[Bio] / FigWebPages / ask_CG24.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG24.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Cdif_Ab_|_CG-24
MSILVQKFGGTSVESYEKMNEVCKIVKAYKKNDEELQLVLVVSAMGRKGAPYATDTLINL
CSAVNDEPSKRELDLIMSCGEIISGTILANLLNAQGIDSVFFTGQQAGIITSDEYSNAKI
KYINPKKVKRALDDGKVVVIAGFQGVTDDGEITTLGRGGSDTSAVAIGKALECETVEIYT
DVDGIMTADPRVEPNAKVLSFIDYEEVFQMADKGAKVIHPRAVQLAKSGNITLAIKNTMN
PTFEGTKIGSLCRHLEDNIEYEQERDFKVAVANKDSVAQVKIKSAEEVFTEVLNEIEKKL
ITIDMINFFISEKAFVVEDADIKSLKEILDKFELDYEVNRDCAKVTLICSRIADEMSGIM
SKVVRGLSKAGVSLLQTSDSNMTISCLVSEEDMHTAVHAIHQQFYLK
>Tten_Aa_|_CG-24
MKILVQKFGGTSVSSEEKREKAVSKVIEAVKNGYNVVVVVSAMGRNGDPYATDTLINMAK
SIYSDIPKRELDLIMNCGEIISSVLFAATLSNKGYKAKALTGGQAGIITDDNFGNAEVIN
VDPSRILEVLREGIIPVVAGFQGITQKGELTTLGRGGSDTTAALLGVALKAEAVEIYTDV
DGIMTADPRIVSTAHIIDKISYNEVFQFAEQGAKVVHPRAVEIAMRGNIPLIIKNTMSDS
GGTIITNYSDAYDSIYEVDKLVTGIANMNNRVQITIESTENVQDIFEKIGEEKISIDLIS
IFPDKQVFTISEADFEKLRRLFEKYGVKYSYRTNCAKVSIIGNRIRGVPGVMARVIKALS
KRNIEIYQTADSHNTISCLVSQDKVEEAIRVLHDEFSL
>Cace_Aa_|_CG-24
MKIIVQKFGGTSVSTPERRSFVVQKVSSAIKEGYSPIVVVSAMGRAGEPYATDTLLSLID
NDFKETNKRASDLLMCCGEIISTVIMSNELKRAKIAAIPVTGGQAGIITDDEYSNASVKK
VNPENLLKLLCHNEVPVVAGFQGKSQNGFFTTLGRGGSDVTASLIGCAVNAEKIEIYTDV
DGIMTADPRIVQDAALIETISYNEVFEFAEQGAKVIHPRAVEVAMNGNIPLIIKNTLNDC
KGTLINREGDSLNKNLITGITSLSGRVQVTTKFKDSKIKSTEFLSLLGERNINIDLINVF
PKENIFTIDKKDLNKLKDTLIKTKVQYYLEDDCSKIAIIGNRICGVPGVMAKILKAITKE
GIEVLQTADSHTTIWCLVKSNVRNKAINALHREFNLNNK
>Cper_Aa_|_CG-24
MKIVVQKFGGTSVSTKERRTMVVEKVKGAINKGYLPVVVVSAMGRKGEPYATDTLLGLVS
EEFKKENKLATDLLMGCGEIISTVVMSDELREAEIEAVPLTGGNAGILTDDNYSSADFID
INPKLILEVLKEGKVPVVAGFQGVDRNGFLTTLGRGGSDTTAAVLGVALKAEEIEIYTDV
DGIMTADPRIVGDAELINKISYNEVFQLADQGAKVIHPRAVEIAMKGNVTLVIKNTMSTC
IGTMIDSLGDVDNNKFITGITHQGNRIQVSIKSDDNKDNINYKTILESLANNKISLDLIN
IFPKEKVFTIDAGVKELFEDIMRKNNLKYSLVEDLSTIAIVGSRMRGIPGVMAKIVGALD
NENIEVLQTADSHMTIWCLVESKNVREAIKALHRVFMK
>Ctet_Aa_|_CG-24
MKIIVQKFGGTSVSTKERRQRVVEKIIKAKNAGYSPVVVVSAMGRKGEPYATDTLLSLVS
