[Bio] / FigWebPages / ask_Orphan.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_Orphan.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Faln_Aa_|_Orp
MAGDVVVLKFGGAAFAAPGAHQGIARHVADRLRAGGSSASPGGARAIVVVSAVAGETDRL
GTALRAVSPAPDRDLLAAALMTGETVNVALMTAALRDAGLAAVALTAADTGFVGAGEPHC
ADLRRIDGSVLASLVEPAGTVLVVPGGQAVDGDGRPIMLGRNSSDLSAIAAAIAVGARAC
EIFSDSPGICTADPRLVPDARTLAAVDYDTMITMSRHGAKVLHHSAVAWAQRHGVEIRCR
SLLPDGAVYSVVRAGRTSAAAVLVHGTGTVWAGDPDLVRATLAELGSDAVAIPEAAAVPE
VAVTEVAAVPEVAAVPDVAVTDVAVTEVAVTEVAAAAATAGIAGTAAVGEPVGGTVAHLV
LADAARDLRPRGLRHRADLRLVTTLFPDGRLQHRLVPAAEAPTVARAQHDVVVA
>Mxan_Ad_|_Orp
MMKFGGTSVGSPTRLRQVVELIGKHARQGPLAVVVSAMGDTTDWLLDAAHLATEGDLEGA
LAVATRIADLAKANAAALAPGQATALAERVDGLLAPLRQLLHGVSLTRECSAPTRDRVLS
FGELVSATLLAELLTAHRTPATFRDARQLLVTDDRFGAARVDLVRTRERLQAARETWGVE
VPVLPGFIAATPDGRTTTLGRNGSDYTAALVAQGLGASEVTVWTDVLGLHTADPELVTDA
YPVAHLTHGEGLELAAVGARMLHPRTMIPLIESGISLRIRNTMEPEHPGTLIDAIGSRDG
QRPACIATREDLALLGIEVRKLSDQFQLGERVLAALREARVTVWMTAQSANGQSLAVVVP
RPDAEHARSVLVTELAQELSRREVEPLEVRQPVTLLTLVAETMGHGVNVAGRFFSALGAV
GVNVRASAQGASSRSLSCVVDAADTAVAARTTHAAFNLAHQQVSLFVL
>Rxyl_Aa_|_Orp
MSSAEPLVIKFGGTSVGDGEGFARAARITAGAAAEGRPVAAVVSAMSGVTDALLAAAAGT
ATAGTRTARGLARDLRRALGERHLAAARCAVSGDLLPEVEARVLSLLDRLEEELARRALP
EAERRAEIAVCGERLSAEILAGALRAAGAPAAVAADPIATGPGGEEVLSEETRARCTRHV
RPLLEEGLVAVVPGYAGRSPDGAVTTLGRGGSDLSATALGRGIGAGEVWIMTDVDGVLDA
DPRLVPGAATLPRLSYREAGAFAALGAEVLHPRTMEPAAAAGIEVLVRNTFDPHSPGTRI
SARECGPGLRALALRRGLSVEPLEALDGRSGDVFCLLGADVYGIRALVERPSGSAAAVIG
VGSPGDEELAAGLRRLHRAGIRPLWAGNTAAGLAFVVAGSRAEEALRELHAALLRREALA
GEAVA
>Mxan_Ac_|_Orp
MRVMKFGGTSVGNAERMRGVADLAAAARKQTRVMMVASAVSGITNLLLEAARAAQEGQPV
ESLHGRFEDVHRGIIRELAPELGEARQRSLEEGLSTLASELRGLLQGVGLLRECSPSVLA
HLSGLGERAACLILGALMHARGLEPHAVEPRDVILCAGDPLQATPLQEETRARFTPLREA
GGPGLMLMPGFFGGDTRGKTMCLGRGGSDYSAALAAAALDAELLEIWTDVDGIFSADPRL
