[Bio] / FigWebPages / ask_CG37.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG37.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Rrub_Aa_|_CG-37
MARIVMKFGGTSVGDVDRIRNVARRVKAEVDAGNEVAVVVSAMSGETNRLVGFCDSMTNM
YDAREYDAVVATGEQVTIGLLAIALQDIGVEARSWMGWQIPIHTDEAHGKARILSIDTTV
LEQRLASGQVAVVAGFQGLGPNNRVTTLGRGGSDTSAVALAAALKADRCDIYTDVDGVYT
TDPRIVPKARKLDRITYEEMLEQASLGAKVLQTRSVEMAMKHRVRVRVLSSFSDAPGTLV
CDEDEIVEKELVSGIAYSRDEAKITLVKVSDRPGVAARIFGPLADANINVDMIVQNVSED
GHSTDLTFTLPRSDLARALKVLEGARDDINYRELTTSSAVVKVSVIGVGMRSHAGVAQTM
FRALSEKGINIHVISTSEIKVSVLIAEEYMELAVRALHSAYGLDAA
>Acry_Aa_|_CG-37
MARIVMKFGGTSVADLDRIRNVAARVKRVVDEGHEVAVVTSAMAGATNQLVAWCQELSPL
YDAREYDTVVATGEQVTIGLLAVALQTIGVDARSWTGWQIPIRTDGQHGKARIDAIDGAE
LIRRMQMGQVPVIAGFQGIGPDNRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVPKARKLPAIAYEEMLELASVGAKVLQTRSVELAMKERVRVQVLSSFTDAPGTLV
VDEDEIVEQEIVAGIAYSRDEAKVTVRRVPDRPGVAASVFGPLAEAGINVDMIVQNVSAD
GTTDMTFTLNKTELPRARLVLDEKRDEIGFAELATDPDVAKISVVGVGMRSHAGVAGTMF
RSLAARGINIQVISTSEIKVSVLIDAEYTELAVRALHTAYGLDVA
>Atum_Aa_|_CG-37
MARIVMKFGGTSVANLERIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVDWVQNAAKV
AGTNAASFYDAREYDAVVASGEQVTSGLLAITLQSMGINARSWQGWQIPIRTDNAHGAAR
ILEIDGSDIVHRMGEGQVAVVAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIY
TDVDGVYTTDPRIEPKARRMKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSF
EDPDAPGMGDLINPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRVADRPGVSAAIFG
PLAEAHINVDMIVQNISEDGSRTDMTFTVPSGDVAKALRVLDENKGQIGFDVAQNETGLA
KVSVIGIGMRSHAGVAASAFKALAEKNINIKAITTSEIKISILIDGAYAELAVRTLHSAY
GLDKA
>Babo_Aa_|_CG-37
MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFT
DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
LDK
>Bhen_Aa_|_CG-37
MARIVMKFGGTSVANIERIYNVAQHVKREVDAGNEVAVVVSAMAGKTNELVQWTCDASPI
HKDAYEYDVVVASGEQVTAGLLALTLQEMGVNARSWLGWQIPIHTDSAHGSARITDIDGS
FLIQRFQEGQVAVIAGFQGLAPDNRISTLGRGGSDTSAVAMAAAIQADRCDIYTDVDGVY
TTDPRVEPKARRLPKVAFEEMLEMASLGAKVLQVRSVELAMVHNVRTFVRSSFEDPNALG
MGDPMNSSGTLICDEDEIVEQQNVTGIAFAKDEAQISLRRLADRPGISAAIFGPLAEARI
NVDMIVQNISEDGSKTDMTFTVPSADVDKAVALLEKNRKEIGFDVIQSESGLAKISVIGV
GMRSHAGVAATAFRALAEKGINIQAITTSEIKISILIDSVYTELAVRTLHAVYGLDKG
>Bjap_Aa_|_CG-37
MSRLVMKFGGTSVANIERIRNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPM
HDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKTSDAHASARIEDIDGSE
IIKRFRDRKEVAVIAGFQGINPETNRITTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGV
YTTDPRIVPKAKRLGKIAFEDMLELASQGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
DPHANQPPGTLICSEEEIMESHVVTGIAFSKDEAQISVRQIEDKPGVAASIFGPLADANI
NVDMIVQGVSEDGKTTDLTFTVPAADFTRARDTITAAKGKIGYARLDTATDVAKISVIGS
GMRSHAGVAAQAFSALAGRNINIRAITTSEIKFSVLIDTAYTELAVRTLHTLYGLDQA
>Bmel_Aa_|_CG-37
MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFT
DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
LDK
>Bqui_Aa_|_CG-37
MARIVMKFGGTSVANIERIHNVARHIKREVDAGNEVAVVVSAMAGKTNELVQWTRDASPM
HKDADEYDVVVASGEQITAGLLALKLQAMGVNARSWLGWQIPIHTDNVHGSARITDINGS
FLIQRFQEGQVAVIAGFQGLAPDNRISTLGRGGSDTSAVAIAAAVQADRCDIYTDVDGVY
TTDPRIEPKARLLPKVAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFEDPDALG
MDDPINSSGTLICDEDEILEQQNVTGIAFAKDEAQISLRRLADRPGISAAIFGPLAEERI
NVDMIVQNISEDGSKTDMTFTVPSVDVEKAVTLLEKNRKEIGFDVLQFERNLAKVSVIGI
GMRSHAGVAATAFKALSEKGINIQAITTSEIKISILIDHAYTELAVRTLHALYGLDKG
>BRAD-1a_|_CG-37
MGRLVLKFGGTSVANIDRIRNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPM
HDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKTSDAHASARIVDIDGSE
LIQRFQERKEVAVIAGFQGINPATNRITTLGRGGSDTSAVAIAAAIKADRCDIYTDVDGV
YTTDPRVVPKAKRLDKIAFEDMLELASQGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
DPHAKQPPGTLICSEEQIMENHVVTGIAFSKDEAQISVRQIEDKPGIAASIFGPLADANI
NVDMIVQNVSEDGKTTDLTFTVPATDYNRARETIAAAKDKIGYQRLDTATDVAKVSVIGS
GMRSHAGVAAKGFAALAARNINIRAITTSEIKFSVLIDAVYTELAVRTLHTLYGLDQA
>Bsui_Aa_|_CG-37
MARIVMKFGGTSVADLERIYNVARHVKREVEAGNQVAVVVSAMSGKTNELVDWVQNMPKV
CGASSPFYDAREYDTIVASGEQVTSGLLAIALQSIGVDARSWQGWQIPIQTDNAHGAARI
QEIDGSQIIRRMEMGQVAVVAGFQGIGPDNRVATLGRGGSDTSAVAVAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLPKISFEEMLEMASLGAKVFQVRSVELAMVHKVRTFVRSSFT
DPDAPGMGDPINPPGTLICDEEEIVEQQVVTGIAFAKDEAQISLRRVADRPGVSAAIFGP
LAEEHINVDMIVQNVSEDGSKTDMTFTIPTGDIDKALKVLDKAKSEISFDNIQSETGLAK
ISVIGIGMRSHAGVAATAFKALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHAVYG
LDK
>Ccre_Aa_|_CG-37
MSRLVMKFGGTSVADLERIRRVARLVAAEVATGKQVAVVVSAMSGKTNELVAWTDGAGRA
AAGLPESDDEYDAVVASGEQVTAGLLAMTLRNMGHKARSFLGWQVPILTDEAHGRARIEE
