[Bio] / FigWebPages / ask_CG49.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG49.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Nmar_Aa_|_CG-49
2 :     MTKLVVAKFGGSAIGPNGVSIPEIIQRITNLKQDSKVIAVFSAPLTLDNGKKRSLTDVML
3 :     EQGRNAENGVTPSLDIIKSTYEKILELVDDENKGKCENVIEQNLEKAKKALDEAFESKEF
4 :     VDEVRSRALAFSGEILMSHVMNYILRSNKIKAETVDFEDWPIITDNNIESTNFLTSESRT
5 :     KMDKTAELVEQNEVVTIGGFIGKTVDNVTTTYERGGSDRTAADLGILFHKSYETSIDFEK
6 :     DSAVVSADPKIVESGLREVHQLSYNEARLAGMFGMKILDPIAIKEIVENGVDMPITVTNM
7 :     KNPDKITTIKRILDEQKGHPIKIVTGKENCAIFRIETNSIQKLLTSLDKDKRYSEFVILS
8 :     PFTKDGIEFSRILFLDGDYVKRNEKYLLGFDSLATITYNRGVITLIGDEMWRVQQVASRT
9 :     SAKIGEAGLNILNMDAQEETSRIIIVVEDTKDNIRKAISAIHQEISEINFI
10 :     >Csym_Aa_|_CG-49
11 :     MERLVVTKFGSSAMGPDGSNMPVILDRIAELGKDAKVVCVFSAPLTQDGGAARSITDVML
12 :     DMGESAASGGGFDLSGVKSAYGRVAEHATGQGRAECADIIDKSLRRAGEALGAAEAAGSF
13 :     VHEARADALAFSGELLMSYLMDAILRSRGTRSAAVPFDSWPIITDDNPETTNFLHAESEA
14 :     RAGALLELVGSHDVVTMGGFIGRTPNGATTTYERGGSDRTAADLGILLHSRYDARIDLAK
15 :     DSAVVSADPRVVREGLSPVEELSYNEARQAGMFGMKILDPIAIKEIFENGVDIPIVITDL
16 :     ADPRNRTVIRSGPVASNGHPLKIVTGKRNCAMFRAEADSADRLLASLEGEKRYSEFVVLS
17 :     PFTKNETEFSRVLFLDGDFVRRNERYLRGFDPLAAVTYNRGVITMIGDEMWRVQQVASRA
18 :     SAGLGSAGLNILDMDAQEETSRIIIVIEDSGDNMERAIRAVHAERETIGFV

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3