VPEAFPLPEVSFEEAMELAYFGAKVLHPKTIAPARERGIPVRVCNSFRPDHPGTRVTDDA
APPEHPVRGLSFLPGIALVNLGGAGLKGVPGTAARVFESMALANISVVLITQGSSECSIS
FCVQQADAERAVQALEVAFEMERAAGKVDTIEQQRGLAVLSIVGDGMRHRVGVAGTFFSA
LADVGCSIAAIAQGSSERSISAVIAETDGPRALAHVHGRCFGTTEVVELLLA
>Susi_Ab_|_Orp
MKDLLVMKFGGTSVGSAERMKVAAQLAAQEQKKRPVAIVVSAMSKVTDLLLDTMRHAEAG
DRAGMERNLNLLRERHEQACRELLPASEQGAVLAKLHDVIDEFERIVNGMAMLGERPPRS
VDEAVAVGERLTVVLVSEHLRVSGTPSVAVNARDVVVTDAVFGNASPLMEPTRVKARATL
RPQLEQGLLPVITGFNGATADGRPTTLGRGGSDFSASIVAAALDASELWIWTDVDGIMSA
DPRLVPDAQVLEEITYAEAAELAYNGAKVLHPRTLAPLVEKAIPVWSKNSFAPEKPGTKI
VPSMAVEHGARAVASMRNVALVSLTPASPEVNGVQVLARALEAIARADVEVLVLTSSSYR
QNFCVLVREDELDRSVQALESALALELAHHYVHPIEVDRNVGLLAAVGEGMQGKPGLAGR
IFTAISRVQVNIIAIAQGSSELTIAVVVRREGLEKAVKAVHAECGLGMRPPVPVFPFGAS
EGRAQRPTKR
>Mkan_Ab_|_Orp
MRVVMKFGGTSVGTGESIRKVAKIVTDAAEEHEVIVVVSAMSGVTDELVRAAESAPDWTE
EDVKNFVGKLRRRHGKAASEAISSDLIRREVMGYVDSLLEELEKVLLGLSYVGEVTPRSM
DLILSFGERMSAPIVAGALRDRGLEAEHLEGGEAGVITDDGFGEAEPILPACRRKAQKTL
IPMIESGKIPVITGFIGRTIDGEVTTLGRGGSDYSAAIIGCISEADEVQIWTDVDGVMTA
NPNLVPDARTVPRLSYEEAMELASFGAEVLHPKTVIPARSENIPIRVKNTFNPESEGTLI
TSESEPSEQVVKAVASSSDVGMIDIRGTTMIGRPGVAGRIFSRLGDEGINVIMISQSASE
SNISIVVSRPEVRRAARIIEREFVGERVVERVTTYEDVAVVAVVGEGMRGTPGVASRVFR
AVADAGVNIKTISQGASEVNISFVVAEEDEAAAVNAVHSEFELGEEA
>ROSE-4a_|_Orp
MPLLVMKFGGTSVGDAAAIQAVAAITEAQRAAWGRVVLVVSAMSGVTDMLIRGATTAASG
DKHTFRDLDRMLREKHAAALAELVPDDQERTAIDDQIARLIDEFSILCHSVAVLGELSPR
AIDAISSLGERMSVRVVAAALRARGIPAEALDASEFVVTTAHFGDARPLQEVTRERTRAR
ILPLLGRGIVPVITGFIGATEQGVTTTLGRGGSDYSGAIIGAALDADEVDIYTDVDGVMT
TDPRLAPDARVIPVLSYAEMGELAYFGAKVLHPRTIRPIVERGIPLRVRNTFNPYHPGTL
VVQDVESNGQTVKAVTAIRNLSLVTVEGRGMIGVPGVAARTFGAVASVGANVLMISQASS
EQSICFVVPSSTIPQVTYALEHNLAMELARRDIDRIWAREDVAIVTAVGAGMRDTPGVAA
RVFGALADNHINVIAIAQGSSECSISTVVAAADCDAAVRAVHRLTGV
>Crud_Aa_|_Orp
MIIIQKFGGTSVGTKKRIKSLKNIIKKYRNLNIRIVIILSAMSGETTKMLRLAKYFKYKK