IPPENLEECFANGEIAVIAGFQGVTPNRRITTLGRGGSDTSAVAIAAAVKGDCDIYTDVD
GVYTTDPRIESKARRLAKISYEEMLEMASLGAKVLQTRSVEMAMAHRVPVRVLSSFVEPG
EAPGQGTIVCDEEEIMEKRIVSGVAYSRDEAKITLLGLPDHPGVSSQIFGRLAEANVNVD
MIVQSRARSADTANMEFTVGKRDATRAVEIVQAAQKEIGFEAVAVNEDVAKVSVIGVGMR
SHAGVAQSMFQALAEKNINIQVISTSEIKISVLIDAAYTELAVRALHAVYGLDQL
>Elit_Aa_|_CG-37
MKFGGTSMAGTERIRRVANIVRKQAAGGDEVAVVVSAMAGETDRLVNFCREANALYDPAE
YDVVVASGEQVTSGLLALTLQSLGCKARSWLGWQLPVHTVEAHAKARIEDIENDALLESM
RGGTIAVIPGFQGLSDDGRITTLGRGGSDTSAVAVAAAIDADRCDIYTDVDGVYTTDPRI
VARARKQKAVTYEEMLELASVGAKVLQTRSVGLAMKEGVRVQVLSSFVDDDATPADDLPG
TMIVSEEEMDRILEEGDMERQLVTGIAHDKNEAKIILTRVPDKPGAVAHIFEPLAAASIN
VDMIIQNVGRDKGETDVTFTVPQADLARAQALLEDRREEIGFNRIITDSQIAKISVVGVG
MKSHAGVASTMFRALSDRGINIQAISTSEIKVSVMIDEDETELAVRVLHTAYGLDAEDAA
>Gbet_Aa_|_CG-37
MARIVMKFGGTSVGDLDRIRNVARLVKREVDAGNEVSVVVSAMSGVTNQLVGYCQSLSPL
HDAREYDTVVATGEQVTTGLLSIALQEAGVDARSWLGWQLPIRTDNAHGKARIESIEGGE
LINRMQAGQVPVVAGFQGIGPDHRITTLGRGGSDTSAVAVAAAVRADRCDIYTDVDGVYT
TDPRIVARARKLDRISYEEMLELASVGSKVLQTRSVELAMKERVRVRVLSSFADPEGENV
GTLVVDEDEIVEKEIVSGIAYSRDEAKITVRRVPDRPGVAAHVLGPLTEANVNVDMIVQN
VAEDGTTDMTFTVGTSDLPRAQAALSAAQVEIGFAEMSADPQVCKISVVGVGMRSHVGVA
TTMFRTLAEKGINIQVISTSEIKVSVLIAEEYAELAVRALHTAYGLDAA
>Goxy_Aa_|_CG-37
MKFGGTSVGNIERIRNVAKRVKAEHDRGRRVAVVVSAMAGVTNRMVGYCAELDPLADPKE
YDAVVAAGEQVTSGLVSIALQALGVKARSFQGWQIPLVTDDAHGKAAIESVDGTALLACL
DDDVVPVVAGFQGVGPDGRIATLGRGGSDTSAVAVAAAINADQCDIYTDVDGIYTTDPRI
VKRAKKLDRITYEEMLELASVGAKVLQTRSVGLAMREGVRVRVLSSFAETDDDSGSIVVD
EDEIMEKELVAGIANSHDEAKISVRNIPDRPGIAAAIFDPLAAANINVDMIVQSVGVDNM
TNMTFTVSKADEAAARAVLEKAREYVQYGELITSHNVVKISVVGIGMRSNAGLAARMFRT
LADRGINVQVISTSEIKISVLIDSEYTELAMRALHTAYGLDAKEGADA
>Hnep_Ab_|_CG-37
MARTVLKFGGTSVGDLDRIANVAEIVAARAAKGEKMAVIVSAMSGETNKLVALADGAAGK
DLPRSLYDDEYDVVVASGEQVTAGLLALALRRRGLKARSWLGWQLRLKTDNSHGRARIMG
FDDSSLPDSIDSGEIAVVAGFQGVTDDFRVTTLGRGGSDTSAVAVAAALGAQVCDIYTDV
DGVYTTDPRIVPKARRIDKISYEEMLEMASLGAKVLQTRSVELAMNHGVPVRVLSSFVKP
GEESPGTLVCSEEEIVEKQVVSGVAYSRDEAKVTLYGVPDKPGSSAKIFSALARAGVNVD
MIVQASSREASKANLVFTCTDRDSPFARETLEGLQAEVGYDRIEVIRDVSKISIIGVGMK
SHTGVAEKMFTALSEKSINIDVIATSEIKISVLIAAPYTELAVRALHTAFGLDAD
>JANN-1a_|_CG-37
MPLLVMKFGGTSVATLDRIRRAAKRVGREVANGYDVIVIVSAMSGETNKLVGFVEETGPF
YDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPLLTTDAHASARIEEIPTDN
LNAKFGEGMKVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAASFGAERCDIYTDVDGVY
TTDPRITTKARKLDKISFEEMLELASLGAKVLQTRSVELAMRYRVRLRVLSSFEEMSDNA
GTLVCAEEDIVEKNVVAGVAYSRDEAKMTLQSVEDRPGIAAAIFGPLAEAGVNVDMIVQN
ISDGGITDMTFSCPVGEVARAEKAMGDAKASGDIGFASLIADTDVAKVSIVGIGMRSHAG
VAAKMFQTLRDEGVNIKVITTSEIKVSVLIDRKYMELAVQALHDAFGLEKAA
>MESO-1a_|_CG-37
MARIVMKFGGTSVADLDRIHNVARHVKREVEAGHQVAVVVSAMSGKTNELVGWVQGMPKA
AGAKSPFYDAREYDTVVASGEQVTSGLLAIALQSIGIDARSWQGWQIPIRTDNAHGAARI
TDIDGSDIIERMERGQVAVVAGFQGLAPDNRVATLGRGGSDTSAVAVAAALRADRCDIYT
DVDGVYTTDPRIEPRARRLAKISFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDFDNPPGTLICDEEEIVEQQVVTGIAYAKDEAQISLRRVADRPGVSAGIFGP
LAEANINVDMIVQNVSEDGSKTDITFTVPTGDVEKALSVLEKVRGTVGFDAIQSEAGLVK
VSVIGIGMRSHAGVAATAFSALAEKGINIRAITTSEIKISILIDGPYAELAVRTLHSVYG
LDKH
>Mlot_Aa_|_CG-37
MARIVMKFGGTSVADIARIRNVARHVKREVDAGHEVAVVVSAMAGKTNELVGWTREASPM
HDAREYDAVVASGEQVTAGLLAITLQNMGVHARSWQGWQIPIKTDNAHGAARILDIDGAF
LIKRFGEGQVAVIAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYTDVDGVYT
TDPRIEPKARRLAKISFEEMLEMASLGAKVLQVRSVELAMVHRVRTFVRSSFDDPDAPGM
GDLLNPPGTLICDEEEIVEQQVVTGIAYAKDEAQISLRRVGDRPGVAAGIFGPLAEANIN
VDMIVQNISEDGKFTDMTFTVPSGDVDKALAVLDRLKAEVGYDVVQSEAGMSKVSVIGIG
MRSHAGVAATAFKALADKAINIRAITTSEIKISILIDGPYTELAVRTLHSVYGLDKQ
>Mmag_Aa_|_CG-37
MARIVMKFGGTSVADIERIKNVANRVKREFDAGNQVAVVVSAMSGATNQLVAWCNQVAPL
HDAREYDAVVATGEQVTTGLLAIALQELGVNARSWCGWQLPIRTDGVHGKARIMSIETDE
MIARMGKGEVAVVAGFQGLGPDNRIATLGRGGSDTSAVALAAALHADRCDIYTDVDGVYT
TDPRIVSVAKKLDKITYEEMLELASVGAKVLQTRSVEMAMKHRVRVQVLSSFEDKPGTLV
CDEDEIVEKELVSGIAYSRDEAKITLVRVADRPGVAASIFGPLAEAAVNVDMIVQNVSED
GKSTDLTFTVGNADLERAKKVLEDAKGNLGFEKLLADPNVVKVSVIGVGMRSHAGIAQKM
FQTLASEGINIQVISTSEIKISVLIEEKYTELALRALHTAYGLDAA
>Naro_Aa_|_CG-37
MARIVMKFGGTSMAGTERIRRVARIVQRQQAAGHEVAVVVSAMAGETDRLVNFCREANPL
YDPAEYDVVVASGEQVTSGLLAMHLQALGCKARSWLGWQLPIHTDDAHSKARIEGIDSEA
LLASMGAGEIAVIPGFQGLTADNRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVAKARKLKNVTYEEMLELASVGSKVLQTRSVSLAMKEGVRVQVLSSFIDDDAPAA
DTIPGTMIVSDEELEGLDMERQLITGIAADKNEAKVTLTRIADRPGAVAAIFGPLAAANI
NVDMIIQNIAKDKGETDVTFTVPISDLARTQALLEERKDTIGYYRMLANSKVAKISVVGV
GMRSHAGVASTMFRALADRGINIQAITTSEIKVSVLIDEDETELAVRVLHTAYGLDGE
>Nham_Aa_|_CG-37
MSRLVMKFGGTSVANLDRIRNVARHVKREVDAGHDVAVVVSAMAGKTNDLVAWCRDASPM
