAK
3841 :     MRRDLDSGHVVVVAGFQGVDEGGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
3842 :     TDPRIVPEARRLKTVTFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFQDEGDGTL
3843 :     ITFEENDNMEQAIISGIAFSRDEAKITVVGVPDHPGIAYQILGPVADANVDVDMIVQNVG
3844 :     HANTTDFTFTVHRNDFAKAMSLVKATAATVGAREVTGDDKIAKVSIVGVGMRSHVGIAKK
3845 :     MFETLSKENINLQMISTSEIKISVVVEDKYLELAVRALHQAFELDKATA
3846 :     >Mfla_Aa_|_CG-40
3847 :     MALIVQKYGGTSVANPERIGNVARRVARHKALGQQVVVVVSAMSGETNRLISLAKEVMPN
3848 :     PDPRELDVLVSTGEQVTIALLSMALMELGVKAKSYTGGQVSIVTDSAHTKARILKIDEER
3849 :     IRKDLDAGYVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
3850 :     TDPRIVPEARRLRSVTFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEEGEGTL
3851 :     ITFEDDKDMEQPVISGIAFNRDEAKITVLGVPDRPGIAYQILGPVADANIDVDIIIQNVG
3852 :     ADGTTDFTFTVHKNDLQKALNILREKVQPHTGAREIIGDDKTAKVSVVGVGMRSHVGIAS
3853 :     QMFRTLAEEGINIQMISTSEIKISVVIDEKYMELAVRVLHKAFGLEEV
3854 :     >Cvio_Aa_|_CG-40
3855 :     MALIVQKYGGTSVGTTERIKNVARRVAKWKAQGHDVVVVVSAMSGETNRLIALAKEIQDY
3856 :     PDPRELDVVVSTGEQVTIGLLAMALKEIGVPAKSYCGWQVKVVTDQAHTKARIQSIDDEA
3857 :     MRGDLKEGRVVIVAGFQGVDEEGSITTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
3858 :     TDPRVVPEARRLKTVTFEEMIEMASLGSKVLQIRSVEFAGKYKVRLRVLSSFEDEGEGTL
3859 :     ITFEEDESMEKAVVAGIAFDRNEARINVKGVPDKPGIAYQILGPIADANIEVDMIIQNVG
3860 :     ENGTTDFSFTVPRGEFNRALTILREVQTHIGAAKIDADDKVAKISIVGVGMRSHCGIAST
3861 :     MFRTLAEEGINIQMISTSEIKVSVLVDEKYLELAVRVLHKAFGLDQAA
3862 :     >Ngon_Aa_|_CG-40
3863 :     MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
3864 :     PDPRELDVVLATGEQVTIGLLAMALKDIGVDAKSYTGWQVSLKTDTAHTKARIESIDDEK
3865 :     MRADLAAGKVVIVAGFQGISSEGNISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
3866 :     TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
3867 :     ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
3868 :     SEGTTDFSFTVPRGDYKQTLEILSERKDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
3869 :     IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFDLG
3870 :     >Nmen_Aa_|_CG-40
3871 :     MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
3872 :     PDPRELDVVLSTGEQVTIGLLAMALKDIGVEAKSYTGWQVALKTDTAHTKARIESIDDEK
3873 :     MRADLAAGKVVIVAGFQGISSEGDISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
3874 :     TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
3875 :     ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
3876 :     SEGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
3877 :     IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNLG
3878 :     >Neur_Aa_|_CG-40
3879 :     MAFLVQKYGGTSVGSTERIKQVAHRVAEFRAQGHELVVVVSAMSGETNRLISLAKEIQPN
3880 :     PDPRELDVILSTGEQVTIGLLAMALRELGIKAKSYTGPQVSITTDSAHTKARILKIDEDP
3881 :     IRADLAAGYVIIVAGFQGVDETGDITTLGRGGSDTTAVALAAALKADECQIYTDVNGIYT
3882 :     TDPRVVPEARKLDTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEGEGTLI
3883 :     TFEEDNKMEQPIISGIAFNRDESKITVVGVPDHPGIAYQILGPVADANIDVDMIIQNVGH
3884 :     DDTTDFSFTVHRNEYARTMDVLKQQVLPHIGAREVIGGDKIAKVSVIGVGMRSYAGIASK
3885 :     MFRVLAEEGINIRMIATSEIKISVVVDEKYMELAVRVLHKAFDLDQVNNTSTKTC
3886 :     >Neut_Aa_|_CG-40
3887 :     MAFLVQKYGGTSVGSVERIKQVARRVAEFWAQGHKLVIVVSAMSGETNRLISLAKEIQTN
3888 :     PNPRELDVVLATGEQVTIGLLAMALRELGIKAKSYTGSQVSITTDSAHTKARILKIDEDH
3889 :     IRADLTAGNVIIVAGFQGRDEAGDITTLGRGGSDTTAVALAAALKADECQIYTDVNGIYT
3890 :     TDPRVVPEARKLNTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEGEGTLI
3891 :     TFEEDNKMEQPIISGIAFNRDESKITVVGVPDHPGIAYQILGPVADANIDVDMIIQNIGR
3892 :     DGTTDFSFTVNRNEYTRTMDILKEQVLPHIGARDVIGGEKIAKISVIGVGMRSYAGIASK
3893 :     MFRVLAEEGINIRMIATSEIKISVVVDEKYMELAVRVLHKAFDLDQANNIDVKSC