LKSIDFMLCIGEQMSVSLFNLLLNSVKILSIPLISSQIGFITNNNYSNARIILIKNIVLI
KKILKKKQIPVLTGFQGITLNGNLTTLGRGGSDTSAVAISIYLKATECQIYSDVKSIFVS
DPRICLNYRINFLPFENMLELSSLGSKILFVRSIELARKYNVNIRLLSSFFKKKGTFISK
KKKFVNSMERVLISGISYTSNEVKITVANIPNVSGVLSKILGPIISNGICIDMVIQNSLN
HLKFTNFTFLIEEFFLKKVIFLIKKFFITKIGGRVEYEKHISKVSVIGIGLRSHNYIIGK
IFYSMSKLGINIILVSTSETKISILIKKKFTVLAIKNLYKIFNKQFFVKRNG
>FRAN-2a_|_Orp
MAIIVQKYGGSSLATIEKIRGVARRVVDTAAAGKQVVVVVSARGRTTDELLGEARALGGH
WRSRESDQLVSTGEVVSAATTALALRELGQPAVSMTGGQAGIQVSGEFGSAAVHSVTPDR
LRTSLEEGKVVVVAGFQGVDASGDVRTLGRGGSDTTAVALAAALGATCEIYTDVDGVYTA
DPRLVPRARLLPTVPAPLMHEMAHTGAGILHPRAVDLAATRRIPVQVRNSLGTNPGTVVE
VVPGNPLESDGVVAAVTQDEDTTLVMMRGRGEPLDSWAALARMASAKVAPADLFALADST
HGSTLGFTSSPARQIDLAHIARQAGGTVELRDDLGRLSLVGTRMNLCGAVIETLAEILST
HGIRSPWIAISERRISILVPRGGMRRLALTIHDALVLGRGLEAHSSDR
>Sgri_Ab_|_Orp
MTTQGSRPTGDVVVQKYGGSSLATVSQVRQVADRVGALARSGRRVVVVVSAQGDTTDELV
GRAEAVNPRPAGHELDQLLATGETASAALMAMALQRGGLAATALSGARSGVLATGPHGAG
VIVAVDTDQLRTLLDAGRTVVLAGFQGVTAEGDIITLGRGGSDTTAVAVAAELRSGHCEI
YSDVPGVFTADPRVVPDARLMPDIDIDVMTEMAFAGARVMHARAVELAALYDVDILVGRS
TATRTGTRIHRRDGNDMLEDRTAVSAVVHDADIARITLRTHDTPDPSADVFRFLAKESIP
ADMTTVSSAPDGGFSLGFTVRRSHAADVGRSFSDLMAPRPHGVEVEDQVAKVSIVGQGLL
SRPEYASRMLASLVGSGISARSLTASQLRVSVTVPRSDAVRAVGLLHSEFGLGAEAGAVP
ASLTPRP
>Pubi_Aa_|_Orp
MKTVVLKFGGTSVGSIDRIKSVAKIISSYKKKKMGVIVVSSAMSGTTNELIKKTKELSNT
FDAAEYDVLLATGEQATCALIAGRLKHLGFKARSWMSWQLPIITEGPYSSSRISKINKGK
ILSFMKSGGIPIITGFQGINLENRLTTLGRGGTDASAIMLAKFFNTDACDIYTDVDGVYT
TDPRNHSKAKKIHKISYDEMLEMASLGAKVMQPTSVQDAKLNNINFSVKSSFQKKKGTLI
TGTKKTFSNQIITGITSTKNDSKVTIVGVKDRPGVAAAVFKPLSLNQINVDMVVQNISLN
GKETDLTFTIKSEDVKKTEKIIKQNKRISFRKLTYDNNVSKVSIIGVGMITTPGITYRMF
QALASKKINIMVISTSEIKISVLISNKQIKKAVAVLHKEFKLD
>Mmar_Aa_|_Orp
MTRVVAKFGGTSVGTIERIRHAAGLVADAARRGETMTVVVSAMAGETDRILGLAGAFGSG
