[Bio] / FigWebPages / ask_CG52.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG52.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Mmar_Ac_|_CG-52
2 :     MALPDQPQPDQADRPLKLCVLKFGSSVLFKPDDYARAAHEIYRHVRAGEKVVAVVSALDG
3 :     ETDALFGVGNDVGQGCSDALLARLVRCGELKSAALMGLALERSGIPSAVLDPHEMGLRAE
4 :     GEALDANLTGLDASRVLKRFASVDVIVAPGFFGEGADGPVTLGRGGTDLTAVEFAHWLGA
5 :     DRVRLIKDVDGVYTDDPAKVANAKRFDQLDYDEAARVSRGLVQDKAITRAKEQDVVIEVA
6 :     ALGRPYATRIAAVEQRAGDGLEMKPMRVAVLGHGAVGAGVCAHLLAHPGRFTLNPVLVRD
7 :     PAQHSAGAAAELSFTDDPARALG
8 :     >Oale_Ac_|_CG-52
9 :     MDPQLNVSSAPKGLCVLKFGGSVLTSEADYAAAGAEIYRHVRAGEKTIVIVSALKGETDQ
10 :     LLAQADANGGAPFPDITARLARLGEFRSAALMGLALSQLGLKAKVLDPHEIGLMAEGDPM
11 :     DANLSELDAGALAGALDEADAVVLPGFTACHAEHGAATLGRGGTDLTAVFFAVKAGANRV
12 :     RLIKDVDGVYTDDPAKDPHAQRYDALDYDQAMDASRGLIQPKAIEAAKAADLVVEVAAMG
13 :     AREATRIASGPAVIGRPRHRGPMKVALL

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3