NELKKNNLAIDLLMSCGEIISTVVMADELLSKNIDAVPLTGGQAGILTDDNYSNASILKL
ECDKILDVVEENKIPIVAGFQGISENGFITTLGRGGSDVTAVLLGGALKAEKVEIYTDVD
GIMTADPRIVSDATLIKEISYNETFQFSHEGAKVIHPRAVEIAMNENIPIVIKNTLTNCD
GTLINNISDLNLNNIITGITHTNDRTQIKIELEQNKENESYFRILDILAENSISIDLINV
FPRESIFTIDGKDFEKFSSIMNKINLKYSHIDSCSKIAIIGNRMRGIPGVMAKIIYVLMN
ENIEVLQTADSHATIWCLVKDIHTEKAIKALHNAFNLSNNK
>Cbot_Bb_|_CG-24
MKILIQKFGGTSVSTAERRSLVVDKIVKAKKAGYYPVVVVSAMGRKGQPYATDTLRSLVE
EDFLDKNTLAADLLMGCGELISTVVMSSELFNKGIDAVPLMGGQAGIITDNNFNNASVLR
VEKDRIVDLLKKDKIPVVAGFQGKSEDGYITTLGRGGSDVTAALLGTALEAESVEIYTDV
DGIMTADPRIVENASLIKEISYNEVFQFADQGAKVIHPRAVEIAMTSNIKLVIKNTMTDC
KGTTINNIGIKNSNNVITGITHMSNRTQIIVDAEENKGNKNYTNLLNSLAENSISIDLIN
VFPKEKIFTIDEKDFNEFSSIMEGLKIKFSYLKDCSKIAIIGSRMRGIPGVMAKILKALV
ERNIEVLQTADSHTTIWCLVSKEDTEKAIKSLHCEFKLDCI
>Cnov_Aa_|_CG-24
MKILVQKFGGTSVSTSEKRKLVVKKVSNAIKAGFKPVVVVSAMGRKGDPYATDSLLGLLT
DEFKENNSLATDLLMSCGEIISSVVMSNELNKNNINAIPLMGGQAGIHTDENFSDASVKS
VDNANIMKILEEGKIPVVCGFQGVSEKGFITTLGRGGSDVTASLLGVALNAEQVEIYTDV
DGIMTADPRIVKGASLIKEISYNEVFQFAEQGAKVIHPRAVEIAMKGSIPLVIKNTMSDC
TGTTIDNIGDLNASNIITGITHMANRVQIRIKLEDNSGNENYYDLLPILAENSISIDLIN
VFPNEKIFTIDKKDFFKFDGIMNSINVKYSHIDDCSKIAIIGSRMRGIPGVMAKILKSLV
KEKIEVLQTADSHTTIWCLVESKYTETAINLLHEEFNLERL
>Sthe-17_Aa_|_CG-24
MRIIVQKFGGTSVATPEGREAVVRRVRQALDDGYATVVVVSAMGRQGDPYATDTLIQLAQ
SAGPDLAPREMDLLLSCGEIISSVLMAATLTAAGIPAVALTGGQAGIQTDENYGNAQIVK
VDPAPVLSRLKEGLVVVVAGFQGVNAAGEVTTLGRGGSDTTAAALGGALRAEVVEIYTDV
DGVKTADPRLVAEARTLSVTTYDEIAQMAHYGAKVVHPRAVEIAMQHRVPIRVRSTFSDN
PGTLITYSAEAGVIWSEPFSDRVVTAVTHVVGLAQVVVKTGRDWATPRLFRRLANAGISV
DLISVSMESSAFSIPESRAAQAEMILTELGLVDLQVRHGCAKVTVVGSGMRGRPGVMATV
AEALYAAEVPIWQTADSHVTISCLIPAADVQRAVQALHDAFELGRI
>Mthe-3_Ab_|_CG-24
MKVLVQKFGGTSVASPEQRLVVTGHIERACRVGYQVVVVVSAMGRRGAPYATDTLLELLG
DNEVEPRERDLLLACGEVISGVVLTGLLKSKDLPAVFLTGGQAGIITDAQFGDARILRVE
PRRIQSYLDQGRVVVVAGFQGVTESGEVTTLGRGGSDTTAVALGVALGAEAVEIFTDVDG
VKTADPHIVSDARTLSTITYNEVCQMAYEGAKVIHPRAVEIARQKNIPLRIKSTFNDGPG