LGDRETDVALAAGEQVSSALMALALREAGLEAQSFLGWQLPVITDGPPGASRIAGMDVAV
LEAAIDAGIIPVVAGFQGITETGEVRTLGRGGTDLSAAALAAALQARCDIYTDVDGVYTT
DPRVEPDARRLDTISHDEMLELAAQGAKVLQTRSVEFAKARGVPMRVLSSFLEAGASRGT
DVVSEQAIAERRLVSGVAYARDQARIALHGASNRSDMAARCFASLAEAEVGVDMIVQAHA
RQPGTVTLEFSIAHRDLDRAQAVLEDAMTGVRISAETGLAKVSVVGAGLRQRADVARSLF
AVLGDQDIAVKVLATSEIKISALIENDAVERAVRALHAAYGLDQV
>Twhi_Aa_|_Orp
MSLIVQKYGGSSLASANNLKRVAERVSRAYYGNNRLVVVVSAMGSTTDRLLTLAHEVSVE
PERRELDVLLSTGECVTASLLAMAINSIGLPARSFTAAQAGIVTDEHHCNARIITITPTL
IEDALNAGEIAVVAGFQGVNRKGQVTTLGRGGSDTTAVALAAALKADRCEIYSDVEGVFT
ADPRIVPKARLLESIPIDHMLELSTAGARILSLRSVVFAKRHNVSVKVGSTFSDTSGTIL
CNEGEAMEEPVITGIATDTSQARITIVGLPDIPGSAAEVFSALSVAEVAVDNIVQNFSSS
NTGFIDLSFTSPKAQGPAVTSALRENQTRIGYKDLQYDDEVGKITVVGSGIQHSADISAQ
LFRLLSDAKVNVEMISTSEMRISFVVRANVVAEVARLIHTSFGLDADLRAVVHSEGRV
>Tthe_Aa_|_Orp
MLTFSFKPPGGAGKEGSVALVVQKYGGTSVGDLERIHKVAQRIAHYREKGHRLAVVVSAM
GHTTDELIALAKRVNPRPPFRELDLLTTTGEQVSVALLSMQLWAMGIPAKGFVQHQIGIT
TDGRYGDARILEVNPARIREALEQGFVAVIAGFMGTTPEGEITTLGRGGSDTTAVAIAAA
LGAKECEIYTDTEGVYTTDPHLIPEARKLSVIGYDQMLEMAALGARVLHPRAVYYAKRYG
VVLHVRSSFSYNPGTLVKEVAMEMDKAVTGVALDLDHAQIGLIGIPDQPGIAAKVFQALA
ERGIAVDMIIQGVPGHDPSRQQMAFTVKKDFAQEALEALEPVLAEIGGEAILRPDIAKVS
IVGVGLASTPEVPAKMFQAVASTGANIEMIATSEVRISVIIPAEYAEAALRAVHQAFELD
KA
>Rxyl_Ab_|_Orp
MERRHRQRERPLGIVVQKYGGSSVATAEHIKAVAGKIQRARKAGLDLVVVASAMGKTTDR
LLRLAGEVSSDPSPREIDQLLATGEEQSVALLAMALHDRGVPAVSLTGPQAGMRATGRYG
SGVISEIRPGRIRRLLGEGRVVIVAGFQGMNALGDVMTLGRGGSDTTAVALAAALGADRC
EIYTDVDGVYTADPRIVPGARRIPVISYAEMSEMAWRGAKVMHPRAVELGALYGVEIHVL
SSFDEESPGTIITGGEKVEHLETRETVAGIVHDTDVARITLNGVRTGPGTLSKVFTPLAE
RGISVDVIVESGIKEGVADIAFTVSRADFAEARSAAGEVARALGGSVEGEEGLAKVSVVG
TGMLNRPGYAARMFSALGSEGIPIRMVSTSEIQVTCVIPAERVQEAVRRLHRDFELEERE
DV
>Rbal_Aa_|_Orp
MSLIVQKFGGTSVADTEKIRAAARKAIRAQKAGHRVVMVVSAMGKNTDTLLDLASQISDE
PPAREMDMLLSTGEQVSVALVAMAIHSMGSKAVSLTGGQIGLKTDNSFSKARIQSIDTGR
