[Bio] / FigWebPages / ask_CG40.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG40.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Nmen_Aa_|_CG-40
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLSTGEQVTIGLLAMALKDIGVEAKSYTGWQVALKTDTAHTKARIESIDDEK
MRADLAAGKVVIVAGFQGISSEGDISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERQDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFNLG
>Aave_Aa_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKDLAPS
RASSAYHRELDMLAATGEQASSALLAIALQAEGMESVSYAGWQVPIRTDSSYTKARIESI
DDQRVRADLAAGKVVIVTGFQGIDEHGHITTLGRGGSDTSAVAVAAAMKAAECLIYTDVD
GVYTTDPRVVAEARRLHTVSFEEMLEMASLGSKVLQIRSVEFAGKYKVPLRVLSSFTPWD
IDIEEEARSGTLITFEEDEKMEQAVVSGIAFNRDEAKISVLGVPDKPGIAYQILGAVADA
NIEVDVIIQNLSKDGKTDFSFTVNRNDFARTVDLLKEKVVPALGAQEVVGDAKICKVSIV
GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYVELAVRTLHKAFELDQP
SAA
>ACID-3a_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELTPS
RITSAYHRELDMLAATGEQASSALLAIALQAEGMESVSYAGWQVPVRTDSSYTKARIESI
DDKRVRADLDAGKVVIVTGFQGIDEGGNITTLGRGGSDTSAVAIAAAMKAHECLIYTDVD
GVYTTDPRVVPEARRLTTLSFEEMLEMASLGSKVLQIRSVEFAGKYKVPLRVLSSFTSWD
IDINEEAKSGTLITFEEDEQMEKAVVSGIAFTRDEAKISVIGVPDTPGIAYQILGAVADA
NIDVDVIIQNMGKEGKTDFSFTVNRNDYQRTIDLLKDKVLPQLGAEEIVGDAKIAKVSIV
GIGMRSHVGVASKMFRALSEEGINIKMISTSEIKTSVVIDEKYVELAVRTLHKAFELDQA
AA
>AZOA-1a_|_CG-40
MALIVQKYGGTSVGNPERIKNVARKVAKFQAQGHKVVVVVSAMSGETNRLIALTKEVATH
PDARELDVVVSTGEQVTIGLLCMALHDIGVKAKSYTGGQVRILTDSAHTKARILNIDEAP
IKKDLDEGNIVVVAGFQGVDEHGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRVVPEARKLDTITFEEMLELASLGSKVLQIRSVEFAGKYKVKLRVLSSFQEEGEGTL
ITVEEDQNMEQPVISGIAFTRDEAKLTVLGVPDKPGIAYQILGPVADANIDVDMIIQNIG
HDGTTDFSFTIPRGELDKTAKVLEGVKAHIGARAIEADKAMAKVSVVGVGMRSHPGVASK
MFRTLAEEGINIQMISTSEIKISVVIEDKYLELAVRVLHKAFGLESA
>Bamb_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDNAYTKARIHSIDDER
VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALDAAECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVSAERVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQAA
>Bbro_Aa_|_CG-40
MSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLLSLAREISPQ
PDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKARIKSIDDKR
VLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLIFTDVDGVYT
TDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSSLTDPLIPLE
EEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILGPVAAANIDV
DMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVAKVSIVGIGM
RSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAFGLDQVPGDQ
>Bcen_Da_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
VKDDLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVQGHVSAERVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKVFELDQAS
