[Bio] / FigWebPages / ask_CG25.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG25.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Pacn_Aa_|_CG-25
MTRVVQKFGGSSVADAASIKRVARRIAATKQAGNDIVVVISAMGDTTDDLMDLALEVSPQ
PAPRELDMLLTTGERQSAALLAMALSDVGIPARSYTGSQAGVITTAAHGNARIIDITPGR
IEKSLEAGDLVIVAGFQGVSQTTKDVTTLGRGASDTTAVALASSLGADFCEIYSDVDGVF
TADPRIVKGARRIPEISYEEMLEMAACGAKILHLRCVEYARREDVPVHVRSSFSDKPGTW
VKDPTDITKGSDMEEAIISGVAHDRSEAKITIAGLPDAVGRAAQIFEIIAHADINIDMIV
QNASRVMNGRTDLSFTLPMNDGPTAVRALTAVKDELGYEQILYNDQIGKVSVVGVGMRTH
PGVTSTFFRALADCGINLQMISTSEIRISVVVDADQVDEAVRVAHTAFGLDAEGEAVVYA
GTGR
>Cmic_Aa_|_CG-25
MSLIVQKFGGSSVADAESIKRVAKRIVATRKAGNDVVVAVSAMGDSTDELLDLAHEVTPI
PAPRELDMLLTAGERISMALLAMAIKSMGYDARSFTGSQAGMITDAQHGAARIVDVTPGR
VRDALGEGAIAIVAGFQGFNRGTGDITTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
TADPRVVPLARKIDRITSEEMLELAASGAKVLYIRAVEYARRHGVLLHVRSSFTHNEGTI
VYNPTDGENVEEPVIVGVAADLSEAKVTVVGVPDVPGKAAQIFTIVAKTGANIDMIVQNV
SAAATSLTDISFTLPKSDAQRVLTVLAAEKDEVGFTGLQHDDQIGKLALVGAGMRTNAGV
SAQLFTALSDAGINIEMISTSEIRISVVTRADTIDEAVRVVHHAFGLDADDVAVVHAGTG
>Lxyl_Aa_|_CG-25
MALIVQKFGGSSVSDAESIKRVAKRIVETRKAGNEVVVAVSAMGDTTDELVDLAHEVTPI
PAPRELDMLLTAGERISMALLAMAIKSMGSDARSFTGSQAGMITDAVHGSARIVDVTPGR
IQDALSEGAIAIVAGFQGFSRESRDITTLGRGGSDTTAVALAVALGAEVCEIYTDVDGVF
TSDPRQVPLARKIDRITSEEMLELAAAGAKVLHIRAVEYARRHDVTLHVRSSFSNREGTY
VLNEAAAAAAAKKDGIVEEPIIAGVATDLSEAKITVVGVPDVPGKAAQIFKIVAKANANV
DMIVQNVSAAATSLTDISFTLPKSEGQRVLTALTAEKYEVGFQSLQYDDQIGKLALVGAG
MRTNTGVSAKLFEALFDAGINIEMISTSEIRISVVTCADTVAEAARVVHSAFRLDGDQQA
IVYAGTGR
>ARTH-1a_|_CG-25
MSMPTTEVKTENQPYVLPVATARTKQLIVQKFGGSSVSDADGIKRVAKRVVDAQRAGNEV
VVVVSAMGDTTDELLDLAAQVTDSAPAREMDMLLSSGERISMALVAMAINKLGASAQSFT
GSQAGMITDGIHGKARIIDVDPHRIRTALDKGHIAIVAGFQGMSRTTNEITTLGRGGSDT
TAVALAAALDADVCEIYTDVDGIYTADPRVVPSAQKIDRISSEEMLELAASGAKILHLRC
VEYARRFGVPLHVRSSFSQNEGTWVMPGADDKITTQEGVALEQPIISGVAHDRSEAKVTV
VGVPDIPGKAAAIFQVIADAHSNIDMIVQNVSTHGTGRTDISFTLPIVEGADALAALRAA
QPEIGFENIEYNEQIGKLSLIGAGMRSHPGVSATFFKALSDAGININMISTSEIRISVVT
HADLLDDAVRAIHKAFDLDSEDEATVYGGTGR
>Cjei_Aa_|_CG-25
MALIVQKYGGSSLESAERIRRVAERIVETKKQGNDVVVVCSAMGDTTDDLLELAEQVNPV
PPAREMDMLLTAGERISNALVAMAIASFGAEAQSFTGSQAGVLTTERHGNARIVDVTPGR
VREALDEGKICLVAGFQGVNRETRDVTTLGRGGSDATAVALAAALEADVCEIYSDVDGVY