IERLLDAGNIVVAAGFQGIDDDLNITTLGRGGSDTTAVALAAVLGADACEINTDVDGVYT
TDPRLLAEARRVDVISYDEMLELASLGAGVMHSRSIEFAKKFEVPIHVRSSFSDQDGTMI
VAQPESETAPVSGAALTRDEARVTVLGVPDVPGMSQKIFSAIAAQKVAVDMVVQNVGTSG
KADVSFTVAGGELKKTLAALEGILDSLGADGVTHDDQVSKVSVVGLGMAHQKAVAASMFR
ALAEANVNIHMITTSEIKISCLVPRDQANEALRAVHEAFSLDQRPSDAKTWNEIKASNAK
EADVADVVARLQNDALEALTLTDISIVPAQARVTLDGVPDQVGVAADMFEQIGEAGIFVD
MIVQGYDGEDGSTSVSFTVEQADLDAAQKVAREICGKHSMRDVRGASGITKLSVSGIGLR
SHTQVGTVLFEQLASAGINVEMIATSELQVNVVIQSDQAGDAATRLKQAFAEALH
>Sthe-17_Ab_|_Orp
MGLVVQKFGGSSVATAEKYRRVARRIAWKKRQGNDVVVVVSAPGDMTDDLIERARSITDR
PSAREMDVLLATGEQISIALLTMALHELGVDAVSLTGPQAGFQTDDHHRAARIVNIDTAR
IRRELAAGRVVIVAGFQGMDDHGDITTLGRGGSDASAIALAAYLSADQCQIFTDVDGVYS
ADPRIVPTARRLDEISYDEVLELAAAGAQVMQLRSVELAKQYGVEFEVLSSLAPLPDEGG
EERGTKVVAKLSPNNHRIVSGVAVDSKVAHITLLGLPDRPGVAYRAFKALGDARINLDMI
VQSAGTGCGNGPTADISFTCARDDLETALEVCNRLLPEFPGARVVYDTDVAKVSIVGSGV
ASNYGVAARMFEALAEKDINIELITGSEIKISCLVRASRAMEAVRAVHDKFELGDVAPIV
>Swol_Aa_|_Orp
MSLIVAKFGGSSVASIDKIKHIAGRIKGMRDKGDDIVVVVSAMGDTTDELIELASLTGHD
LCKREMDMLLATGEQQSAALLALTLNNFACSSISLTGWQAGIKSDDSHSKARITGIETGR
IKNELKQGNVVIIAGFQGLSPQGDITTLGRGGSDTTAVALAACLDALRCMIFTDVEGVFT
ADPRIVKEAKKLPQISYEEMLEMASLGAGVLQPRAAEFAMLYNVDVEVLSSFSHNPGTII
TEVANMENHRAVSGIAHDLNCARFALFDVPDQPGIAKTLFKTLAAENINVDIIIQSAMRD
GRNDIAFTIEEKELSRAIPVVEGLVKKICASGMTYGNDVAKVSIVGAGMQSNIGVAAAMF
EALADEGINIHMISTSEIRVSCVIDECHIKAAIKALHRKFELDKIE
>Chyd_Aa_|_Orp
MLVVQKYGGSSVANPERIKNVARRVAEYYRAGHRVAVVVSAMGDTTDELLDLMGEISPNP
PAREIDMLLSTGEQVSVALLAMALHELGVPARSFTGLQAGIYTDEVHTKARITEIKPERV
IACLNSGKVAVVAGFQGVNREGDITTLGRGGSDTTAVALAAALKADICEIYTDVDGVYTA
DPRIVPDARKIKEISYEEMLELASLGAVVLQPRSVDFARNYKVEVHVRSSFNYNEGTVLK
EERDLEKKGVVTGVAHDKNVVKIGVFGVPDQPGVAYRLFSELAAHNINVDMIIQSAGKEE
GQNDISFTIGKNDLAKTVEILEDVVKKLSARGYTYDEKVAKVSIVGAGMVTYPGVAAKMF
EALYEENINIQMISTSEIKVSCIIAEDAVERAVNAIHKKFELGNGV