>Bmal_Ca_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQDIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>Bpar_Aa_|_CG-40
MSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLLSLAREISPQ
PDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKARIKSIDDKR
VLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLIFTDVDGVYT
TDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSSLTDPLIPLE
EEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILGPVAAANIDV
DMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVAKVSIVGIGM
RSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAFGLDQVPGDQ
>Bper_Aa_|_CG-40
MSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAGETNRLLSLAREISPQ
PDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRTDSSYTKARIKSIDDKR
VLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAAIKADECLIFTDVDGVYT
TDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKYHVPTRVLSSLTDPLIPLE
EEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPDKPGIAYSILGPVAAANIDV
DMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVSARELVTDEKVAKVSIVGIGM
RSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKYMELAVRSLHKAFGLDQVPGDQ
>Bpse_Ga_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQDIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>Btha_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIAMQEIGVEAVSYAGWQVPIKTDSAYTKARIHSIDDER
VRRDLDAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALEADECLIYTDVDGVYT
TDPRVVEEARRLDSVTFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPQIPLD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVLGDPKVSKVSVVGVGM
RSHVGVASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>BURK-1a_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKFQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVQGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQAS
>Bvie_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQ
PSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDER
VKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALD
EEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDV
DMIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAERVQGDPKVSKVSVVGVGM
RSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQAP
>Bxen_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVARRVAKWHKAGHKMVVVPSAMSGETNRLLGLAKEITAQ
PSPRELDMIAATGEQVSSGLLAIALQEAGVDAVSYAGWQVPVKTDSAFTKARISEIDGER
VLRDLDAGKVVVITGFQGIDPDGNITTLGRGGSDTSAVAVAAALKADECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIPLD
AEMKSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVDGKTAFTFTVGRGDYQRAMDILTGQVKGHVQAEQVLGDPKVSKVSVVGVGM
RSHVGIASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>Cnec_Ba_|_CG-40
MALIVHKYGGTSMGSTERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLAKEISPQ
PNPRELDMLASTGEQASVALLAIALHGEDIDAVSYTGWQVPVKTDSAYTKARIESIDDER
ILADLDAGRVVVITGFQGIDDDGNITTLGRGGSDTSAVAIAAAIEADECLIYTDVDGVYT
TDPRVVEDARRLDQITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
QEMHSGTLITFEEDSTMEAAVISGIAFARDEAKITVLGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVDGKTDFTFTVPRGEYQRALAILNDGVKSHIGAGSVSGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQA
>Cvio_Aa_|_CG-40
MALIVQKYGGTSVGTTERIKNVARRVAKWKAQGHDVVVVVSAMSGETNRLIALAKEIQDY
PDPRELDVVVSTGEQVTIGLLAMALKEIGVPAKSYCGWQVKVVTDQAHTKARIQSIDDEA
MRGDLKEGRVVIVAGFQGVDEEGSITTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRLKTVTFEEMIEMASLGSKVLQIRSVEFAGKYKVRLRVLSSFEDEGEGTL
ITFEEDESMEKAVVAGIAFDRNEARINVKGVPDKPGIAYQILGPIADANIEVDMIIQNVG
ENGTTDFSFTVPRGEFNRALTILREVQTHIGAAKIDADDKVAKISIVGVGMRSHCGIAST
MFRTLAEEGINIQMISTSEIKVSVLVDEKYLELAVRVLHKAFGLDQAA
>Daro_Aa_|_CG-40
MALIVQKYGGTSVGNPERIKNVAKRVAKFQAQGHQVVVVVSAMSGETNKLIALAKEVQAN
PDPRELDAIMSTGEQVTTGLLSMALMDIGCKAKSYTGGQVKVLTDSTHTKARILSIDEAN
MRRDLDAGYVIVVAGFQGVDANGNITTLGRGGSDTSGVALAAALKADECQIYTDVDGVYT
TDPRVVPEAKKLDTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFQDEGEGTL
ITVEEDKNMEQPIISGIAFNRDEAKLTMLGVPDTPGIAYQILGAIADANIDVDMIIQNVG
HDGTTDFSFTVNRGEFAKAKEILEGVKAKLGAREITGDNKICKVSAVGVGMRSHPGVASQ
MFKALADEGINIQMISTSEIKISVVLDEKYLELAVRVLHRTFGLDQ
>Hars_a_|_CG-40
MALIVHKYGGTSMGSTERIKNVARRVAKWHDAGYQIVVVPSAMSGETNRLIGLAKELMPH
PNPRELDMLASTGEQVSVALLAMALHSIGKEAVSYTGWQAGIKTDSAFTKARIQSIDDVK
VKKDLDAGRIVIITGFQGVDEDGNIATLGRGGSDTSAVAVAVALEAKECLIYTDVDGVYT
TDPRVVSEARRLNTVTFEEMLEMASLGSKVLQIRSVEFAGNYKMPTRVLSSLTDPMMSLE
EEAKSGTLISFEEDTKMEQAAITGIAFSRDEAKITVLGVPDRPGIAYQILGPIAAANIEV
DMIIQNQSVDGKTDFTFTVPRADYAKAVDVLNDSVKAHIGAASIQGDTKVSKVSVVGVGM
RSHVGIASQMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKTFDLEKSN
>Mfla_Aa_|_CG-40
MALIVQKYGGTSVANPERIGNVARRVARHKALGQQVVVVVSAMSGETNRLISLAKEVMPN
PDPRELDVLVSTGEQVTIALLSMALMELGVKAKSYTGGQVSIVTDSAHTKARILKIDEER
IRKDLDAGYVVVVAGFQGVDEQGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRIVPEARRLRSVTFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEEGEGTL
ITFEDDKDMEQPVISGIAFNRDEAKITVLGVPDRPGIAYQILGPVADANIDVDIIIQNVG
ADGTTDFTFTVHKNDLQKALNILREKVQPHTGAREIIGDDKTAKVSVVGVGMRSHVGIAS
QMFRTLAEEGINIQMISTSEIKISVVIDEKYMELAVRVLHKAFGLEEV
>Mpet_Aa_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELSPA
SHTPQLARELDMIAATGEQVSVGLLAIALQAEGLQAVSYTGWQVPVRTDSAYTKARIESI
DDVRVRADLAAGKVVVITGFQGIDGDGHITTLGRGGSDTSAVAVAAAMKAAECLIYTDVD
GVYTTDPRVVPEARRLSAISFEEMLEMASLGSKVLQIRSVEFAGKYRVPLRVLSSFTPWD
IPLDEEAKSGTLITFEEDENMEQAVVSGIAFNRDEAKITVMGVPDKPGIAFQILGPVAEA
NIDIDVIIQNVSHDGKTDFSFTVHRNDYARTMELLKGTVQPVINAAQVLGDPKICKVSIV
GIGMRSHVGVASRMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDAP
AAVPAA
>Neur_Aa_|_CG-40
MAFLVQKYGGTSVGSTERIKQVAHRVAEFRAQGHELVVVVSAMSGETNRLISLAKEIQPN