TADPRIVPDAQKLDTISFEEMLEMAAVGAKVLMLRSVEYARAFDVPLRVRSSYSTDIGTL
VSGSMEDIPMEEAVLTGVAHDRSEAKIAVLGIPDSPGEAAKVFRAVADAEINIDMVVQNI
SKIDNNRTDITFTCPRTDATRAMQLLKGIKEQNDWQDLIFDDHVGKVSLVGAGMKSHPGV
TADFCEALRDAGVNIELISTSEIRISVLIRDTDVDKAVRAIHERFQLGGDKEATVYAGTG
>Cdip_Aa_|_CG-25
MALVVQKYGGSSLESAERIRRVAERIVATKKQGHDVVVVCSAMGDTTDELLDLAAQVNPV
PPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVITTERHGNARIVDVTPGR
VREALDEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVY
TADPRIVPNAQKLEKLCFEEMLELAASGSKILVLRSVEYARAFGVPLRVRSSYSNDPGTL
VAGSMEDIPVEEAVLTGVATDNSEAKITVLGIPDSPGSASAVFRALADAEINIDTVLQNI
SSLEDNRTDITFTCPRADGPHAMELLRNLQAKNDWQNVLYDDQIGKVSLVGAGMKSHPGV
TAEFCEALRDAGVNIELISTSEIRISVLIRESDVDVAARAIHEKFELGGETEAIVYAGTG
>Cglu_Aa_|_CG-25
MALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGDTTDELLELAAAVNPV
PPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLTTERHGNARIVDVTPGR
VREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVY
TADPRIVPNAQKLEKLSFEEMLELAAVGSKILVLRSVEYARAFNVPLRVRSSYSNDPGTL
IAGSMEDIPVEEAVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNV
SSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLYDDQVGKVSLVGAGMKSHPGV
TAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEAVVYAGTG
>Ceff_Aa_|_CG-25
MNERCARVALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGDTTDELLDL
AAAVNPVPPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLTTERHGNARI
VDVTPGRVREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAAALGADVCEIY
SDVDGVYTADPRIVPNAQKLERLSFEEMLELAAVGSKILVLRSVEYARAFNVPMRVRSSY
SNDPGTLIAGSMEDIPMEEAVLTGVATDKSEAKVTVLGIPDKPGEAAKVFRALADAEINI
DMVLQNVSSVEDGTTDITFTCPRSDGPRAMELLKKMQQQGDWTNVLYDDQVGKVSLVGAG
MKSHPGVTAEFMEALRDVNVNVELISTSEIRISVLIREDDLDKSAKALHEKFQLGGDEEA
TVYAGTGR
>Sery_Aa_|_CG-25
MALVVQKYGGSSLESADRIKRVAERIVETRKAGNDVVVVCSAMGDTTDELLDLAQQVNPA
PPERELDMLLTAGERISNALVAMAIEALGAEARSFSGSQAGVITTSAHQNARIIDVTPGR
VQEALKQGQVVLVAGFQGVAQDTKDITTLGRGGSDTTAVAVAAAMNADVCEIYTDVDGVY
TADPRIVSDAKHLDRITYEEMLEMAATGAKVLHLRAVEYARRYGVPLHVRSSYSPKSGTI
VSGSVEDLSVEQAMITGVAHDRSEAKVTVRGVPDNPGIAGRIFRVIADAEIDIDMVLQNV
SGTASGRTDITFTVARSNGALAVTELEKIKDELGFDQVVYDDHVGKVSLVGAGMRSHPGV
TATFCEALSHAGVNIEIINTSEIRISVLIRDTQLEDAVAALHAAFELGGDEEAVVYAGSG
>Mlep_Aa_|_CG-25
MALVVQKYGGSSVADADRIRRVAERIVQTKKQGNDIVVVVSAMGDTTDDLLDLAQQVCPE