3894 :     >Nmul_Aa_|_CG-40
3895 :     MTFIVQKYGGTSVGSTERIKNVARRVARFQARGDRVVVVVSAMSGETNRLIALAREFQAH
3896 :     PDPRELDVMVSTGEQVSVALLSMALMDLGIKAKSYTGAQVRIHTDSAYTKARILKIDEDR
3897 :     IRADLDAGYVVAVAGFQGVDEAGSITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
3898 :     TDPRIVPEARKLKTVTFEEMLEMASLGSKVLQIRAVEFAGKYKVKLRVLSSFEEEGEGTL
3899 :     ITFEEEKNMERAIISGIAFNRDEAKITVLGVPDRPGIAYQILGPVAEANIDVDMIIQNVG
3900 :     HDGMTDFSFTVNRNEFARTMDILKNQVQPHIGARGVIGGDRIAKVSVVGVGMRSHVGIAS
3901 :     RMFRTLAEEGINIQMISTSEIKISVVVDEKYMELAVRVLHKVFELDQIS
3902 :     >AZOA-1a_|_CG-40
3903 :     MALIVQKYGGTSVGNPERIKNVARKVAKFQAQGHKVVVVVSAMSGETNRLIALTKEVATH
3904 :     PDARELDVVVSTGEQVTIGLLCMALHDIGVKAKSYTGGQVRILTDSAHTKARILNIDEAP
3905 :     IKKDLDEGNIVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
3906 :     TDPRVVPEARKLDTITFEEMLELASLGSKVLQIRSVEFAGKYKVKLRVLSSFQEEGEGTL
3907 :     ITVEEDQNMEQPVISGIAFTRDEAKLTVLGVPDKPGIAYQILGPVADANIDVDMIIQNIG
3908 :     HDGTTDFSFTIPRGELDKTAKVLEGVKAHIGARAIEADKAMAKVSVVGVGMRSHPGVASK
3909 :     MFRTLAEEGINIQMISTSEIKISVVIEDKYLELAVRVLHKAFGLESA
3910 :     >Daro_Aa_|_CG-40
3911 :     MALIVQKYGGTSVGNPERIKNVAKRVAKFQAQGHQVVVVVSAMSGETNKLIALAKEVQAN
3912 :     PDPRELDAIMSTGEQVTTGLLSMALMDIGCKAKSYTGGQVKVLTDSTHTKARILSIDEAN
3913 :     MRRDLDAGYVIVVAGFQGVDANGNITTLGRGGSDTSGVALAAALKADECQIYTDVDGVYT
3914 :     TDPRVVPEAKKLDTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFQDEGEGTL
3915 :     ITVEEDKNMEQPIISGIAFNRDEAKLTMLGVPDTPGIAYQILGAIADANIDVDMIIQNVG
3916 :     HDGTTDFSFTVNRGEFAKAKEILEGVKAKLGAREITGDNKICKVSAVGVGMRSHPGVASQ
3917 :     MFKALADEGINIQMISTSEIKISVVLDEKYLELAVRVLHRTFGLDQ
3918 :     >ACIN-1a_|_CG-41
3919 :     MALIVQKYGGTSMGTPERILNVARRVKRWHDHGHKVVVVVSAMSGETNRLLALAKAITDT
3920 :     PDPRELDQMVSTGEQVTISMLAMALNSIGVEAKSYTGRQVGIKTDSAYNKARIEAIDTDV
3921 :     MTKDLDAGRVLVVAGFQGVDEEGNTTTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
3922 :     TDPRVAPKAKKVDRISFEEMLEMASLGSKVLQIRSVEFAGKYQVPLRVLSSFDNDNDGAF
3923 :     DEEFKQNVGTLITTEAEDTMEQPIISGIAFNRDEAKLTILGVPDEPGIAAKILVPISAAN
3924 :     IEVDMIVQNVEEDGTTDFTFTVNRGDLAKAKKILEETASNIGAREVSTRDDIVKVSIVGV
3925 :     GMRSHAGVASKMFMALAEESINILMISTSEIKVSVLIEENYLELAVRTLHTAFGLDREHG
3926 :     ESSARA
3927 :     >Parc_Aa_|_CG-41
3928 :     MALIVQKYGGTSMGSIDRIKNVAKRVKRWHDNGHQVVVVVSAMSGETNRLIDLARQISSQ
3929 :     PDPREYDQMVSTGEQVSISLLAMAIKELGIGARSFTGRQVAIKTDNAHNKARIESIDDKN
3930 :     IRQQLDAGNIVIVAGFQGIDEEGNATTLGRGGSDTTGVAIAAALGADECQIYTDVDGVYT
3931 :     TDPRVTSKAKKLEKITFEEMLEMASLGSKILQIRSVEFAGKYGVPLRVLSSFDENNDGSF
3932 :     DQDFQDNVGTLITIDEGDNMEQAIISGIAFNRDEAKIVVRGVPDHPGIASAILSPIGRAN
3933 :     IEIDMIVQNLSTNGMTDFTFTVNRTDMEKTMKVLENEVKDEIGAKEILANDEVVKVSLVG
3934 :     VGMRSHAGVASLMFQTLAENNINIQMISTSEIKVSVLIQEQYLEKAVRSLHTAFGLDRED
3935 :     GESKVAGL
3936 :     >Pcry_Aa_|_CG-41
3937 :     MALIVQKYGGTSMGSIDRIKNVAKRVKRWHDNGHQVVVVVSAMSGETNRLIDLARQISSQ
3938 :     PDPREYDQMVSTGEQVSISLLAMAIKELGIGARSFTGRQVAIKTDNAHNKARIESIDDKN
3939 :     IREQLDAGNVVIVAGFQGIDEEGNATTLGRGGSDTTGVAIAAALGADECQIYTDVDGVYT
3940 :     TDPRVTSKAKKLEKITFEEMLEMASLGSKILQIRSVEFAGKYGVPLRVLSSFDENNDGSF
3941 :     DQEFQDNVGTLITIDEGDNMEQAIISGIAFNRDEAKIVVRGVPDHPGIASAILSPIGRAN
3942 :     IEIDMIVQNLSTNGMTDFTFTVNRTDMEKTMKVLESEVKDEIGAKEILANDEVVKVSLVG
3943 :     VGMRSHAGVASLMFQTLAENNINIQMISTSEIKVSVLIQEQYLEKAVRSLHTAFGLDRED
3944 :     GESKIAGL
3945 :     >PSYC-4a_|_CG-41
3946 :     MALIVQKYGGTSMGSIDRIKNVAKRVKRWHDHGHQVIVVVSAMSGETNRLIDLATQISKY
3947 :     PDPREYDQMVSTGEQVSISLLSMAIKELGIGARSFTGGQVAIKTDNKHNKARIESIDAEK
3948 :     IQAQLDDGNVVVVAGFQGIDAEGNITTLGRGGSDTTGVALAAALGADECQIYTDVDGVYT
3949 :     TDPRVTSKARKLDKITFEEMLEMASLGSKVLQIRAVEFAGKYQVPLRVLSSFDEGQDGSF
3950 :     DEEFRQNVGTLITVDEGDDMEQPVISGIAFNRDEAKIVVRGVPDHPGIASGILTPISNAN
