[Bio] / FigWebPages / ask_CG33.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG33.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Bhal-1_Aa_|_CG-33
2 :     MSIIVQKYGGTSVGSVQRIEHVANRIIATAASGKKVVVVVSAMGKTTDELVGLASEITDE
3 :     PRKREMDMLLATGEQVTIALLAMALHKRGQEATSLTGWQAGMITESHHGNARILEVERAR
4 :     MDELLDKVHVVIVAGFQGIDQQGEIMTLGRGGSDTSAVAIAAALKAERCEIYTDVTGVFT
5 :     TDPRVVKQARKLQTISYDEMLEMANLGASVLHPRAVEFAKNYEIPLLVASSMVDEPGTMI
6 :     EEEGTMEQNLLVRGIAFENDVTKVTVHGLPNEIHTLPTLFAHLSAAGINVDIIIQNQTDS
7 :     GMAISFSITQSSLKETLARLEELKGELSFQGIDYEEELAKVSIVGSGMVSNPGVAAKMFE
8 :     ILAANDIAIKMVSTSEIKVSAVIDEELMVLAVEMLHEQFKLHEEEPAVAVKV
9 :     >Bant_Aa_|_CG-33
10 :     METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVSVVSAMGKSTDELVALANAITEN
11 :     PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITEINTDR
12 :     IQSYLTKGTIVIVAGFQGVSEDLEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
13 :     TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSMEQENGTIV
14 :     KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
15 :     VHLSFSIHSNDLRETLAVLEQNQEALHYESVEYENHLAKVSIVGSGMVSNPGVAANMFTT
16 :     LKEEDIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIEPLVQMS
17 :     >Bcer_Aa_|_CG-33
18 :     METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVSVVSAMGKSTDELVALANAITEN
19 :     PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITEINTDR
20 :     IQSYLTKGTIVIVAGFQGVSEDFEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
21 :     TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSMEQENGTIV
22 :     KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
23 :     VHLSFSIHSNDLRETLEVLEQNQEALHYEAVEYENHLAKVSIVGSGMVSNPGVAANMFTT
24 :     LKEENIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIVPLVQMS
25 :     >Blic_Ab_|_CG-33
26 :     MGLIVQKFGGTSVGSVEKILNVAYRVIEEKQRGHDVVVVVSAMGKSTDSLVALAKEITEQ
27 :     PSSREMDMLLTTGEQVTISLLTMALQNKGYDAVSYTGWQAGIETENIHGNARITNIDTAK
28 :     LKERLNEGKIAVVAGFQGVTAEGEITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFT
29 :     TDPRYVKTARKLAGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTEKEAGTLI
30 :     EEESSMEQNLIVRGIAFEDQITRVTVCGLASGLTTLSTIFTTLAKQNINVDIIIQSVTGT
31 :     SKTSISFSVKTEDLKRTVEVLEEYKDALDYEQIETENRLAKVSIVGSGMISNPGVAAEMF
32 :     AVLAEKNIQVKMVSTSEIKVSTVVNEGDMVKAVEALHDAFELSKQTAVI
33 :     >Bsub_Aa_|_CG-33
34 :     MGLIVQKFGGTSVGSVEKIQNAANRAIAEKQKGHQVVVVVSAMGKSTDELVSLAKAISDQ
35 :     PSKREMDMLLATGEQVTISLLSMALQEKGYDAVSYTGWQAGIRTEAIHGNARITDIDTSV
36 :     LADQLEKGKIVIVAGFQGMTEDCEITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFT
37 :     TDPRYVKSARKLEGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTETEAGTLI
38 :     EEESSMEQNLIVRGIAFEDQITRVTIYGLTSGLTTLSTIFTTLAKRNINVDIIIQTQAED
39 :     KTGISFSVKTEDADQTVAVLEEYKDALEFEKIETESKLAKVSIVGSGMVSNPGVAAEMFA
40 :     VLAQKNILIKMVSTSEIKVSTVVSENDMVKAVESLHDAFELSKHPSAV
41 :     >Bthu_Aa_|_CG-33
42 :     METIVQKFGGTSVGSVERIQHVANLIIEEYERGHSIVTIVSAMGKSTDELVALANAITEN
43 :     PSKREMDMLLSTGEQVTISLLTMALQAKGYNAISLTGWQAGITTESVHSSARITDIHTDR
44 :     IQSYLAEGTIVIVAGFQGVSENHEITTLGRGGSDTTAVALAAALNAKKCDIYTDVTGVYT
45 :     TDPRVVKDAYKLDEISYDEMLELANLGAGVLHPRAVEFAKNHNVILEVRSSTEQENGTIV
46 :     KGECNMEQQSIVKGIAFEDNITRITVKGLEQGSLSTVFSTLAAAHINVDIIIQSITNEGT
47 :     VHLSFSIHSNDLRETLKVLEQNQEALHYESVEYENHLAKVSIVGSGMVSNPGVAANMFTT
48 :     LKEEDIHIKMVSTSEIKVSVVIDRLHLVTGVEALHQSFMAKIEPLVQLI
49 :     >Linn_Ab_|_CG-33
50 :     MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGKSTDKLVAMAEEISEA
51 :     PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIETEAVHSNARIADIDSAR
52 :     IESALEAGQIVIVAGFQGITTDGEITTLGRGGSDTTAVAIASALKAEKCAICTDVVGVFT
53 :     TDPRYVKKAQKLEQLTYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHELEPGTMI
54 :     EEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
55 :     GHGNLSFTIKTSELLATLAVLEESKELLQIEKLESEQELAKVSIVGSGMVSNPGVAAKMF
56 :     EALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQFELDK
57 :     >Lmon_Ab_|_CG-33
58 :     MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGKSTDKLVAMAEEISEA
59 :     PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIETEAVHSNARIADIDSAR
60 :     IESALDAGQIVVVAGFQGFTTDGEITTLGRGGSDTTAVAIASALNAVKCAICTDVVGVFT
61 :     TDPRYVKKAQKLEQITYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHEQVPGTMI
62 :     EEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
63 :     GHGNLSFTIKTSALLATLAVLEESKELLQIEKLESEQDLAKVSIVGSGMVSNPGVAAQMF
64 :     EALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQFELDK
65 :     >Lwel_Ab_|_CG-33
66 :     MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNRVIIVVSAMGKSTDKLVAMAEEISET
67 :     PDKREMDMLLSTGEQITIALLAMTLKEKGHDAISLTGWQAGIETEAVHSNARIAEIDSSR
68 :     IESALDLGQIVVVAGFQGFTSDGEITTLGRGGSDTTAVAIASALNAEKCAICTDVVGVFT
69 :     TDPRYVKNAQKLEQITYDEMLELANLGAGVLHPRSVEYAKNFRIPLEVRASHEKEPGTMI
70 :     KEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFTKLAENNIDVDIIIQGITGL
71 :     GHGNLSFTIKTSALLATLAVLEESKELLQIEKLESEQELAKVSIVGSGMVSNPGVAAQMF
72 :     EALTENNIPIKMISTSEIKVSTVVSARNMVEAAQALHDQFELDK

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3