PPARELDMLLTAGERISNALVAMAIESFGAQARSFTGSQAGVITTGTHGNAKIIDVTPTR
LQFALDEGRIVLVAGFQGVSQDTRDITTLGRGGSDTTAIAMAAALGADVCEIYTDVDGIF
SADPRVVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYADKPGTV
IVGSIKDVPMEDPILTGVAHDRSEAKVTIVGIPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDSGPIAVAKLGSLRDEIGFTQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVFALHEAFGLGGEDEVTVYAGTG
>Mbov_Aa_|_CG-25
MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
>Mtub_Aa_|_CG-25
MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
>Mavi_Ba_|_CG-25
MALVVQKYGGSSVANADRIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLMDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQAALDEGRIVLVAGFQGVSQDTRDVTTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
SADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRYNIPVHVRSSYSDKEGTV
VVGSIKDKPMEDPILTGVAHDRSEAKVTVVGIPDIPGYAARVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSREAGPTAVAKLDALKDEIGFTQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAQVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGAETATVYAGTG
>Mulc_Aa_|_CG-25
MALVVQKYGGSSVGNAERIRRVAERIVETKKQGNDVVVVVSAMGDTTDDLMDLALQVCPV
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIEVTPGR
LQAALDEGRIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALGADVCEIYTDVDGIF
SADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDKPGTL
VVGSIKDIAMEDPILTGVAHDRSEAKVTIVGIPDIPGYAAKVFRAVAEADVNIDMVLQNV
SKVEDGRTDITFTCSRDSGPTAVAKLDSLKDEVGFTQLLYDDHIGKLSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGEETATVYAGTG
>Msme_Aa_|_CG-25
MALVVQKYGGSSVADAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDLLDLARQVSPA
PPPREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVITTGTHGNAKIIDVTPGR
LRDALDEGQIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVAVAAALDADVCEIYTDVDGIF
TADPRIVPNARHLDTVSFEEMLEMAACGAKVLMLRCVEYARRYNVPIHVRSSYSDKPGTI
VKGSIEDIPMEDAILTGVAHDRSEAKVTVVGLPDVPGYAAKVFRAVAEADVNIDMVLQNI
SKIEDGKTDITFTCARDNGPRAVEKLSALKSEIGFSQVLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAEAGINIDLISTSEIRISVLIKDTELDKAVSALHEAFGLGGDDEAVVYAGTG
>MYCO-4a_|_CG-25
MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDDLLDLAKQVCPA
PPARELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVVTTGTHGNAKIIDVTPTR
LRSALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAVAAALNADVCEIYTDVDGVY
TADPRIVPNARKLDTVSFEEMLEMAACGAKVLMLRCVEYARRYDLPIHVRSSYSDKPGTI
VKGSIEDIAMEDAILTGVAHDRSESKVTVVGLPDVPGYAAKVFRAVADADVNIDMVLQNI
SKIEDGKTDITFTCARDNAPGAVEKLTSLQDEIGFTRVLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAEVGVNIDLISTSEIRISVLVKDTELDKAVAALHEAFGLGGDEEAVVYAGTG
>Mgil_Aa_|_CG-25
MRAALILYGISPRIAKGSPVALVVQKYGGSSVSDADRIRRVAERIVETKKAGNDVVVVVS
AMGDTTDELLDLAKQVSPAPPVREMDMLLTAGERISNALVAMAIESLGAQARSFTGSQAG
VVTTGTHGNAKIIDVTPTRLRSALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAV
AAALNADVCEIYTDVDGVFTADPRIVPNARKLETVSFEEMLEMAAAGAKVLMLRCVEYAR
RFNLPIHVRSSYTDRPGTLVTGSMEDIPMEDAILTGVAHDRGEAKVTVVGLPDVPGYAAQ
VFRACADADVNLDMVLQNISKVEDGKTDITFTCSRESGPGAVEKLTSLQNEIGFTRVLYD
DHIGKVSLIGAGMRSHPGVTATFCEALANAGINIDLISTSEIRISVLIKDTELDRAVAAL
HEAFGLGGDEEAVVYAGTGR
>Mvan_Aa_|_CG-25
MALVVQKYGGSSVSDAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDELLDLAKQVSPA
PPARELDMLLTAGERISNALVAMAIESLGAEARSFTGSQAGVVTTGTHGNAKIIDVTPTR
LRAALDEGQIVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAVAAALKADVCEIYTDVDGIF
TADPRIVPNARRLDTVSFEEMLEMAAAGAKVLMLRCVEYARRFDLPIHVRSSYSDNPGTI
VKGSIEDIPMEDAILTGVAHDRGEAKVTVVGLPDVPGYAAQVFRAVADADVNIDMVLQNI
SKVEDGKTDITFTCSRESGPGAVEKLTALQDEIGFTRVLYDDHIGKVSLIGAGMRSHPGV
TATFCEALADAGINIDLISTSEIRISVLIKDTELDRAVEALHDAFGLGGDEEAVVYAGTG
>Nfar_Aa_|_CG-25
MALVVQKYGGSSVASAERIRRVAERIVETKKQGHDVVVVCSAMGDTTDELLDLAEQVAPA
PPAREMDMLLTAGERISNALVAMAIHSLGAQARSFTGSQAGVITTGAHGNAKIIDVTPSR
LREALDEGTIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALEADVCEIYTDVDGVF
TADPRIVSDAQRLEQVSYEEMLEMAACGSKVLMLRCVEYARRYNVPVHVRSSYTDKPGTY
VYGSMEDIPLEKAILTGVAHDRSEAKVTVVGLPDEPGYAAKVFRAVADAEINIDMVLQNI
SKVETGKTDITFTLPKTEGARAVEMLTKRQGEIGFSQVLYDDHIGKVSLVGAGMKSHPGV
TATFCEALADAGINIDLISTSEIRISVLVKDTELDDAVQVLHRAFDLGGDEVAVVHAGTG
>RHOD-5a_|_CG-25
MALVVQKYGGSSVATAERIRRVAERIVETKKAGNDVVVVVSAMGDTTDELLDLAQQVCPA
PPAREMDMLLTSGERISNSLVAMAIHSLGAEARSFTGSQAGVITTGAHGNAKIIDVTPGR
VRDALDEGSIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVALAAALEADVCEIYTDVDGIF
TADPRIVPDAQRLETVSFEEMLELAACGAKVLMLRCVEYARRYNVPVHVRSSYTTKPGTI
VSGSMEDIPVEEAIITGVAHDRGESKITVVGLPDTPGYAAQVFRAVAEAEINIDMVLQNI