3951 :     IEIDMILQNLSDQGLTDFSFTVNRPDFDKAITILESIKGDIEAKEIHGNTDVVKVSLVGV
3952 :     GMRSHAGVASKMFQVLAENNINIQMISTSEIKISVLIKEQHLEKAVKSLHTAFGLDRADG
3953 :     ESKVAGL
3954 :     >Voku_Aa_|_CG-42
3955 :     MALIVQKYGGTSVASVERIQAVAQKIKAFKEKGHQLVVSVSAMSGETSRMTALAQTIQDI
3956 :     PSLREMDVLLTTGEQVTIALLTMALQQLGCDAVSYTGPQVCIMTDSEHGKARIKSIDNHR
3957 :     IFHSLDQGKVVVVAGFQGVDENGHITTLGRGGSDTTAVALVTALKADECQIYTDVDGVFT
3958 :     TDPRIEINARRINVVSYEEMLEMASLGSKVLQIRSVEFASKYKVPLRVLSSLIDNPLGTL
3959 :     ITREENIVEQVVISGIAHNKDEAKLSLIGVLDEPGIAFKILNPISSANIEVDMIVQSVSA
3960 :     REGLTNFAFTVHRNNFKTASKILNNVCKEIGAIAVQSDDKVVKVSLVGIGIRSHAGIATQ
3961 :     MFEVLHNEGINIQMISTSEIKISVVIDEKYLELAVRSLHAVFELDKE
3962 :     >Rmag_Aa_|_CG-42
3963 :     MALIVQKYGGTSVVSAERIQAVAQKIKAFKETGNQLVVSVSAMSGETNRMTALAQTIQNT
3964 :     PSLREMDVLLTTGEQVTIALLTMALQQLGCDAISYTGSQVRIMTDSEHSKARIKSIDDHR
3965 :     ICQSLAQGKVVVVAGFQGVDENGHITTLGRGGSDTTAVALAAVLKANECQIYTDVDGVFT
3966 :     TDPRIEPNARKMNVVSYEEMLEMASLGSKVLQIRSVELASKYKVPLRVLSSLIDNPVGTL
3967 :     ITSEENIVEQAVISGIAYNKDEAKLSLIGVPDKPGIAFKILSQISAANIEVDMIVQSVSA
3968 :     REGLTNFAFTVHRNDFKIASKILDRLCQELSAIAVQSDNKVVKVSLVGIGMCSHVGIASK
3969 :     MFEVLHNEGVNIQMISTSEIKISVVIDEKYLELAVRSLHVVFELDKE
3970 :     >Mhyd_Aa_|_CG-43
3971 :     MALLVQKFGGTSVGTTERIEAVADKVCRFRKEGHDVVVVVSAMSGETNRLIALANDIMDE
3972 :     PTPREMDVLVSTGEQVTIALLSMALQKRGCDARSYTGSQVRILTDSSHTKARIKQIDEQR
3973 :     MREDLDAGRVVVVAGFQGIDDNGNITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
3974 :     TDPRVVDSARRLERITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSSFQEGEGTLI
3975 :     TFEDENAMEQPVVSGIAFNRDEAKLTISGVPDTPGSALRILKPVSDANIEVDMIVQNVGE
3976 :     DNKTAFTFTVHRNDFKRAQEVLRGVTAELGAGEVGGDTKIAKVSIVGVGMRSHAGVATKM
3977 :     FEALSNEGINIQMISTSEIKISVVIDEKYLELAVRALHSAFELDKAGVEESA
3978 :     >Sdeg_Aa_|_CG-43
3979 :     MSLFVQKFGGTSVGTVERIKAVAKKVAGFRDQGHDIVVAVSAMSGETNRLIALAKEMQAT
3980 :     PDPREMDVLVSTGEQVTIALMCMALKDLGYDARSYTGTQVKILTDSSHMKARIQDIDVAP
3981 :     MKADLAAGRVVVVAGFQGVDENGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
3982 :     TDPRVVSSAKRLERITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSTFDDGPGTLI
3983 :     TLDEEYSTMEQPVVSGIAFNRDEAKVSILGIPDAPGVASKILAPIGDANIEIDVIVQNVA
3984 :     ADNTNDLTFTVNRADVDKARAVVERVATELGAREVVTDDKIAKISIVGVGMRSHAGVAST
3985 :     MFKSLAADAINIQMITTSEIKISVIIDERYLELAVRGLHTAFGLDKDQ
3986 :     >Abor_Aa_|_CG-43
3987 :     MALIVQKYGGTSVGTVERIQAVAEKVAGFHKRGDQVVVVVSAMSGETNRLIELANGVTDK
3988 :     PSPREMDVLVSTGEQVTIALLSMALQKQGLNARSYTGSQIPLRTDNTYSKARIEEIDDKK
3989 :     VRADLDGGSVVVVAGFQGVDNDGNITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
3990 :     TDPRVVDNARRLDSITFEEMLEMASQGSKVLQIRSVEFAGKYNVPLRVLSSFQDGPGTLI
3991 :     TVEDEVDMEKPVISGIAFTRDEAKIIVRGAPDTPGIAYKILGPVSAENIEVDMIVQNVGK
3992 :     DGAADFTFTVHRNDFARAQEALRNASEELGNPEIIGDDKIAKVSLVGVGMRSHAGVASKM
3993 :     FQALATEGVNIEMISTSEIKVSVVIAEKYLELAVRALHSAFELDQPGV
3994 :     >Hche_Aa_|_CG-43
3995 :     MALLVQKFGGTSVGSVERIEKVADKVKKFRDEGHDLVVVVSAMSGETNRLIGLAKDIMDE
3996 :     PTPRELDVLVSTGEQVTIALLCMALHKRGCEARSYTGGQVRILTDNAHTKARILEIDENN
3997 :     IRADLDAGRVVVVAGFQGEDESGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
3998 :     TDPRVVDSARRLDSITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSSFEDGPGTLI
3999 :     TTEDDENMEQPIVSGIAFNRDEAKLTVSGVPDIPGVASKILKPISDANIEVDMIVQNVGE
4000 :     DNHTDFTFTVHRNDFNKAKAILEKLCKELEAREVKGDSKIAKVSIVGVGMRSHAGVATTM
4001 :     FEALSKEGINIQMISTSEIKISVVIDEKYLELAVRSLHGAFELSEKPA
4002 :     >MARI_Aa_|_CG-43
4003 :     MALLVQKYGGTSVGTIERIEAVADRVLKHKQQGDDIVVVVSAMSGETNRLIDLAKSINPS
4004 :     PSAREMDVLLSTGEQVTIALLSMALMKRGLDARSYTGSQIRITTDSAHGKARIQKIDTEA