TLVVAWQPGVTGVHISRDRVITGITHMDGLTQLRVSLPSGEGAGEVFPLLAQNNISVDFI
NIFPGELVFTVKSEVARQARELIEGLGLKVTARPGCAKVATVGAGMRGVPGVMATIVTAL
EREGIKILQSADSYTSIWCLVDRKDMERAVQTLHREFKLNDGKTGEVKVYAVG
>Pthe_Ab_|_CG-24
MKFIVQKFGGTSLVNDETRRMAAKKVIEAKNKGYLPVVVVSAIGRMGDPYATDTLLKLAC
DGNWELSPRESDLLMSCGEVISGVVMAATIQKEGHPAVFLTGLQAGIITDNNHNDARILK
VNPENIIKHARDGKIIVVAGFQGATENGEITTLGRGGSDTTAAALGVALDAEWVDIYTDV
EGIMTADPRIVSDARLLEVVTYNEICQLAHEGAKVIHPRAVEIAMQKDIPLRIKSTFSSA
PGTLVTSRGEAYKGSIDITRDRTITGITYISDITQFRIPMDGCGDTAGLQRRMFEALALA
GISIDFINVHPDVVIFTVKNSVAAKAAQILENMGLRPSILPDCAKVAAVGAGMTGVPGVM
ARIVGALADEKVQILQSSDSYTTIWVLVKKKDMEKSIRALHRQFGPGEKDIERR
>Chyd_Ab_|_CG-24
MAKKFIILKFGGTSLKTAELREKVAQKIINTFESGYQPVVVVSAIGRKGDPYATDTLLNF
AYEVNRDLPPREADLLMACGEIISGVIMVNTLAKMGYKAKLFTGAQAGIITDDNFTSASI
LKVKADKILKAVDEGFIPVVCGFQGVTEDGEVTTLGRGGSDTTAAALGVALKAEFIDIYT
DVEGIKTADPRIVEDAKTLEVVTYNEISQLAHEGAKVIHPRAVEIAMQKNIPLRIKSTLT
DGEGTLVTSHAEVYGEVIEVIRDRIITGIAHIPGVTQIKILREDTPEIVNLAQKVFKGLA
LAEISVDFINISPEGLAFTVKGEVTEKAVDVLENMGFTPRIRRNCAKIAAVGAGMTGVPG
VMAKIVEALTREQIEILQSTDSYTTIWVLVDGENMEKAVRAIHKAFKLNE
>Dred_Aa_|_CG-24
MRFIIQKFGGTSLVTQELRELVANKIIAAVDEGFSPVVVVSAIGRAGEPYATDTLLNFAL
SINRDIPPREMDMLMSCGEIISGVAMANTLQRMGHQAVLLTGAQAGIITDDNFNDARIIR
VEPQNVIKHVEQGKIVIVTGFQGICQGGDITTLGRGGSDTTASALGVALNAEYIDIYTDV
EGIMTADPRIVEDARILDSVTYNEICQLAHEGAKVIHPRAVEIAMQKNIPLRVRSTFLDS
PGTLVTSHHGVYGTIDITRDRLACGVTHIAGVTQLKIIAKDIAVEDPALRIFRALALADI
SIDFINVSPELIMLTVKDEVAKKAVDVLENLSVFPQVKPNCAKVSTVGAGMTGVPGVMAS
IIQALTEEGVEILQSSDSHTTIWVLVEKENMKKAIRALHRKFKLGQRE
>Lmon_Aa_|_CG-24
MKIIVQKFGGTSVQNEKSRLMAFNHIKQVLKEGYKVVVVVSAIGRYGDPYATDTLLELIG
AKNTKLTAREQDTLLSVGETISASVFTNMLKEANIKAEAFSGGQAGIITSDDHLNAKITE
VDTARLKDALTNLDVAVVAGFQGITANGDISTLGRGGSDTSAAALGVSLQADYIDIFTDV
DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKIPMRIRSTYLES
TGTLVTSLTNDSDHFDVKERIVTGVAHVTNLTQISVQTDTVKAQQLAFKILADAGISLDF
INISTNSVIFTVPEEKSHVVKQLLEDADLQTTVRQACAKVSIVGAGITGVPGVTAKIVGA
LSEKNIPILQSADSHTTIWVLVKEEDLISAVNALHDVFCLEIK