PDPRELDVILSTGEQVTIGLLAMALRELGIKAKSYTGPQVSITTDSAHTKARILKIDEDP
IRADLAAGYVIIVAGFQGVDETGDITTLGRGGSDTTAVALAAALKADECQIYTDVNGIYT
TDPRVVPEARKLDTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEGEGTLI
TFEEDNKMEQPIISGIAFNRDESKITVVGVPDHPGIAYQILGPVADANIDVDMIIQNVGH
DDTTDFSFTVHRNEYARTMDVLKQQVLPHIGAREVIGGDKIAKVSVIGVGMRSYAGIASK
MFRVLAEEGINIRMIATSEIKISVVVDEKYMELAVRVLHKAFDLDQVNNTSTKTC
>Neut_Aa_|_CG-40
MAFLVQKYGGTSVGSVERIKQVARRVAEFWAQGHKLVIVVSAMSGETNRLISLAKEIQTN
PNPRELDVVLATGEQVTIGLLAMALRELGIKAKSYTGSQVSITTDSAHTKARILKIDEDH
IRADLTAGNVIIVAGFQGRDEAGDITTLGRGGSDTTAVALAAALKADECQIYTDVNGIYT
TDPRVVPEARKLNTITFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFEEGEGTLI
TFEEDNKMEQPIISGIAFNRDESKITVVGVPDHPGIAYQILGPVADANIDVDMIIQNIGR
DGTTDFSFTVNRNEYTRTMDILKEQVLPHIGARDVIGGEKIAKISVIGVGMRSYAGIASK
MFRVLAEEGINIRMIATSEIKISVVVDEKYMELAVRVLHKAFDLDQANNIDVKSC
>Ngon_Aa_|_CG-40
MALIVHKYGGTSVGSPERIKNVAKRVAKARAEGHDIVVVVSAMSGETNRLVALAHEMQEH
PDPRELDVVLATGEQVTIGLLAMALKDIGVDAKSYTGWQVSLKTDTAHTKARIESIDDEK
MRADLAAGKVVIVAGFQGISSEGNISTLGRGGSDTSAVALAAALKADECQIYTDVDGVYT
TDPRVVPEARRMDTVTFEEMIELASLGSKVLQIRSVEFAGKYKVRLRVLSSLQDGGNGTL
ITFEEDDNMERAAVTGIAFDKNQARINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVG
SEGTTDFSFTVPRGDYKQTLEILSERKDSIGAASIDGDDTVCKVSAVGLGMRSHVGVAAK
IFRTLAEEGINIQMISTSEIKVSVLIDEKYMELATRVLHKAFDLG
>Nmul_Aa_|_CG-40
MTFIVQKYGGTSVGSTERIKNVARRVARFQARGDRVVVVVSAMSGETNRLIALAREFQAH
PDPRELDVMVSTGEQVSVALLSMALMDLGIKAKSYTGAQVRIHTDSAYTKARILKIDEDR
IRADLDAGYVVAVAGFQGVDEAGSITTLGRGGSDTTAVALAAALKADECQIYTDVDGVYT
TDPRIVPEARKLKTVTFEEMLEMASLGSKVLQIRAVEFAGKYKVKLRVLSSFEEEGEGTL
ITFEEEKNMERAIISGIAFNRDEAKITVLGVPDRPGIAYQILGPVAEANIDVDMIIQNVG
HDGMTDFSFTVNRNEFARTMDILKNQVQPHIGARGVIGGDRIAKVSVVGVGMRSHVGIAS
RMFRTLAEEGINIQMISTSEIKISVVVDEKYMELAVRVLHKVFELDQIS
>Pnap_Aa_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELAPA
QSDDTYSRELDALAATGEQASSALLAIALQAEGMPAVSYAGWQVTIKTNSAYTKARIESI
DDEKVRADLDAGKVVIITGFQGMDEGGNVTTLGRGGSDTSAVAIAAALKAHECLIYTDVD
GVYTTDPRVVPEARRLQTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVPLRVLSSFTDWN
IDINEEARSGTLISFEEDEKMEKAIVSGIAFNRDEAKISVLGVPDTPGIAYQILGAVADA
NIEVDVIIQNISKDGKTDFSFTVHRNDFAKTLDLLKSKVVPALGAQEVTGDARICKVSIV
GIGMRSHVGIASKMFRVLAEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDQP
VA
>POLA-1a_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELAPA
RPGDDYHRELDALAATGEQASSALLAIALQSEGMQAVSYAGWQVTIKTNNAYTKARIESI
DDERVRADLDAGKVVIITGFQGVDEGGNVTTLGRGGSDTSAVAIAAALKAHECLIYTDVD
GVYTTDPRVVPEARRLHTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVPLRVLSSFTDWD
IDINEEARSGTLISFEEDENMEQAIVSGIAFNRDEAKISVLGVPDTPGIAYQILGAVADA
NIEVDVIIQNISKDGKTDFSFTVHRNDYSKAVDLLKTQVLPKLGAQEVTGDAKICKVSIV
GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDQP
AA
>POLY-1a_|_CG-40
MALIVHKYGGTSMGSVERIANVAKRVAKWMRAGHQVVVVPSAMSGETNRLLGLAKEINPE