4005 :     MRADLDAGRVIVAAGFQGADELGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
4006 :     TDPRVVDSARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYQVPLRVLSSFVEGEGTLI
4007 :     TTEGSKGMEQPAVSGIAFNRDEAKLTLKGVPDIPGIASRILGPISDANIEVDMIVQNVSV
4008 :     DGTTDFTFTVHRNEYDQALSTLNIIAKELGASAVLSDAKIAKVSIVGVGMRSHAGVASTM
4009 :     FKALAAESINIQLISTSEIKVSVIIDEKYMELAVRALHSAFKLNETASGVREA
4010 :     >Avin_Aa_|_CG-43
4011 :     MALIVQKFGGTSVGSIERIEQVAEKVKKFRDNGDDIVVVVSAMSGETNRLIGLAKQISEQ
4012 :     PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSSFTKARILQIDDRK
4013 :     LRTDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
4014 :     SDPRVVPKAQRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFQEGPGTLI
4015 :     TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDNPGVAFKILGPISEANIEVDMIVQNIAH
4016 :     DNTTDFTFTVHRNDYLNAMRVLENTAREIGAREVIGDTDIAKVSIVGVGMRSHAGVASRM
4017 :     FGALAKEGINIQMISTSEIKVSVVIEEKYLELAVRSLHTAFELDAPARQGE
4018 :     >Paer_Aa_|_CG-43
4019 :     MALIVQKFGGTSVGTVERIEQVAEKVKKFREAGDDVVVVVSAMSGETNRLIGLANQIMEQ
4020 :     PVPRELDVMVSTGEQVTIALLSMALIKRGVPAVSYTGNQVRILTDSAHTKARILHIDDTH
4021 :     IRADLKAGRVVVVAGFQGVDGNGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
4022 :     TDPRVVPQARRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFQEGPGTLI
4023 :     TIDDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVA
4024 :     HDNTTDFTFTVHRNDYLNALEILKQTAANIGAREAIGDTNIAKVSIVGVGMRSHAGVASR
4025 :     MFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPARQGE
4026 :     >Pent_Aa_|_CG-43
4027 :     MALIVQKFGGTSVGSIERIEQVADKVKKFREQGTDLVVVLSAMSGETNRLIDLAKQITDQ
4028 :     PEPRELDVIVSTGEQVTIALLSMALMKRGVPAVSYTGNQVRILTDSAHNKARILQIDDQK
4029 :     IRADLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
4030 :     TDPRVVPQAQRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKEGPGTLI
4031 :     TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANIEVDMIVQNVSH
4032 :     DNTTDFTFTVHRNEYEKALAVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASRM
4033 :     FEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPARQGE
4034 :     >Pflu_Aa_|_CG-43
4035 :     MALIVQKFGGTSVGSVERIEQVADKVKKFREAGDDLVIVLSAMSGETNRLIDLAKQISGE
4036 :     AKPVPRELDVIVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHNKARILQIDD
4037 :     QKIRGDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGV
4038 :     YTTDPRVVPKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFQEGPGT
4039 :     LITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDNPGVAFKILGPISAANIEVDMIVQNV
4040 :     SHDNTTDFTFTVHRNDYLAAQTVLENTAREIGAREVVGDTDIAKVSIVGVGMRSHAGVAS
4041 :     RMFEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPARQGE
4042 :     >Pmen_Aa_|_CG-43
4043 :     MGALRGIRRLFEMALIVQKFGGTSVGTVERIQQVAEKVKKFREKGDDIVVVVSAMSGETN
4044 :     RLIDLAKQISDGEPVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSA
4045 :     YNKARILQIDDQKIRADLKAGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKAD
4046 :     ECQIYTDVDGVYTTDPRVVPKAQRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLR
4047 :     VLHSFQEGPGTLITLDEEESMEQPIISGIAFNRDEAKLTIRGVPDIPGIAFKILGPISAA
4048 :     NIEVDMIVQNVSHDNTTDFTFTVHRNDYNNALGVLQKTADELGAREVVGDTNIAKVSIVG
4049 :     VGMRSHAGVASRMFEALAKETINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPS
4050 :     RQGE
4051 :     >Pput_Aa_|_CG-43
4052 :     MALIVQKFGGTSVGSIERIEQVAEKVKKHREAGDDLVVVLSAMSGETNRLIDLAKQITDQ
4053 :     PVPRELDVIVSTGEQVTIALLTMALIKRGVPAVSYTGNQVRILTDSSHNKARILQIDDQK
4054 :     IRADLKEGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
4055 :     TDPRVVPQARRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKEGPGTLI
4056 :     TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISASNIEVDMIVQNVAH
4057 :     DNTTDFTFTVHRNEYEKAQSVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASCM
4058 :     FEALAKESINIQMISTSEIKVSVVLEEKYLELAVRALHTAFDLDAPARQGE
4059 :     >Pstu_Aa_|_CG-43
4060 :     MALIVQKFGGTSVGTVERIEQVAEKVKKFRDGGDDIVVVVSAMSGETNRLIDLAKQISEQ
4061 :     PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDAQR
4062 :     IQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
4063 :     TDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLI
4064 :     TLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAH
4065 :     DNTTDFTFTVHRNDYNNALQVLQGIAAEMGAREAIGDTNIAKVSIVGVGMRSHAGVASRM
4066 :     FEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPAGNTAE
4067 :     >Psyr_Aa_|_CG-43
4068 :     MALIVQKFGGTSVGSVERIEQVADKVKKFREAGDDLVVVLSAMSGETNRLIELARQISDQ
4069 :     PVPRELDVIVSTGEQVTIALLAMALMKRGVPAVSYTGNQVRILTDSAHNKARILQIDDQK
4070 :     IRSDLKAGRVVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
4071 :     TDPRVVSQAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYNVPLRVLHSFKEGPGTLI
4072 :     TIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANIEVDMIVQNVSH
4073 :     DNTTDFTFTIHRNDYQAALQVLEATAREISAREVSGDTKIAKVSIVGVGMRSHAGVASRM
4074 :     FEALAKESINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPRQGE
4075 :     >Deth_Aa_|_CG-44
4076 :     MAVVVHKYGGTSVGDAERIKHVAKRIIAARQKGSDVVAVVSAMGDTTDDLIALAHKLNDC
4077 :     PEPREMDVLLSTGEIVSSTLLAMALKNMGQDAISLSGQQAGIRTDSAHSKARITGIDPKR
4078 :     IHDELAKGRVVIVAGFQGVSDCQDVTTLGRGGSDTTAVALAASLGASICERYTDVDGVYT
4079 :     ADPRLIPDARRLAEISYEEMLELSSYGAKIMHPRAVEIGQVYNIPILVASSFNENPGTLI
4080 :     HGGENMEIRNRVSGIAHDFEVAKITILGVPDKPGIAAGLFAPLAKAGVSVDTIVQNSSQD
4081 :     HITDLTFTVTKSDLGKALEVIGPIAKDIQAREVLSDSRIGKVSIIGTGMLNAPGYAARMF
4082 :     KALSDAGINILLISTSEIRITCIIEEDKVKDAVKAIHKAFEMEKD
4083 :     >DEHA-1a_|_CG-44
4084 :     MAVVVHKYGGTSVGDAERIKHVAKRIIAARQKGNDVVAVVSAMGDTTDDLIELAHKLNDC
4085 :     PEPREMDVLLSTGEIVSSTLLAMALKNMGQDAISLSGQQAGIRTDSVHSKARITGIDPKR
4086 :     IHDELDKGRVVIVAGFQGISDCQDVTTLGRGGSDTTAVALAASLGASICERYTDVDGVYT
4087 :     ADPRLIPDARRLSEISYEEMLELSSYGAKIMHPRAVEIGQVYNIPILVASSFNENPGTLI
4088 :     HGGEKMEIRNKVSGIAHDFEVAKITILGVPDKPGIAAGLFAPLAKAGVSVDTIVQNSSQD
4089 :     HITDLTFTVTKSDLGKALEVIGPIAKELQAREVLSDSKIGKVSIIGTGMLNAPGYAARMF
4090 :     KALSDAGINILLISTSEIRITCIIEEDKVKDAVRAIHKAFEMEKD
4091 :     >Dred_Ab_|_CG-45
4092 :     MLVVKKFGGSSVADPERIKRVARRVVEEHQKGNQVVVTVSAMGDTTDDLVSLAKQVTNDP
4093 :     SEREMDMLLSTGEQISIALLSMAIRDLGSDVISLTGGQVGIYTDDVHSKAKILKIETSRV
4094 :     KEELEQGRVVVVAGFQGIKSNHDITTLGRGGSDTTAVALAAALKADICEIFTDVDGVYTT
4095 :     DPRLVPEASKLKNISFDEMLELASLGAQVLHPRSVELAKQYGIPIHVRTSFDHREGTIVE
4096 :     EAPNMENAPVVSGVAHDYNVAKIGLFDVPDQPGVAKKIFKALSKHNLNVDMIIQSAMRNN
4097 :     MNDIGFTTTQDDLRKALQTIEAIQQEVGFRGYNHDEDVAKVSIVGAGMISHPGVAADMFE
4098 :     ALADEGINLEMITTSEIKVSCVIKRSETEKAVKALHKKFKLDNLAEASIYNR
4099 :     >Pthe_Aa_|_CG-45
4100 :     MLIVQKYGGSSVADAGRIRQVARRVAGARADGHRVVVVVSAMGDTTDELIQLVKEVTDSP
4101 :     PEREMDVILSTGEQVSIALLAMAIKDLGEPVISLTGAQVGILTDNVHTKAKILHVNTARL
4102 :     MDELNRGNIVVVAGFQGINSANDITTLGRGGSDTTAVALAAALKADLCEIYTDVDGVYTA
4103 :     DPRLVPEARKLDVVSYEEMLELANLGAVVLHPRSVELAMQYGIPLHVRSSFNHNSGTVVK
4104 :     EAENMEKALVVTGVAYDMNVAKVGLYNVFDRPGIAYKLFKALADENINVDMIVQSAMRGD
4105 :     RNDISFTCTQGDLKKALQVVERLLPELGASGYTSDDSVAKVSIVGAGMVSNPGVAARMFE
4106 :     AIYEEGINLEMISTSEIKISCIIKAHEAGKAVKALHKKFNLAQEHDQ
4107 :     >Csac_Aa_|_CG-45
4108 :     MGIVVQKYGGTSVADKERIFRAARRAVAEYEKGNKVVVVVSAQGDTTDELIEKAKEINEN
4109 :     PSKREMDMLLSTGEQISIALMAMAIEKLGYPVISLTGWQAGIKTDSNYSNARIKEIDTER
4110 :     LQRELDKRNIVVVAGFQGINKYDDITTLGRGGSDTTAVALAAALKADKCEIYTDVDGVYT