>Lwel_Aa_|_CG-24
MKIIVQKFGGTSVQNEKIRLMAFNHIKHALKDGYKVVVVVSAIGRYGDPYATDTLLELIG
AKDTKLTPREQDTLLSVGETISASVFTNMLKEADIKAEAFSGGQAGIITSNHHLNAKITE
VDTSRLKTALKTLDVAVVAGFQGKAKNGDITTLGRGGSDTSAAALGVSLQADYIDIFTDV
DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKIPMRIRSTYLES
TGTLVTSVADELGHFDVKERMVTGVAHVTNLTQISVKTDTVKAQQQAFKILADAGISLDF
INILTDSVIFTVPEEKRLVVKLLLEEADLQTNVRENCAKVSIVGAGITGVPGVTAKIVGA
LSEKNIPILQSADSHTTIWVLVREEDLISAVNALHDVFCLEIK
>Linn_Aa_|_CG-24
MKIIVQKFGGTSVQNEKIRLMAFNHIKNALKDGYKVVVVVSAIGRYGDPYATDTLLELIG
AKDTKLTAREQDTLLSVGETISASVFTNMLREADIKAEAFSGGQAGIITSNNHLNAKITE
VDTKRLKKALETLDVAVVAGFQGITENGDITTLGRGGSDTSAAALGVSLQADYIDIFTDV
DGMMTADPRIVEHARSLPRVSYNEVSNMAYQGAKVIHPRAVEIAMTAKVPMRIRSTYLES
TGTLVTSLADDSGHFDVKERMVTGVAHVTNLTQIFVKTDTVKAQQQTFKILADAGISLDF
INISTDSVIFTVPEEKRRVVKQLLEEANLQTTVREDCAKVSIVGAGITGVPGVTAKIVGA
LSEKNIPILQSADSHTTIWVLVREEDLISAVNALHDVFCLEIK
>Oihe_Aa_|_CG-24
MQVMVQKFGGTSVQSSENREHVIRHIREALVQEYKLVVVVSALGRKPDPYATDSLLGLVD
FPTNTNSSRELDLLMSCGEVISSVVLSNELQKNHISAVALTGAQAGFVTNEDFNRAKIKE
VNPTRILKELETHDVVVVAGFQGQSESGEITTIGRGGSDTSAAALGVALSAERIEIFTDV
EGIMTADPRVVKNARPLDVVTYTEICNLAYQGAKVIHPRAVEIAMQGKIPMRIRSTYSEQ
LGTLVTSSRVHELGMDIPDRMITGIAHISPVTQIKVQTKESAYRVQSEVFKAMAEAGISV
DFINISPTGVVYTVPDTLTTKAIEILEMLGFHPEVTKGCAKVSAVGAGMSGVPGVASKIV
QALTDSGVQILQSADSHTTIWVLVHNDDLITAVNALHDVFGLSITEELLES
>Bcla_Aa_|_CG-24
MKIIIQKFGGTSVKTDESRLQAVRHVQKAVNDGYKVVVVVSAMGRKGDPYATDTLLSLVS
KSRITKREQDLLVSCGETISAVVFSDLLNAHGVQATAMNGAKAGFRTNEEFGNAKIKEMK
CEHLLKKLETEDVVVVAGFQGQSKSGDVTTLGRGASDTSATALGAALHAEWVDIFTDVEG
VMTADPRIVSDARALEAMSYNEICNMAYQGAKVIHPRAVEIAMQAKIPIRIRSTYSDNEG
TLVTALGASHSMDVNERMITGIAHVANVTQIKVAAKEGQLDLQENVFKSMAQAKISVDFI
NISPSGVTYTVSDEAADKAKQVLEHLGYTPELRRGCAKVSAVGAGMSGVPGVAAKIVSAL
SGENVQILQSADSHTTIWVLVKNEDMKKAVNALHKMFQLSEATTV
>Bhal-1_Ab_|_CG-24
MKIIIQKFGGTSVKTAEVREMAAKHVEKAVEGGYKVVVVVSAMGRSGDPYATDTLLQLVD
TKTIAKREQDLLVSCGEIISSVVFTELLLKKGIQATAMTGAQAGFRTNEEFTNAKIVDMK
VDRLKKTLVHQDVVVVAGFQGQSPTGETTTLGRGGSDTSATALGAALDAEWVDIFTDVEG