HDAREYDAVVASGEQITSGLLAIALQALGIQARSWQGWQIPIRTSDAHASARILGIDGSE
LVNRFTERKEVAVIAGFQGINPQTGRITTLGRGGSDTSAVAIAAAIHADRCDIYTDVDGV
YTTDPRVVPKARRLDRIAFEEMLELASQGAKVLQVRSVELGMTQNMPIFVRSSFDKPEDI
DPHGTPPGTLICGEEEIMESHVVTGIAFSKDEAQISLRQIEDKPGVAASIFVPLADANIN
VDMIVQSVSEDGKTTDLTFTVPAADYARARETITRAKDKIGYARLDSATDLAKISVIGSG
MRSHAGVAAQAFKALSEKSINIRAITTSEIKFSLLIDTAYTELAVRTLHTLYGLDHT
>Nwin_Aa_|_CG-37
MSRLVMKFGGTSVANLDRIRNVARHVKREVDAGHDVAVVVSAMAGKTNELVAWCRDASSM
HDAREYDAVVASGEQITSGLLAIALQALGIQARSWQGWQIPIRTSDAHASARILEIDGSE
LISRFTERKEVAVIAGFQGISPQTGRITTLGRGGSDTSAVAIAAAIRADRCDIYTDVDGV
YTTDPRVVSKARRLDRIAFEDMLELASQGAKVLQVRSVELGMTQNMPIFVRSSFDAPEEI
DPHGTPPGTLICGEEDIMESHVVTGIAFSKDEAQISVRQIEDKPGVAASIFVPLADANIN
VDMIVQNVSEDGKTTDLTFTVPASDHARAKETITRAKDMIGYARLDSATDVAKISVIGSG
MRSHAGVAAQAFKALSDKGINIRAITTSEIKFSLLIDTAYTELAVRTLHTLYGLDQT
>Pden_Aa_|_CG-37
MPLLVMKFGGTSVADLDRIKNAALKVQREVERGYDVIVIVSAMSGKTNELVGWVEATSPL
FDAREYDAVVASGENITAGLMALTLQELGVPARSWQGWQVPINTTSQHSAARFVSIPRDN
IDQKFAEGMRVAVVAGFQGLGSDNRITTLGRGGSDTTAVAFAAAFGAERCDIYTDVDGVY
TTDPRITSKARKLKKIAFEEMLELASLGAKVLQTRSVELAMRYKVRLRVLSSFEETDENS
GTLVCDEDEIMESKVVNGVAYSREEAKITLVTVEDRPGISAAIFAPLAEAGVNVDMIVQN
ISEKDYEDHPGSVTDMTFSCPVNQVARARKAMEDAKAAGHIAYDDLVVDTEVAKVSVVGI
GMRSHAGVAARMFKALADENINIKVISTSEIKISVLIDRKYMELAVQALHDAFELEKP
>Rden_Aa_|_CG-37
MPVLVMKFGGTSVATLDRIRRVAKRVGVEVAKGYDVIVIVSAMSGKTNELVGWVNEISPL
HDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPVRTTNAHSSARIEEIPTEN
IRAKFAEGMRVAVVAGFQGLSPEGRITTLGRGGSDTTAVAFAAAFEAERCDIYTDVDGVY
TTDPRVSAKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDTA
GTLVCDEEEIMESNVVAGVAFSRDEAKMTLLSVADRPGIAANIFTALSDAGVNVDMIVQN
IAEEGRTDMTWSCPTDHVARAQKAVENAKSEGVINYHEVIADLDVAKVSVVGIGMRSHTG
VAAKMFQVLSAEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELEKAA
>Retl_Aa_|_CG-37
MARIVMKFGGTSVADLDRIKNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVQGTPKV
IGANSPFYDAREYDAVVASGEQVTSGLLAIALQAMDINARSWQGWQIPIRTDNAHGAARI
LEIDGSDIIKRMGEGQVAVIAGFQGLGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYT
DVDGVYTTDPRIVPQARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDLLNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
LAESHINVDMIVQNISEDGSKTDMTFTVPSGDVEKAIKVLGDHKEKIGYDVVQNESGLVK