AKPRELDQIASTGEQVSSGLLALALMREGIDAVSYAGWQVTVHTDSAFTKARIKSIDDQK
ILNDLNAGRAVVVTGFQGVDPDGNITTLGRGGSDTSAVAMAAALKADECLIYTDVDGVYT
TDPRVCEDARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYKVKTRVLSSLTDPLMPLD
QEMKSGTLITFEEDSTMEAAVISGIAFARDEAKITVLGVPDRPGIAYQILGPIADANIDV
DIIIQNQSVEGKTDFTFTVPRADYQKALDILRNNVQAHIEAKEISGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIVMISTSEIKISVVIDEKYMELAVRALHKAFELDQK
>Rfer_Aa_|_CG-40
MALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLALAKELAPA
KATESYSRELDMLAATGEQASSALLAIALQAEGLESVSYAGWQVPIRTNSAYTKARIESI
EDTKVRADLDAGRVVIVTGFQGLDELGNITTLGRGGSDTSAVAVAAAMKADECLIYTDVD
GVYTTDPRVVPEARRLQTVSFEEMLEMASMGSKVLQIRSVEFAGKYKVKLRVLSSFTPWD
IDINEEAASGTLITFEEDEHMEQAIVSGIAFSRDEAKISVLGVPDKPGIAYQILGAVADA
NIDVDVIIQNISKDGKTDFSFTVNRGEYAKTVDLLKEKVLPKLGAQEVVGDTKICKVSIV
GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFELEQA
PA
>Rmet_Aa_|_CG-40
MALIVHKYGGTSMGSTERIKNVAKRVAKWHRAGHRVVVVPSAMSGETNRLLGLAKEISAQ
PDPRELDMLASTGEQASVALLAIALHGEGIDAVSYTGWQVPVKTDSSYTKARIESIDDER
ILGDLDAGKVVVVTGFQGIDGDGNITTLGRGGSDTSAVAIAAAIEADECLIYTDVDGVYT
TDPRVVEDARRLDQITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
QEMHSGTLITFEEESEMEAAVISGIAFARDEAKITVLGVPDKPGIAYQILGPIADANIDV
DMIIQNQSVDGKTDFTFTVPRGDYQRALTILNDNVKGHIGAESVSGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKVFELDQA
>Rsol_Aa_|_CG-40
MALIVHKYGGTSMGSVERIKNVAKRVAKWHRAGHQIVVVPSAMSGETNRLLGMAKEISAQ
PDPRELDMIASTGEQVSVGLLAIALHAEGIDAISYTGWQVPVQTDSAYTKARIQSIDDER
VRADLEAGRVVVITGFQGIDGEGHITTLGRGGSDTSAVAVAAALEAEECLIYTDVDGVYT
TDPRVVDDARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
VEMHSGTLITFEEDSNMEAAAISGIAFARDEAKITVIGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVDGKTDFTFTVPRGDYQRALGILNDSVKGHIGAANVSGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA
>Tden_Aa_|_CG-40
MALIVQKYGGTSVANVERIRAVAERVAKFKMLGHQVVVVLSAMSGETNRLIGLAKQIQAE
PDPRELDMMVSTGEQVTIALLAMALKDLGLKAKSYTGAQVRILTDDAFTKARILSIDEAK
MRRDLDSGHVVVVAGFQGVDEGGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
TDPRIVPEARRLKTVTFEEMLEMASLGSKVLQIRSVEFAGKYKVKLRVLSSFQDEGDGTL
ITFEENDNMEQAIISGIAFSRDEAKITVVGVPDHPGIAYQILGPVADANVDVDMIVQNVG
HANTTDFTFTVHRNDFAKAMSLVKATAATVGAREVTGDDKIAKVSIVGVGMRSHVGIAKK
MFETLSKENINLQMISTSEIKISVVVEDKYLELAVRALHQAFELDKATA
>Veis_Aa_|_CG-40
MALIVHKYGGTSMGSPERIRCVAKRVAKWARAGHQMVVVPSAMSGETNRLLALAKELAPA
RATDAYHRELDMLAATGEQASSALLAIALQAEGLGSVSYAGWQLPIRTDSSYTKARIESI
DDQRVRADLAHGKVVIVTGFQGIDDEGNITTLGRGGSDTSAVAVAAAMKAHECLIYTDVD
GVYTTDPRVVPQARRLQTVSFEEMLEMASLGSKVLQIRSVEFAGKYRVRLRVLSSFTPWD
MDIDEEARSGTLITFEEDEKMEQAVVSGIAFNRDEAKLSVLGVPDKPGIAYLILGAVADA
NIDVDMIIQNLSKDGKTDFSFTVHRNDYARAIDLIKEKVLPVLGAHEVVGDTNICKVSIV
GIGMRSHVGVASKMFRVLSEESINIQMISTSEIKTSVVIDEKYMELAVRSLHQAFGLDQE
AA

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3