4111 :     ADPRIVPNASKLKEISYDEMLELATLGAKVLHNRSVELAKKYNIPIVVRSSFNDNEGTVV
4112 :     KEVSSVEKLLVSGVACDKDIARVAVIGVENVPGKAFQIFSLLAKENINVDIILQSIGREK
4113 :     TKDISFTVSKSNLKQTLDVLTKNLHVIGAKDITYADNVAKVSIVGAGMVNNPGVAAMMFE
4114 :     ALYDAGINIEMISTSEIKISVLIDEKDAEKAVRAIHDKFKLHLLNSNGK
4115 :     >Noce_Aa_|_CG-46
4116 :     MTLIVQKFGGTSVGTLERIEAIADKLVAFQRRGDSLVAVVSAMSGETNRLLALAHEIHSQ
4117 :     PNPRELDVLLSTGEQVTIALLSIAIEKRGIPARSYTGSQVYIRTDSAHNKARIQEIDAKR
4118 :     IHDDLRQGRIVVVAGFQGADEKGNITTLGRGGSDTTAVALTAALEAGECQIYTDVDGVYT
4119 :     TDPRVVPEARRLARLTYEEMLELASLGAKVLQIRAVEFASKHHVPLRVLSSFEKGEGTLI
4120 :     TSEVEGMEEPLISGIAFNIDEAKLTILGVPDKPGVAYHILGPVADANIGVDMIIQNVGRD
4121 :     GTTDFTFTVHRNDYLKALEILRESASTLGAREVRGDDKIAKISVVGVGMRSHAGIASTMF
4122 :     HTLAQEGINIQTISTSEIKISVVIEEKYLELGVRALHSAFELEKAPSRISSSL
4123 :     >Aehr_Aa_|_CG-46
4124 :     MALIVQKYGGTSVGTTERIKNVARRVQASRERGDDVVVVVSAMSGETNRLLALAEEIGPN
4125 :     PPAREVDVLVSTGEQVTIALLTMALESIGTPARCYTGPQVRILTDSAHSRARILDIDAKQ
4126 :     INDDLRLGRVVVVAGFQGVDESGAITTLGRGGSDTTAVAIAAALKADECQIYTDVDGVYT
4127 :     TDPRVVPKARRLERITVEEMLELASLGSKVLQIRSVEFAGKYKVPLRVLSSFKEGPGTLI
4128 :     TYEENPMEEPLISGIAFNRDEAKLTVLGAPDVPGIAASILGPISDAGIEVDMIIQNVSTS
4129 :     GATDFTFTVHKRDYEQALKILQDNKDKLGAREIYGDPKIVKLSLVGVGMRSHAGVASTMF
4130 :     KALSAEGINIQMISTSEIKISVVVDEKYLELGVRTLHTAFGLDDENAQVEVEGDNA
4131 :     >Hhal_Aa_|_CG-46
4132 :     MGLVVKKFGGTSVGTTERIQAVAEQVKASREAGDDVVVVVSAMSGETNRLVELAESIHPN
4133 :     PPAREVDVLLSTGEQVTIALLTMALEQIDCPARCYTGAQVRILTDSSFSRARILDIDAEP
4134 :     LQEDLQRGRVVVVAGFQGVDEEGALTTLGRGGSDTTAVALAAALEASECQIYTDVDGVYT
4135 :     TDPRVVPEARRLDRITVDEMLELSSLGSKVLQIRAVEFAGKYRVPLRVLSSFEEGPGTLI
4136 :     TYEEEGMEEPLISGIAFNRDEAKISVIGVPDTPGIAAKILGAVAEANIEVDMIIQNISQQ
4137 :     GLTDFTFTVHKRDYQATLDLVRDNAEQLGAREVYGDDKIVKLSLVGVGMRSHAGVANTMF
4138 :     RALSNEGINIQMISTSEIKISVVVEEKYLELGVRALHKAFELDVQPVAELEGLSDE
4139 :     >Srub_Ab_|_CG-47
4140 :     MPDRSFSSTECASRPVRVLKFGGTSVGSADGIKNAVRLVHAATETCRPVVVVSAAAGVTD
4141 :     ALVQAAEESRADRGSVEAWTRRVGRRYRALAANTLADEALRARYDTALRTELSELRRALQ
4142 :     EMAGPNAAAARDVVLAAGERLMVPLLAAALDASGCTSQAVDAATLIRTDAAHGDATVQWA
4143 :     PTRRQVRDWHRTRAAGLPVVTGFVGETADGKTTTLGRGGSDLSAAVLAWALAAERMERWT
4144 :     DVEGLYTRDPDAHSDAQPLQRIDFEQARAWTKAGRLGMHPCTLDPLMDAGIPLRVRCTHR
4145 :     PAAPGTRIVPAPTLAQG
4146 :     >Srub_Aa_|_CG-47
4147 :     MVFKFGGTSVGRPDRFRTVVQLIREAAAEGRVVAVVSALSGVSRQLASALEAVSTRADGA
4148 :     TAVETLTDTLRTRHAEQAEAVLCADRKRTYEAILDERLEALRCAFERVEQDIDVPAARDA
4149 :     VLAVGEQLSVPMVTLALRDAGLHAPRCDATDLVVTDDTFGAAQVQHDDTSERVRAWYRSL
4150 :     DPAAVPVVAGFIGATEDGRPTTLGFEGSDYSAALFAKLLGAQGLTRYTDVDGIYTDDPDA
4151 :     NEDAERVDHLSMEEALARSASGGLGMHPKTLRPLADAGIPMQVRSIVAPECPGTPIVPAE
4152 :     RTADALWPAP
4153 :     >Ahyd_Aa_|_CG-48
4154 :     MALYVQKYGGTSVGTLERIEAVAERVEQTRAQGHDVVVVVSAMSGETNRLLGMAQQLDPD
4155 :     ANRREMDVLVSTGEQVTIALLAIALNKRGCPAVSMTGDQVRIHTDSAYGKARITHIDTEQ
4156 :     VQAELGAGKVVVIAGFQGRDEHNAITTLGRGGSDTTAVAVAAAIKADECQIFTDVDGVYT
4157 :     TDPRIEPKARRLDTITFEEMLEMASLGAKVLQIRSVEFAGKYRVPLRVLSSFVDGEGTLI
4158 :     TYGGERMEAPLVSGIAFNRNEASLTILGVPDRPTVAAQILNPISDANIDVDMIVQNTLGD
4159 :     GTADFTFTVNRDDYRRARALLEETASELGAACVQGNGEIAKVSIVGVGMWNHPGVARTMF
4160 :     KVLGEEGINMQLISTSEIKISVVIDEKYLELAVRALHSAFGLDQEPHEQPLGNNP
4161 :     >Asal_Aa_|_CG-48
4162 :     MALYVQKYGGTSVGTLERIEAVAERVQLTRAQGHDVVVVVSAMSGETNRLLGMAQRLDPD
4163 :     ANRREMDVLVSTGEQVTIALLAIALNKRGCAAVSMTGDQVRIHTDSAYGKARISHIDTEQ
4164 :     VQAELGAGKVVVIAGFQGRDEHNAITTLGRGGSDTTAVAVAAAIKADECQIFTDVDGVYT
4165 :     TDPRIEPKARRLSTITFEEMLEMASLGAKVLQIRSVEFAGKYRVPLRVLSSFVDGEGTLI
4166 :     TYGGERMEAPLVSGIAFNRNEASLTILGVPDRPTVAAQILNPISDANIDVDMIVQNTLGD
4167 :     GTADFTFTVNRDDYRRARALLEETASELGAACVQGNGEIAKVSIVGVGMWNHPGVARTMF