>Mthe-3_Aa_|_Orp
MALIVQKYGGTSVNGPERVKNVARRVVNTRRAGNDVVVIVSAPGDMTDDLIAMAHEISPN
PPAREMDMLLATGEQTSIALLAMAIHELGEPVISLTGPQVGILTDNVHSKARIMEVSCER
LRRELEQGKIVIVAGFQGKTCEGEITTLGRGGSDTTAVAVAAALKADVCQIYTDVDGVYT
ADPRVVPEARKLPVISYDEMLELASLGAQVLQPRSVEFGKLNHVVLEVRSSFNDHEGTLV
KEVTEMERKMVVSGVAGDRNVARIALHDVPDRPGIARTLFVALARESINVDMIVQSAMRD
GINDIAFTVGRDDLQKAVEVTERVRQEIGASKVTSNDRVAKVSIVGAGMITNPGVAADMF
ACLAEEGINIHMISTSEIKVSCIIDEEHLTRAMQALHRHFKLDRE
>Aaeo_Aa_|_Orp
MKILVQKFGGTSVGTLERIELCAKRVIKALEKGYKPVVVSSAMAGETDSLIELAKKVHPR
PPEREMDTLLAVGEQKAIALFAMTLNKLGYPAVSLCGWQVPIITDNVHTKARIRKIGISR
LLSLIEEGYIPVVAGFQGVTEDWEITTLGRGGSDTTAVALAAALKADCEINTDVPGVFTA
DPRIVPNAKKIKKISYEEMLELASLGAKVMQIRSVEFAAKYNVRIHVRSTFSEEEGTWIV
PEDEVMEKVAVRGITVDTKETRFTVVRVPDKPGIAAEIFKALGDAHIVVDMIVQNVSHEG
YTDMSFTVNKTDADKAEEIVKKIAQKIGAKEVVRDDKVAKISIVGIGMKSAYGVAGRMFD
ILARNGINIKAISTSEIKISCLIDEKYAELAVRALHEEFIEEMEEFETINGKNKE
>Sfum_Aa_|_Orp
MALVVQKYGGTSVANPERIKAVAEKVVGRRRKGDDLVVVLSARAGETDRLIALAHEVSLS
PDAREMDVLLATGEQTTVALFSMAVRNLGVEAISMTGYQAGINTDRSYGQARISGIETRP
IMEKLHEGRIVVVAGFQGYDDEGNITTLGRGGSDTTAVALAAALGADVCEIYTDVEGVFT
ADPNVYSKARKLDRISYEEMFEMASMGAKVLHLRSVEFGMKYHVPIMVLSSFTDAPGTLV
TKEDEEMEKVVVSGITYNKNEGRITITNVPDQPGMAARVFRPISDAGINVDLIVQSGAGI
PGRADISFTVPKTAHKKAMEIVEAVAREIDAGPVHGNASIAKISIIGLGMRNHSGVAAKM
FDSLARENINLKMISTSEIKISCIIEEKYAELAVRVLHDAFELETAPHGRIEVQEET
>Dnod_Aa_|_Orp
MALIVQKYGGTSMGSVERIETVADRIVRARQAGHDVVVTVSAMSGETNRLIALAQRFAAQ
PSPRELDVLMSSGEQVSMALLAIALEKRGCPALSLAGWQVGIFTDSQHTKARIQHIDDGA
IYRALSAGKVVIVAGFQGVDEAGDITTLGRGGSDTTAVALAAVLKADECQIYTDVDGVYT
TDPRIEPRARKLEQISFVEMLEMASLGSKVLQIRSVEFAGKYHVPVRVLSSFSDDETGTL
ISSVEGAIIEATHVTGIAFTRDEVMIQLMHLPDDMNTLYQILRPIGCADISLDMVAQTRN
DDGSINFSFIVPHQEKDRVIEFIVEQFSHIAALSVLQTEIAKISLVGLGLRSHTGIIGRI
LQALMQENIPVHCFATSETRVSLVTDLLYLERAVHCLHDAFQLEKADECRESF
>Phal_Aa_|_Orp
