[Bio] / FigWebPages / ask_CG23.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG23.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Hmar_Aa_|_CG-23
2 :     MRVVAKFGGTSLGSGDRINRAADSIAAAVQQGHEVAVVASAMGNTTDELLEEINYDADSA
3 :     DRAEIVSMGERTSVRMLKGALAARGIEAVFLEPGSEDWPIITDEYGEVDVEETQKRAHAL
4 :     AGQLKDVVPVITGFLAQDYQGNVTTLVRGGSDTSAVMMGDYMDADEVVIVTDVEGVMTGD
5 :     PRVVEGARNVGKISVDELRSLSFRGAEVVAPSALSYKSEDLGVRVVHYQHGDLLSGGTSI
6 :     EGEFQNLIDLQEQPIACVTVAGRAIRNSPGILADLSGAIADEDINIEANSSGMDSLTFYV
7 :     DEDDAEEAEALLHARIVDDETLSSVTVEDEIAVIRVTGGDPSQSALAHQVVAPLADAHIH
8 :     LYDVITSATSVSVFVPWEDREQALSLVQDVF
9 :     >Hwal_Aa_|_CG-23
10 :     MRIVTKFGGTSLGNGDRITRAADSIAAAIDAGHEIAVVASAMGSTTDYLLDEIHYDAADK
11 :     DRAEIVSMGERTSVRMLKGALSARGVTAQFLEPGSDDWPIITNERGEVDVGETQRRAADL
12 :     ASNLDDVVPVLTGFLAESHDGTTTTLGRGGSDTTAVMLGHYTDADEVVIVTDVEGVMTGD
13 :     PRVVEGARNVGQITVDELRNLSFRGAEVVAPSALTYKNDDLGVRVVHYQHGDLLTGGTLI
14 :     EGEFENLIDMQEDMLACVTVAGRSIRNSTGILADLSQSLRDDGINIDAVASGMDSITFYI
15 :     SEDIASKAENLLHAKVINNQTLSSVTVDDGIAVIRVTGGELPNRPGVILDIVRPIAEAGI
16 :     NIRDVITSATSVAVFVAWDDREETLSIVQSKF
17 :     >HALO-10a_|_CG-23
18 :     VRVVTKFGGTSLGSGDRVERAADSIADAVAAGHEIAVVASAMGNTTDELLDDITFDADEP
19 :     DRAEIVSMGERTSVRMLKAALAARGVDATFLEPGTTDWPIVTNERGEVDADATAAGVDRL
20 :     AGRLGDTVPVITGFLAEDPQGNVTTLGRGGSDTTAVMLGRYLDADEVVIVTDVEGIMTGD
21 :     PQVVEGARNVGRITVDELRNLSFRGAEVIAPSALSFKDDALDVRVIHYQHGDLLSGGTRI
22 :     EGTFESMIDMRDSPLACLTVAGRAIRNRPGITSALSTALSDSDINVDAVASGMDSMTFYV
23 :     DESVAERAENILHQEVIAVSELSSVTVTDDIAAIRVLGGELPNRPGVLCRIIDPLADRNI
24 :     NVIDIISSATSVAVFVSWADREPALDVVQNGFGS
25 :     >Npha_Aa_|_CG-23
26 :     MRVVAKFGGTSLGNGDRVNRAADSIAAAVEEGHEVAVVASAMGSTTDFLLDAIEFEADEA
27 :     DEAEIVSMGERTSVRMLKAALGARDINAKFLEPGTEEWPVITDEHGEVDVEATQRRAKQL
28 :     AADMAAEGYVPVITGFLAQDHAGNVTTLGRGGSDTTAVMLGNYMNADEVVIITDVEGVMT
29 :     GDPRVVEGARNVGEITVDELRNLSFRGAEVVAPSALSYKTADMIVRVAHYQHGDLLDGGT
30 :     TIEGQFQNLIDMREEPLACLTAAGRAIRNTPGILSDLSTELSEADINVDAVASGMDSVTF
31 :     YVDAEVAEEAETVLHQAVIDLDELSSVTVDDDIAVIRITGGELPNNSGILEDIINPLADA
32 :     HINVLDLVTSATSVAVFLEWDDREDALEIIQDAV
33 :     >Msta_Aa_|_CG-23
34 :     MGIVVAKFGGTSVGSGERIYKAANSVVNEYMQGNQVVVVVSAINKTTDESIKLVNESIGE
35 :     LVTEKQLAGILSMGEMQSVRIMAATIESLGVKAEFIDPFSEKWPVITDSNYLNAKIDKKE
36 :     TQKRVTKYIKKLLNQGIIPVVCGFLGCDVDGSVTTLGRGGSDVSAFLIGHCLGADEVVIV
37 :     TDVKGVMSTDPRKLNTARKLDKITVEEMIDLANYGAQVLHPNALRYKDPNIKAKIISFEY
38 :     GDLRVQGTDIIGPAHEEYDVITITKCDDKLSVLAVVGENLMNQQCIIAQITQKVCENKLN
39 :     IYGISTGESSITLFFKEDEAIKAHEKLHDLVIGGDTLSSISLGQKIAMISVVSHDFIDTP
40 :     GIIASITKPLHENEINIVELSSSQTAVVVFVDWNDGDKAYDLIKETLQ
41 :     >Msmi_Aa_|_CG-23
42 :     MDLIVAKFGGTSVGDGSRIRKAAQSVVNEYMKGNQLVVVVSAVNNATDELIELSNEAIGG
43 :     GLTDKQKAEIMAMGELTSSRLFAAAIESLGVKAEFIDPYNDKWPVITDSNSLNAKIDFAT
44 :     TDKKCEGIKNLISQGIIPVICGFLGKGPSGEITTIGRGGSDVTAFLLGHCLSANNVVIVT
45 :     DVDGVMSTDPNKIEEAELLDEISVEEMRDLATHGAQVLHPHALKYKDPLISAKIINFNNG
46 :     DLSSEGTKITGPFEGDMLKTVSLYKNPISVIAIVGEEMLKKVGLLADLTSCLAENEINIF
47 :     GISAGQNSITVFVEKKDSDKAYHLLHSWVIDEDVLSSLSLGDDTAMITVVSPEFIDEPGI
48 :     ISNITNPLRKNDINIVEISSSQTAVVLFVDWKDGEKALELIKEVLK
49 :     >Mthe-5_Aa
50 :     MELIVAKFGGTSIGNGRRIKKAARSVVKEYMKGRKVVVVVSAINKTTDELLQIVDEAMED
51 :     AVTEKQLAEIVSMGEMTSVRIFSSAIEALGVKSEYIDPFMDEWPIITDSNLLNAKVDFEA
52 :     TEEKSRELLKLLDQGIIPVVCGFLGRDPNGYITTLGRGGSDITAFLLGHCLKADEVIIVT
53 :     DVGGVMSTDPNKLQGAKKLDKISVEEMRDLATHGAQVLHPHALKYKDPDIKAKIIGFEHG
54 :     DLSAPGTEIIGPSKNKMVKTTTLNPDPISVVAVVGEKILNKPGILARLTSRLAENSINII
55 :     GISTGQNSVTIFVDKKDADEAHRLLHDVVIADDDLSSLSLGRDIAMITISSPDFIDTPGI
56 :     ISEITKPLRDNDLNIVEISSSQTSVVIFVDWNDGKKAYELVRGVLE

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3