4168 :     KVLGEEGINMQLISTSEIKISVVIDEKYLELAVRALHAAFGLDNEPHEQPLGNNP
4169 :     >Nmar_Aa_|_CG-49
4170 :     MTKLVVAKFGGSAIGPNGVSIPEIIQRITNLKQDSKVIAVFSAPLTLDNGKKRSLTDVML
4171 :     EQGRNAENGVTPSLDIIKSTYEKILELVDDENKGKCENVIEQNLEKAKKALDEAFESKEF
4172 :     VDEVRSRALAFSGEILMSHVMNYILRSNKIKAETVDFEDWPIITDNNIESTNFLTSESRT
4173 :     KMDKTAELVEQNEVVTIGGFIGKTVDNVTTTYERGGSDRTAADLGILFHKSYETSIDFEK
4174 :     DSAVVSADPKIVESGLREVHQLSYNEARLAGMFGMKILDPIAIKEIVENGVDMPITVTNM
4175 :     KNPDKITTIKRILDEQKGHPIKIVTGKENCAIFRIETNSIQKLLTSLDKDKRYSEFVILS
4176 :     PFTKDGIEFSRILFLDGDYVKRNEKYLLGFDSLATITYNRGVITLIGDEMWRVQQVASRT
4177 :     SAKIGEAGLNILNMDAQEETSRIIIVVEDTKDNIRKAISAIHQEISEINFI
4178 :     >Csym_Aa_|_CG-49
4179 :     MERLVVTKFGSSAMGPDGSNMPVILDRIAELGKDAKVVCVFSAPLTQDGGAARSITDVML
4180 :     DMGESAASGGGFDLSGVKSAYGRVAEHATGQGRAECADIIDKSLRRAGEALGAAEAAGSF
4181 :     VHEARADALAFSGELLMSYLMDAILRSRGTRSAAVPFDSWPIITDDNPETTNFLHAESEA
4182 :     RAGALLELVGSHDVVTMGGFIGRTPNGATTTYERGGSDRTAADLGILLHSRYDARIDLAK
4183 :     DSAVVSADPRVVREGLSPVEELSYNEARQAGMFGMKILDPIAIKEIFENGVDIPIVITDL
4184 :     ADPRNRTVIRSGPVASNGHPLKIVTGKRNCAMFRAEADSADRLLASLEGEKRYSEFVVLS
4185 :     PFTKNETEFSRVLFLDGDFVRRNERYLRGFDPLAAVTYNRGVITMIGDEMWRVQQVASRA
4186 :     SAGLGSAGLNILDMDAQEETSRIIIVIEDSGDNMERAIRAVHAERETIGFV
4187 :     >Nmar_Ab_|_CG-50
4188 :     MRLVIKYGGTSISSAKDIRAVANHLNSLSKKNQIVVVCSATSGTTDDLIEISQSIKKENK
4189 :     SKAEQLASKITNRHKQLAKQTIKKADLRKKLLKNFDDDFAELVALIDGMVLLGEVTPRTM
4190 :     DYLFSFGERLSIKLVSMAVNDSGKKSVPLTGKEVGIVTDSNFGESKPLIDTTRLRVSKNV
4191 :     ENLFSKKTVPVVGGFVGADQHGHVTTFGRGGSDYSATIIGTCIKADEIWLMSDVDGLMTA
4192 :     DPKIVKNAKLLKEVSYIEAIEMALFGAKQIHPRTFEPLLSKKIPMKIRSSFNLKNEGTLV
4193 :     TASPSPSVKNTVKCVSNVRNNGLIDIQGGSMVGTPGTAAKIFATLAKAGINVMMISQNPS
4194 :     ESSITIVVKNADLDKAVSSLEMELLGKIIKKLEVTTNVAIIALIGSGMRGTVGVASKVFG
4195 :     AAEKNKVNVSMITQGSSELNLAFVVKNSDTNAAVRALHNAFALDKIN
4196 :     >Csym_Ab_|_CG-50
4197 :     MRLVIKYGGTSMDEPGKIRDAAAFVASQGGEVVAVCSAASGTTDNLMGISGLIRKGDGKG
4198 :     ARAAADGIMRYTRELAEGAVSVEEDRERLSAALDGALAELNGLIDGMALLGEVTPRSSDY
4199 :     LLSFGERLSSEILASAISERDRKAEALAGNEAGIVTDSNFGGARPLMDTTGLRVSKKIGG
4200 :     LLLEGVIPVVGGFVGADQYGRITTLGRGGTDYTATTVGASIKADEIWLMSDMDGLMTANP
4201 :     RVVGGARVLDEVSYAEAVEMAMFGAKQIHPRTFEPLMGTRIPMRIRSAVNTGNPGTLVTA
4202 :     SPGPESGRTIKCVSALRHNALIDIRGGGMVGEAGTAAGIFSTLAGAGVNVMMISQNPSES
4203 :     SITVVIKKSDMDRAVDALEIGLAGKVIKKLEVTPDVAIVALIGSGMRGTVGIASRVFGAA
4204 :     ASKGLNVVMITQGSSELNLAFVVGDDDCWEAVRALHDEFGLGAPGGRAAG
4205 :     >Mmar_Aa_|_CG-51
4206 :     MTRVVAKFGGTSVGTIERIRHAAGLVADAARRGETMTVVVSAMAGETDRILGLAGAFGSG
4207 :     LGDRETDVALAAGEQVSSALMALALREAGLEAQSFLGWQLPVITDGPPGASRIAGMDVAV
4208 :     LEAAIDAGIIPVVAGFQGITETGEVRTLGRGGTDLSAAALAAALQARCDIYTDVDGVYTT
4209 :     DPRVEPDARRLDTISHDEMLELAAQGAKVLQTRSVEFAKARGVPMRVLSSFLEAGASRGT
4210 :     DVVSEQAIAERRLVSGVAYARDQARIALHGASNRSDMAARCFASLAEAEVGVDMIVQAHA
4211 :     RQPGTVTLEFSIAHRDLDRAQAVLEDAMTGVRISAETGLAKVSVVGAGLRQRADVARSLF
4212 :     AVLGDQDIAVKVLATSEIKISALIENDAVERAVRALHAAYGLDQV
4213 :     >Oale_Aa_|_CG-51
4214 :     MTAPRLVLKFGGTSMANPERIAHSASIVAAEARAGKQVAVVVSAMAGETDRLLGAAEALG
4215 :     GGLGETETDTVLAAGEQASAALMALALKREGFQSQAVMGWSLPILVEGPPGGAKITDIHG
4216 :     EQLDAMLSAGVIPVVAGYQGLNAEGRLATLGRGGTDLSAAAVAAAVGAECDIYTDVDGVF
4217 :     TTDPRIAPEAVRVERISHDAMLELAAMGAKVLQTRSVEYAKAKGVTLRVKSSFLPAGQSA
4218 :     GTEVTPEFEIGEKRIVSGVAYVRDQARLSIHGGEGPQAAELLFAALGEADVDVDMIVQAR
4219 :     ARSGGSVVECSVAGRDLPRALAAAEAAARPNGLEVRSETGLAKVSVVGTGLRGRADVART
4220 :     LYGVLAREGIAVRMTATSEIKISALVDADYLEHAVRALHAAYRLGSAPSKA
4221 :     >Oale_Ac_|_CG-52
4222 :     MDPQLNVSSAPKGLCVLKFGGSVLTSEADYAAAGAEIYRHVRAGEKTIVIVSALKGETDQ