IMTADPRIVSEARPLDTMTYNEVCNMAYQGAKVIHPRAVEIAMQAKIPIHIRSTYSDGKG
TLVTSMLTEAGARDVQDRIITGIAHMSGVTQIKVHAKDGEFDLQEKVFRAMAAEKISVDF
ININLTGVVYTVMDEVADRAIEVLRELGFDPEVKRHCAKVSAVGAGMTGVPGVTAKIVAA
LSQENIRILQSADSHTTIWVLVSEDDLTKAVNALHRMFHLEQSEQTKQKQV
>Blic_Aa_|_CG-24
MKIIVQKFGGTSVKDDRGRKLALNHIKEAVNEGYKAVVVVSAMGRKGDPYATDSLLDLLY
GGQDTITEREQDMLLSCGETISSVVFASMLLENGIKAAALTGAQAGFLTDNNHTNAKILE
MKPERLVSMLADHDAVVVAGFQGATAKGDITTIGRGGSDTSAAALGAALDAEFIDIYTDV
EGVMTADPRIVEKAKPLPVITYTEICNLAYQGAKVIHPRAVEIAMQAKVPIRVRSTYSNE
TGTLVTSHHNSKAGSDVFERLITGIAHVKDVTQFKVPAKEGQYNVQTEVFKAMANAGISV
DFFNITPSEIVYTVAGNMTDRAHSILKELGYEPAVTRNCAKVSAVGAGIMGVPGVTSKIV
TALSEKGIPILQSADSHTTIWVLVHEKNMATAVNALHEVFELSK
>Bsub_Ab_|_CG-24
MKIIVQKFGGTSVKDDKGRKLALGHIKEAISEGYKVVVVVSAMGRKGDPYATDSLLGLLY
GDQSAISPREQDLLLSCGETISSVVFTSMLLDNGVKAAALTGAQAGFLTNDQHTNAKIIE
MKPERLFSVLANHDAVVVAGFQGATEKGDTTTIGRGGSDTSAAALGAAVDAEYIDIFTDV
EGVMTADPRVVENAKPLPVVTYTEICNLAYQGAKVISPRAVEIAMQAKVPIRVRSTYSND
KGTLVTSHHSSKVGSDVFERLITGIAHVKDVTQFKVPAKIGQYNVQTEVFKAMANAGISV
DFFNITPSEIVYTVAGNKTETAQRILMDMGYDPMVTRNCAKVSAVGAGIMGVPGVTSKIV
SALSEKEIPILQSADSHTTIWVLVHEADMVPAVNALHEEFELSK
>Bant_Ab_|_CG-24
MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
EGTLIAAYDGATKGQDVEERPVTGIAHVSNVTQIKVLAKETAYDIQQHVFKEMANEGISV
DLINISPTGVAYTVNDNVSARAVEVLKQLGYEPIVTEHCAKVSIVGAGMAGIPGVTAKIV
TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
>Bthu_Ab_|_CG-24
MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
EGTLIAAYDGATKGQDVEERPVTGIAHVSNVTQIKVLAKETAYDIQQHVFKEMANEGISV
DLINISPTGVAYTVNDNVSARAVEVLKQLGYEPIVTEHCAKVSIVGAGMAGIPGVTAKIV
TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
>Bcer_Ab_|_CG-24
MKIIVQKFGGTSVRDENGRKHALHHIKKSLDAGYKVVTVVSAMGRKGEPYATDTLLSLVN
QEESHISNREQDLLLSCGELISAIVFSNMLNENGIKAAALNGAQAGFVTNDDFTNAKIIE
MNCDRIHEELENVDVIVVTGFQGQTKKGDTTTLGRGGSDTSASALGVALHAEYIDIFTDV
EGVMTADPRIVKDARHLQTVTYNEICNMAYQGAKVVHPRAVEIAMHAKVPLRVRSTYSDS
EGTLISASDGATKGRDVEERPVTGIAHVSNVTQIKVLAKETAYDLQQHVFKEMANEGISV