MALIVQKFGGTSVGSIERIEAVADLVVKTKQQGHQVVVVLSAMSGETNRLINLAKQIDTR
PSSRELDVLISTGEQVSVALLAMAIIKRGHSAVSLLADQVNILTDNMFGKARITDVAATR
LKHELEHNRIAIIAGFQGRDIEGNVTTLGRGGTDTSAVEIAGAIKADECQIYTDVNGVYT
TDPRVEPNARRMSQVTFAEMLELASLGAKVLHIRSVEAAGKHNVPLRVLSSFYPDAGTLI
SFEESDMPGNVVSGIAFNRDECLINVEGVLSGTQYLAKILKLFADNGIEIDMINQVNHNV
DKVDYAFTVHTNDYLHALDVLTEQQAQLTAQNIFGLTTVAKVSAVGMGMKSHSGVASLFF
DALAAENINVILVSTSEIKISVLIDEKYLELAVRALHKIFLTENE
>MAGN-2a_|_Orp
MKRVDVALIVLKFGGTSVGSIERIRNVARMAMAEQQAGNQVVVAVSAMSGETNRLVGLVE
DLTQFYNKREYDVVVSAGEQISIGLLATAIESMGQKAKSYLGWQVRFITDGSHSKARIKE
VEAFRIQADLDAGAIVIVAGFQGVDSHNNITTLGRGGSDTSAVALAAALKADRCDIYTDV
DGVYTTDPRIVTKARKMDRISYDEMLELASLGAKVLQTRSVELAKKYSVPVRVLSSLEPG
SGTMLTKEEDTMESVVVSGLAYDKNEAKITILGVPDKPGVAANLLGRLGDANINIDMIVQ
NVSPAGDATDMTFTVPKADFPQAMKVMEDAVKDVGARQLQGNSDIAKISAVGVGMRSHSG
IAQKMFKALADEGINILMISTSEIKISVVIEEKYTELAVRALHDAFELEKDPSDRINA
>Mxan_Ab_|_Orp
MALIVQKYGGTSVGDVARIKSVALRCLAAQEAGHDVVVVVSAMSGETNRLMKLVAQITDR
PDEREQDVVVATGEQVSIGLLAMAIHAQQGKATSFLGQQVRIVTDSTFAKARIKSIDAQP
IRAALARGHIVVVAGFQGVDESGSVTTLGRGGSDTTAVALAAALNADACEIYTDVDGVYT
SDPNMVPSARKLDRITYEEMLELASVGAKVLQIRSVEFAMKYKVPLWVKSSFTDDPGTLV
CEEDSSMEDVLVRGVAYDRNEAKITVCGVPDVAGAAAKIFGPLDEKHIVVDLIVQNPSKD
GRTDVTFTVGKADFLTAQEVVRKVAEEIGASGIETDGDIAKVSIVGVGMRNHSGVAARMF
RALSAEGINIQMISTSEIKVSCVVQAKYTELAVRALHTAFGLDQPMPPEGVSAVSEMAAL
MGEKV
>Cbur_Aa_|_Orp
MALIVQKFGGSSVANLEGIQNVARLISEARQEGHSVVAVVSAMYGETDRLIKLAQSISGS
NWREYDALISTGEQVSAALLSMALEARNCPAHSYTAAQIRLRTTNEHKKARIVDIDPEIL
HSDLKEGRVPVVAGFQGVSDAGDITTLGRGGSDLTAVALAAALEADECQIFTDVDGVYTS
DPKIVPQARRIPKITFDEMMEMSSLGAKVLQNRCLEFAGKFKVPVRVLSSLRKGPGTLIT
FEWDSAEQPLVSGIAFDRRQAKLTIQGIPERPGLASYILGPISKANIEVDMIVQNVPTID
ANIDFSFTLPRDDYKDAFSIMKQVANELAAGAVLGSDQVAKISLVGVGMRSHAGIASQMF
SALGQEGIHIHLITATEVKISAVIDEKYLELGARTLHSAFKLNQEIKFT
>Ping_Aa_|_Orp
MALLVQKYGGTSVGNIERIKSVAEKIKATKADGHDVVVVLSAMSGETNRMIALAKEITAN