SKVETGKTDITFTLPTADGPRAVEKLTKLQGDIGFTQVLFDDHIGKVSLVGAGMKSHPGV
TATFCEALAKAGVNIDLISTSEIRISVLVKDVELDKAVKAIHDAFGLGGDEEAVVHAGTG
>Scoe_Aa_|_CG-25
MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGNQVVAVVSAMGDTTDELIDLAEQVSPI
PAGRELDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTSVDEGNVAIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALDADVCEIYTDVDGVF
TADPRVVPKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
VSSEPIKQGEKHVEQALISGVAHDTSEAKVTVVGVPDKPGEAAAIFRAIADAQVNIDMVV
QNVSAASTGLTDISFTLPKSEGRKAIDALEKNRPGIGFDSLRYDDQIGKISLVGAGMKSN
PGVTADFFTALSDAGVNIELISTSEIRISVVTRKDDVNEAVRAVHTAFGLDSDSDEAVVY
GGTGR
>Save_Aa_|_CG-25
MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGHQVVVVVSAMGDTTDELIDLAEQVSPM
PSGREFDMLLTAGERISMALLAMAIKNLGHSAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTALDEGNIAIVAGFQGVSQDKKDITTLGRGGSDTTAVALAAALDAEVCEIYTDVDGVF
TADPRVVKKAKKIDWIAFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
VSNTPLVQKAQQQGEQKVEQAIISGVAHDTSEAKVTVVGVPDKPGEAASIFRAIADAEVN
IDMVVQNVSAASTGLTDISFTLPKTEGRKAIDALEKAKSVIGFDSLRYDDQIGKISLVGA
GMKTNPGVTAGFFEALSDAGVNIELISTSEIRISVVTRADDVPEAVRAVHTAFGLDSDSD
EAVVYGGTGR
>Sgri_Aa_|_CG-25
MGLVVQKYGGSSVADAEGIKRVAKRVVDAKKNGNQVVVVVSAMGDTTDELIDLAEQVSPM
PTGREFDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTSIDEGNIAIVAGFQGVSQEGKNITTLGRGGSDTTAVALAAALDAEVCEIYTDVDGVF
TADPRVVKKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLRGTW
VSNEPQGDQQVEHAIISGVAHDVSEAKVTVVGVPDKPGEAAAIFRAIANAEVNIDMVVQN
VSAASTGLTDISFTLPKAEGRKAIDALERARGVIGFDSLRYDDQIAKISLVGAGMKTNPG
VTAGFFEALSDAGVNIELISTSEIRISVVTRADDVNEAVRAVHTAFGLDSDSDEAVVYGG
TGR
>NOCA-3a_|_CG-25
MGIVVQKYGGSSVADAAGIKRVAQRIVNTRKAGHDVVVVVSAMGDETDNLRDLAEQVTPL
PPPRELDMLLTAGERISMALVAMAIAALGHEAKSFTGSQAGVITDSAHGKAKIIDITPGR
IEKALKDGAIAIVAGFQGVSQDTKDVTTLGRGASDTTAVALAAALGAEVCEIYSDVDGVF
TADPRIVPAARKLARVSTEEMLEMAASGAKILHLRCVEYARRYDMPIHVRSSFSQKEGTW
VIPDSKAGEDEMEQAIIAGVAHDRSEAKITVVGVPDKVGEAARIFEALAATEVNLDMVVQ
NVSAAATGLTDISFTLPRADGQSAMGALARIQDEVGYDKLLYDDQIGKVSLIGAGMRSHP
GITARFFASLAAAGVNIEMISTSEIRISVIVDEAQVDEAVRATHTAFDLDAEEVEAVVYG
GTGR
>Acel_Aa_|_CG-25
MPLIVQKYGGSSVADAERIKKVAQRIVATRKQGYDVCVVVSAMGDTTDELLDLAAQVSPM
PPPRELDMLLTAGERISMALLAMAIANLGMEARSFTGSQAGVITDSRHGRAQIIDVTPGR