VSVIGIGMRSHAGVAATAFRALAEKGINIKAITTSEIKISILIDGPYAELAVRTLHSCYG
LDKN
>Rleg_Aa_|_CG-37
MARIVMKFGGTSVADLDRIKNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVQGTPKV
IGANSPFYDAREYDAVVASGEQVTSGLLAIALQAMDINARSWQGWQIPIRTDNAHGAARI
MEIDGSDIVKRMGEGQVAVISGFQGLGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIYT
DVDGVYTTDPRIVPKARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDLLNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
LAESHINVDMIVQNISEDGSKTDMTFTVPSGDVEKAIKVLGDHKEKIGYDVVQNESGLVK
VSVIGIGMRSHAGVAATAFRALAEKGINIKAITTSEIKISILIDGPYAELAVRTLHSCYG
LDKN
>Rpal_Aa_|_CG-37
MGRLVMKFGGTSVANIERIQNVARHVKREVDAGHEVAVVVSAMSGKTNELVAWCTEASPL
HDAREYDAVVASGEQVTSGLLAIALQSLGIQARSWQGWQIPILTSDAHASARIVGIDGSE
IIKRFSERKEVAVIAGFQGIHAETGRITTLGRGGSDTSAVAIAAALKADRCDIYTDVDGV
YTTDPRVVPKARRLDKVSFEEMLELASLGAKVLQVRSVELGMVHNMPIFVRSSFDKPEDI
DPHGTPPGTLISSEENSMENHVVTGIAFSKDEAQISVRRIEDKPGVAASIFGPLADANIN
VDMIVQNVSEDGKTTDLTFTVPASDFARAKQTITSAQDKIGYARFDSETDVAKVSVIGSG
MRSHAGVAAQAFAALAARNINIRAITTSEIKFSVLIDAAYTELAVRTLHTLYGLDQV
>Rsph_Aa_|_CG-37
MPLLVMKFGGTSVADLARIKNAAQKVKREVERGYDVIVIVSAMSGKTNELVGWVEQTSPL
FDAREYDAVVSSGENVTAGLMALTLQEMEVPARSWQGWQVPIRTTSQHSAARFLEIPREN
LDAKFAEGFKVAVVAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFAAERCDIYTDVDGVY
TTDPRIASKARKLEKIAYEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEDTDETS
GTLVCDEEDIMESKVVSGVAYSRDEAKMTLVTVEDRPGVAAAIFGPLAEAGVNVDMIVQN
ISEKDYGSHPGSVTDMTFSCPINQVARARKALEDAKAEGTIVYDDLVVDTEVAKVSVVGI
GMRSHAGVAATMFKALAADGVNIKVIATSEIKISVLIDRKYMELAVQALHDAFALETAN
>Sala_Aa_|_CG-37
MARIVMKFGGTSMAGTERIRTVARLVAREVADGNEVAVVVSAMAGETDRLVGFCREANPR
YDPAEYDVVVASGEQVTSGLLALTLQAMGVPARSWLGWQLPIRTEEAHARARIADIDTGA
LGAAMAKGEVAVIPGFQGMMDDGRISTLGRGGSDTSAVAVAAAIKADRCDIYTDVDGVYT
TDPRIVARARKLDYVTYEEMLELASVGAKVLQTRSVGLAMKMGVRVQVLSSFVEGDEAPK
KGTMIVSDEEIEEHQMERQLITGIAHDKNEAKIIVTRVPDRPGAVANIFGPLAAAGINVD
MIIQNVGREKGETDVTFTVPGADLLRSIDLLESAKDKIGFNRVISDDKVAKVSVVGVGMK
SHAGVASTMFRALADRGINIQAISTSEIKVSVLIDEDETELAVRVLHTAYGLDAE
>SILI-1a_|_CG-37
MPLLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYDVIVIVSAMSGKTNELVGWVGETSPL
YDAREYDAVVSSGENVTAGLMALTLQEMDVPARSWQGWQVPLKTNSAHSQARIEEIGTEN
INQKFGEGMKVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAAAFGAERCDIYTDVDGVY
TTDPRICEKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDEA
GTLVCDEEEIMESNVVNGVAYSRDEAKLTCLSVADRPGIAATIFGCLSDAGVNVDMIVQN
ISEDGRTDMTFSCPTDQVQRAEMALNAYKEKGELNFAELVADTGVAKISVVGIGMRSQSG
VAAKMFKVLSDEGINIKVITTSEIKISVLVDRKYMELAVQALHDAFELDKAS
>Smel_Aa_|_CG-37
MARIVMKFGGTSVADLNRIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVGWVENMPKV
AGSNAPFYDAREYDAVVASGEQVTSGLLAIALQSMGINARSWQGWQLPIKTDNAHGAARI
LEIDGADVIRRMGEGQVAVVAGFQGLGPDNRLATLGRGGSDTSAVAIAAAVKADRCDIYT
DVDGVYTTDPRIEPKARRLKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSFE
DPDAPGMGDLMNPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRLADRPGVSAAIFGP
LAEAHINVDMIVQNISEDGSKTDMTFTVPSGDVDKALRVLGDNKEKIGYDVIQSESGLVK
VSVIGIGMRSHAGVAASAFRALADKGINIKAITTSEIKISILIDGPYAELAVRTLHSVYG
LDKS
>Spom_Aa_|_CG-37
MPTLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYDVIVIVSAMAGKTNELVGWVNETSPL
FDAREYDAVVSSGENITAGLMALTLQEMDIPARSWQGWQVPLMTNSAHSQARIEEIPPHN
INQKFAEGMKVAVIAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFEADRCDIYTDVDGVY
TTDPRICTKARKLEKISFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDTA
GTLVVDEEEIMESNVVSGVAYSRDEAKMTVVSVQDRPGVAATIFNALSEGGVNVDMIVQN
VSEEGITDMTFSCPTDQVARAEKAMNAVKDAGELEFEDLLVDYDVCKVSVVGIGMRSQSG
VAAKMFKILSDEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELDKAA
>Swit_Aa_|_CG-37
MARIVMKFGGTSMAGIERIRNVANRVKHEVELGNEVAVVVSAMSGETDRLVNFCREASPL
YDPREYDVVVASGEQVTSGLLAIVLQSLGVKARSWLGWQLPIRTSDAHASARIETINSEA
IGKAMAAGEVAVIPGFQGMTGDDRVTTLGRGGSDTSAVAVAAAMKADRCDIYTDVDGVYT
TDPRIVPKARKLAKVTYEEMLELASVGAKVLQTRSVGLAMKEKVRLQVLSSFDQPTDNPT
PGTMIVGEEEIEGTTMERQLITGIAYDKNETKVTLTAVPDRPGAVASIFAPLADANINVD
MIVQNVAHDTGSTDVTFTVPTAELARSLDVLERERGTIGYEKLIHDTNVAKISVVGVGMR
SHAGVASKMFDALAARGINVLAITTSEIKVSVLINEDYTELAVRVLHTAYGLDAEDAA
>Zmob_Aa_|_CG-37
MARIVMKFGGTSVAGLERIRNVARRVQKEVEDGNEVAVVVSAMSGETDRLVGFCREAAPL
YDPAEYDAVVSSGEQVTSGLLAIVLKSMGVKARSWFGWQIPIHTTDAYANSRIESIDTER
LIKAMSSKEVAVVAGFQGVSDEGRVTTLGRGGSDTSAVALAAALDADRCDIYTDVDGVYT
TDPRIVSRARRLDRVTYEEMLELASVGAKVLQTRSVGLAMKAKTRLRVLSSFGDPDLSPE
GGTLIVSEDEIKENTMERQIITGIAYDKSEAKVTLTGVPDKPGAVAQIFSLLADANIHVD
MIVQIAYEGHITDVTFTVPKAQLSQVLDILEKGKEKIGFQKALKNDNVCKVSIVGVGMRS
HPGVAATMFDALAKRGINILAITTSEIKVSVLIDDAYTELAVRVLHTAYGLDADNKPVEE
AIA

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3