PSPREMDVLLTTGEQTTIALLSMALHSLGLDAVSMTGDQIRLKTDSCHSKARILDVETKN
IKEHLKLGRVVVVAGFQGRSETNEITTLGRGGSDTSAVAIAAALKADECQIYTDVDGVYT
TDPRVEPNARRLDRITFEEMLEMASLGAKVLQIRSVEFAGKYNVPLRVLSSFKDGGGTLI
CYEENKMESPVISGIAFNRDEARLTLSGVPDKPTVAAQILSPIGDANIDVDMIVQNTLGN
GKTDFTFTVHRDDYEQTKELLEKVCVLLHADNVQGNKEIAKVSVVGVGMWNHPGVAKTMF
ETLGQEGINMHQIATSEIKISVLVDSKYLELAVRALHKAFKLADDPTEEK
>Csal_Aa_|_Orp
MALYVQKFGGTSVGSVERIKAVAEKVKRFRDEGHQVVVVVSAMSGETNRLIDLASQINDE
PTPREMDMLVSTGEQVTISLLAMALHKLDVEATSYTGAQVGIRTDSAHTKARIQRIETDD
IQADLDDGQVVVVAGFQGVDDEGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVCSKAQRLSAITVEEMLELASLGSKVLQIRAVEFAGKYNVPLRVLSSFEDGPGTLI
VAEEEETTMEEPLISGIAFTASEAKLTLLNTPDVPGVASKILGPIADANIEIDMIVQNVA
PAGDYTDFTFTVAKSDYKQTKSILQDQVIPALGGGELRGDDNIAKVSLVGVGMRSHAGVA
SKMFRVLADENINIRMVSTSEIKISVVIDEKQMELAVRALHTAFGLDKDSIQGE
>Tcru_Aa_|_Orp
MALIVQKYGGTSVGNVERIQNVADKVAKFIDEGHQVVVTLSAMSGETNRLTALAKEVQEQ
PSRREMDVLLTTGEQVTIALLSMALQQKGYDSISYTGWQVPIKTNDIHSKARIEEIDSDK
IRNQLDQGKVVVVAGFQGVTPEGDITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
TDPRVVPEAKRLDVVTFDEMLELASLGAKVLQIRSVEFASKYKVPLRVLSSMKEGGGTLL
ISEEDFEDLDMEKPLISGIAFSRDEAKLMILGVPDKPGVAYQILGPISDANIEIDMIIQN
QSVDGTTDFTFTVARGDLHAAQKILEKTAESLGAREVICDDTIVKISMVGVGMKSHSGIA
STMFKTLADHNINIQMIGTTEIKISVVIEESYLEEAVQALHAAFELDK
>Mcap_Aa_|_Orp
MALFVHKYGGTSVGSPERIKNVAKNVIRARSRGDDIIVVVSAMSGETNRLVALAHEMHER
PSTREMDVLLATGEQVTIALLSMALEAAGCPACSYTGGQVRILTDDAHTKARILDIDTDR
IRSDLAAGRVVVVAGFQGITEAGDITTLGRGGSDTTAVALAAALKADECLIYTDVDGVYT
TDPRIEPKARRLDRITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLSSFAAGPGTLI
TYEEASVEKPLISGIAFNRDEAKLTVKGVPDKPGVAYQILGPVAHANIEVDMIVQNVAED
ATTDFTFTVHRNDYRKALDILQATCTALGAREVTGDDKIVKVSLVGVGMRSHAGIAARMF
EALAREGINIRMISTSEIKISIVVDEKYLELAVRTLHEAFNLDREPDAV

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3