IREALAAGHIAIVAGFQGVAQDTKDVTTLGRGGSDTTAVALAVALGAEVCEIYTDVDGVF
TADPRIVPTARQIPRISYEEMLEMAAAGAKILHLRCVEYARRFKMPIHVRSSFSTKPGTW
IVDIPPEEQMEAPIISGVAHERGEAKITVVGVPDKPGEAAQIFQVIADAGINVDMIVQNV
SSTATGRTDITFTLPTSDLPTAMAALSKAKDRIGFEGLLSDDQIGKVSLIGAGMRTQPGV
TAKFLTALADAGINVEMISTSQIRISVVIREDDLPAAVAALHRAFELDDPEGQAVVYGGT
GR
>Tfus_Aa_|_CG-25
MALIVQKYGGSSVADADAIKRVAERIVAQKKAGYDVVVVVSAMGDTTDELLDLAKQVSPL
PPGRELDMLLTAGERISMALVAMAIGNLGYEARSFTGSQAGVITTSLHGNAKIIDVTPGR
IRDALAEGAICIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALNADLCEIYTDVDGVF
TADPRIVPSARRIPQISYEEMLEMAASGAKILHLRCVEYARRYNIPLHVRSSFSQKPGTW
VVSEVEETEGMEQPIISGVAHDRSEAKITVVGVPDRVGEAAAIFKALADAEINVDMIVQN
VSAASTSRTDISFTLPADSGQNALAALKKIQDKVGFESLLYNDRIGKVSLIGAGMRSYPG
VTARFFDAVAREGINIEMISTSEIRISIVVAQDDVDAAVAAAHREFQLDADQVEAVVYGG
TGR
>Stro_Aa_|_CG-25
MALVVQKYGGSSVDNAERIKRVAERIVAARKAGDDVVVVVSAMGDTTDELTDLANQVSPL
PPGRELDMLLTAGERISMALLAMAIHNLGYEARSFTGSQAGVITTSVHGRARIIDVTPGR
LKGALDEGAVVIVAGFQGVSQDTKDVTTLGRGGSDTTAVALAAALNADVCEIYSDVDGVF
SADPRIVPDARHIRQITYEEMLELAACGAKILHLRSVEYARRAGLPVHVRSSYSTNTGTM
VTGSMEDLPVEQALITGVAHDRSEAKITIVGVPDEPGAAAWIFDTVAGAEINIDMIVQNV
STEGTGRTDISFTLPKTDGPTAMAALSKIQDSVKFKGLLYDDHVGKVSLIGAGMRSHPGV
AAGFFAALGQAGVNIEMISTSEIRVSVVCRDTDLDDAVRAIHDAFELGGDTEAVVYAGTG
>FRAN-2b_|_CG-25
MALLVAKFGGSSVADADRIKRVAERIVENRRAGNDVVVVVSAMGDTTDELLDLAEQVSPL
PPARELDMLLTAGERISMALLAMAITTLGAEARSFTGSQAGVITDSVHGKARIIDVTPGR
IRAALDSGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALGADACEIYTDVDGVF
TADPRIVPDARRIDTISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFSAKPGTW
VTEIPEEQLVEQAIIRGVAHDLSEAKVTVVGCPDKPGVAAAVFRAVADTDVNLDMIVQVG
SVAGSGRTDISFTLPKADGRTALTALTKVQSEIGFERTLYDDHIGKLSLIGAGMKSHPGV
SARFFGSLADAGVNVEIISTSEIRISVVVRDTDLPLAVRAVHGAFDLGDPNGGAIVYAGT
GR
>Faln_Ab_|_CG-25
MALLVAKFGGSSVADADRIKRVAERVVEARRDGNDVVVVVSAMGDTTDELLDLAEQVSPL
PPARELDMLLTAGERISMALLAMAITTLGAEARSFTGSQAGVITDSVHGKARIIDVTPGR
IRAALDEGAIAIVAGFQGVSQDTKDITTLGRGGSDTTAVALAAALHADACEIYTDVDGVF
SADPRIVPDARRIDTISYEEMLEMAACGAKVLMLRCVEYARRYSVPVHVRSSFNAKPGTW
VTEIPEAQLVEQAIIRGVAHDVSEAKVTVVGCPDKPGVAAAVFRAVADADVNLDMIVQVG
SVAGSGRTDISFTLPKTDGRTALTALAKVQGEIGFERTLYDDHIGKLSLIGAGMKSHPGV
SARFFGALADAGVNVEIISTSEIRISVVVRDTDLPGAVRAVHGAFELGDPDGGAVVYAGT
GR

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3