4223 :     LLAQADANGGAPFPDITARLARLGEFRSAALMGLALSQLGLKAKVLDPHEIGLMAEGDPM
4224 :     DANLSELDAGALAGALDEADAVVLPGFTACHAEHGAATLGRGGTDLTAVFFAVKAGANRV
4225 :     RLIKDVDGVYTDDPAKDPHAQRYDALDYDQAMDASRGLIQPKAIEAAKAADLVVEVAAMG
4226 :     AREATRIASGPAVIGRPRHRGPMKVALL
4227 :     >Mmar_Ac_|_CG-52
4228 :     MALPDQPQPDQADRPLKLCVLKFGSSVLFKPDDYARAAHEIYRHVRAGEKVVAVVSALDG
4229 :     ETDALFGVGNDVGQGCSDALLARLVRCGELKSAALMGLALERSGIPSAVLDPHEMGLRAE
4230 :     GEALDANLTGLDASRVLKRFASVDVIVAPGFFGEGADGPVTLGRGGTDLTAVEFAHWLGA
4231 :     DRVRLIKDVDGVYTDDPAKVANAKRFDQLDYDEAARVSRGLVQDKAITRAKEQDVVIEVA
4232 :     ALGRPYATRIAAVEQRAGDGLEMKPMRVAVLGHGAVGAGVCAHLLAHPGRFTLNPVLVRD
4233 :     PAQHSAGAAAELSFTDDPARALG
4234 :     >Mkan_Ab_|_Orp
4235 :     MRVVMKFGGTSVGTGESIRKVAKIVTDAAEEHEVIVVVSAMSGVTDELVRAAESAPDWTE
4236 :     EDVKNFVGKLRRRHGKAASEAISSDLIRREVMGYVDSLLEELEKVLLGLSYVGEVTPRSM
4237 :     DLILSFGERMSAPIVAGALRDRGLEAEHLEGGEAGVITDDGFGEAEPILPACRRKAQKTL
4238 :     IPMIESGKIPVITGFIGRTIDGEVTTLGRGGSDYSAAIIGCISEADEVQIWTDVDGVMTA
4239 :     NPNLVPDARTVPRLSYEEAMELASFGAEVLHPKTVIPARSENIPIRVKNTFNPESEGTLI
4240 :     TSESEPSEQVVKAVASSSDVGMIDIRGTTMIGRPGVAGRIFSRLGDEGINVIMISQSASE
4241 :     SNISIVVSRPEVRRAARIIEREFVGERVVERVTTYEDVAVVAVVGEGMRGTPGVASRVFR
4242 :     AVADAGVNIKTISQGASEVNISFVVAEEDEAAAVNAVHSEFELGEEA
4243 :     >Susi_Ab_|_Orp
4244 :     MKDLLVMKFGGTSVGSAERMKVAAQLAAQEQKKRPVAIVVSAMSKVTDLLLDTMRHAEAG
4245 :     DRAGMERNLNLLRERHEQACRELLPASEQGAVLAKLHDVIDEFERIVNGMAMLGERPPRS
4246 :     VDEAVAVGERLTVVLVSEHLRVSGTPSVAVNARDVVVTDAVFGNASPLMEPTRVKARATL
4247 :     RPQLEQGLLPVITGFNGATADGRPTTLGRGGSDFSASIVAAALDASELWIWTDVDGIMSA
4248 :     DPRLVPDAQVLEEITYAEAAELAYNGAKVLHPRTLAPLVEKAIPVWSKNSFAPEKPGTKI
4249 :     VPSMAVEHGARAVASMRNVALVSLTPASPEVNGVQVLARALEAIARADVEVLVLTSSSYR
4250 :     QNFCVLVREDELDRSVQALESALALELAHHYVHPIEVDRNVGLLAAVGEGMQGKPGLAGR
4251 :     IFTAISRVQVNIIAIAQGSSELTIAVVVRREGLEKAVKAVHAECGLGMRPPVPVFPFGAS
4252 :     EGRAQRPTKR
4253 :     >FRAN-2a_|_Orp
4254 :     MAIIVQKYGGSSLATIEKIRGVARRVVDTAAAGKQVVVVVSARGRTTDELLGEARALGGH
4255 :     WRSRESDQLVSTGEVVSAATTALALRELGQPAVSMTGGQAGIQVSGEFGSAAVHSVTPDR
4256 :     LRTSLEEGKVVVVAGFQGVDASGDVRTLGRGGSDTTAVALAAALGATCEIYTDVDGVYTA
4257 :     DPRLVPRARLLPTVPAPLMHEMAHTGAGILHPRAVDLAATRRIPVQVRNSLGTNPGTVVE
4258 :     VVPGNPLESDGVVAAVTQDEDTTLVMMRGRGEPLDSWAALARMASAKVAPADLFALADST
4259 :     HGSTLGFTSSPARQIDLAHIARQAGGTVELRDDLGRLSLVGTRMNLCGAVIETLAEILST
4260 :     HGIRSPWIAISERRISILVPRGGMRRLALTIHDALVLGRGLEAHSSDR
4261 :     >Faln_Aa_|_Orp
4262 :     MAGDVVVLKFGGAAFAAPGAHQGIARHVADRLRAGGSSASPGGARAIVVVSAVAGETDRL
4263 :     GTALRAVSPAPDRDLLAAALMTGETVNVALMTAALRDAGLAAVALTAADTGFVGAGEPHC
4264 :     ADLRRIDGSVLASLVEPAGTVLVVPGGQAVDGDGRPIMLGRNSSDLSAIAAAIAVGARAC
4265 :     EIFSDSPGICTADPRLVPDARTLAAVDYDTMITMSRHGAKVLHHSAVAWAQRHGVEIRCR
4266 :     SLLPDGAVYSVVRAGRTSAAAVLVHGTGTVWAGDPDLVRATLAELGSDAVAIPEAAAVPE
4267 :     VAVTEVAAVPEVAAVPDVAVTDVAVTEVAVTEVAAAAATAGIAGTAAVGEPVGGTVAHLV
4268 :     LADAARDLRPRGLRHRADLRLVTTLFPDGRLQHRLVPAAEAPTVARAQHDVVVA
4269 :     >Twhi_Aa_|_Orp
4270 :     MSLIVQKYGGSSLASANNLKRVAERVSRAYYGNNRLVVVVSAMGSTTDRLLTLAHEVSVE
4271 :     PERRELDVLLSTGECVTASLLAMAINSIGLPARSFTAAQAGIVTDEHHCNARIITITPTL
4272 :     IEDALNAGEIAVVAGFQGVNRKGQVTTLGRGGSDTTAVALAAALKADRCEIYSDVEGVFT
4273 :     ADPRIVPKARLLESIPIDHMLELSTAGARILSLRSVVFAKRHNVSVKVGSTFSDTSGTIL
4274 :     CNEGEAMEEPVITGIATDTSQARITIVGLPDIPGSAAEVFSALSVAEVAVDNIVQNFSSS
4275 :     NTGFIDLSFTSPKAQGPAVTSALRENQTRIGYKDLQYDDEVGKITVVGSGIQHSADISAQ
4276 :     LFRLLSDAKVNVEMISTSEMRISFVVRANVVAEVARLIHTSFGLDADLRAVVHSEGRV
4277 :     >Sgri_Ab_|_Orp
4278 :     MTTQGSRPTGDVVVQKYGGSSLATVSQVRQVADRVGALARSGRRVVVVVSAQGDTTDELV
4279 :     GRAEAVNPRPAGHELDQLLATGETASAALMAMALQRGGLAATALSGARSGVLATGPHGAG
4280 :     VIVAVDTDQLRTLL