DLINISPTGVAYTVSDNVSNRAVELLQNLGYEPIVTEHCAKVSIVGAGMAGYPGVTAKIV
TALAEKGIQILQSADSHTTIWVLVKETDLVEAVNALHSAFELSKEKQLEQ
>Gkau_Aa_|_CG-24
MKLIVQKFGGTSVRDERGRNLARRHIERALEDGYKVVAVVSAMGRCGDPYATDTLLSLIG
GVHHHVTKREQDMLMACGEIISSVVFSNLLNEHGIKATAFTGAQAGFCTNSDHTNAKILE
MRCDRLLEALRQYDVVVVAGFQGMAENGDITTLGRGGSDTSAAALGAALNAEWVDIFTDV
DGVMTADPRIVESARPLDVVTYTEICNMAYQGAKVIHPRAVEIAMQAKVPLRIRSTYSDA
PGTLVTSSVRGRKGSDVKERLVTGITYVADVTQIKVLAKEGHYELQSDVFQAMAHEGISV
DFINISPYGVVYTVSGDMTEKAVAALRRIGYEPAVTPRCAKVSVVGAGIAGVPGVTAKIV
TALSEQGIQILQSADSHTTIWVLVKQDDMEKAVNALHDAFCLSEADAGEDEAIWSEE
>Gthe_Aa_|_CG-24
MKIIVQKFGGTSVRDERGRNLARRHIEKALEDGYKVVVVVSAMGRNGDPYATDTLLHLIG
GTGHHVTKREQDMLMACGEIISSVVFSNLLNEHGIKATAFTGAQAGFRTNGDHTNAKILE
MRCDRLLEALEQYDVIVVAGFQGVAENGDITTLGRGGSDTSAAALGAALNAEWVDIFTDV
DGVMTADPRIVESARPLEVVTYTEICNMAYQGAKVIHPRAVEIAMQAKVPLRVRSTYSDA
PGTLVTSSVRGQKGSDVKERLVTGIAYVANVTQIKVLAKEGHYELQSDVFQAMAREGISV
DFINISPYGVVYTVSGDMTEKAIAALRRVGYEPAVTPRCAKVSVVGAGIAGVPGVTAKIV
TALSEQGIQILQSADSHTTIWVLVKQDDMEKAVNALHDAFCLSEEGGYEAIWNEE
>Lpla_Aa_|_CG-24
MEIIVQKFGGTSVKDEAARIQALKHVQYAVDQGDKVIVVVSAIGRKGAPYATDSLLGLVG
AEHSRLTNRELDMLVSVGETISTAVFTELARKQGLNVTAMTGHDAGIVTNDDFQNAKILR
VDPKPITDAFIDADVVVVTGFQGATESGHVTTIGRGGSDTSAAILGAALKAKRVDIFTDV
NGMMTADPRLVTHARFIKAISYEELANMAHEGAKVIHPRAVEIAEQAHVPMRIRSTYQEP
DELGTLVTDRTTTQIEHYRTVTGIAHQTDLTQFTVPTDTLSSSAIFQLMAQHGLSVDFIN
ITPHQVVFNLVDGDADVAKQLLTDAHVHCQSIANCAKVSVVGAGITGTPGVTARIVSALA
AQHIDILQSTDSYTTIWVLVKEADLKAAMNALHDEFLGIE
>Lsal_Aa_|_CG-24
MKIMVQKFGGTSVQDDESRKSAMRHIEHAVNEGYKVAIVVSAIGRKGAPYATDSLLSLVG
GERTKLTPRELDMIVSVGEVISTAVFTQMLKENGFNAVAMTGPDAGFRTNNDYQNAKVLE
VKTDAVLDAFASHDVVVVSGFQGMSEEGHVTTLGRGGSDTSAALLAVALDAERVDIFTDV
SGMMTADPRIVKNAHFLKTVSYDEVANMAHEGAKVIHPRAVEVAHQAHLPMRIRSTWDNV
DELGTLVTDKNLSIEHYRTVTGIAHQTGLTQINLSVNNTEAEKIFKVLAENEVSIDFINI
SPNQVVFNTSREDGLKAKKIFEEYNIPVNFVENCVKVSIIGGGMVGTPGVIAKMVTALSK
TGVEILQTADSDTTVWILVTEDNFKLAVNTLHEAFLEN

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3