[Bio] / FigWebPages / ask_CG22.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG22.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Cmur_Aa_|_CG-22
2 :     MFKEKKAPLVCKFGGTSVGTSSSIQRVCEIIRKEKPSFVVVSAVAGVTDLLEEFCRAPVG
3 :     QKSQFTAMIREKHESIAKELGIDVAIEPFLGPLKQFEGAGHLQQEDQAKILAIGEDLSAS
4 :     LICSYCRANSLQLEQLEARQVILTDSQFLRAEPDLALMQTMWGELVLKENTIYLMQGFLG
5 :     ATASGATTVLGRGGSDFSASLVGELCEARELRIYTDVRGVHTADPKILKDTQLIDFLTFE
6 :     EMQELASSGSKVLHQDMLKPCIRAKVPIFVTSTFDLTKEGTWICASLNEGVEGPEIKALS
7 :     LKANQALWFVEYHSPLMRLENVLRCVRGLGSIPGVVMAQNSGVYFTVDWEENNQSMTEAL
8 :     REFGAVSCEGPVSLVALVGAKLTSWSMTGVFDALQGTPVLYWSQTDTVINLIINEESGVV
9 :     VTKLLHDYVLGLNRSGL
10 :     >Ctra_Aa_|_CG-22
11 :     MLRQETAPLVCKFGGTSVGTAQSIRRVCEIIQEERPSFVVVSAVAGVTDWLEEFCRLPKG
12 :     KRAALTEKIRERHESIAKELGIEVSLAIFWEILEHFEDVEELFSEDQARILAIGEDLSST
13 :     LICSYCCTYVLPLKRLEARQVILTDSQFLRAVPDLALMQTAWGELALQEDTIYLMQGFLG
14 :     ATSSGKTTVLGRGGSDFSASLIGELCKARELRIYTDVCGVHTADPKILKDTQLIDSLTFE
15 :     EMQELASSGAKVLHQDMLKPCVRAKVPIFVTSTFNVTKEGTWICASLNESTEGPVIKALS
16 :     LKSNQALWFVEYNSPLVRLEDVLGCVRSLGFVPGVVMAQSLGVYFTIDWEEYPQTITKAL
17 :     EAFGTVSCEGPLSLVALVGAKLASWSMSRVFEALHRTPVLCWSQTDTVINLIINKDFGVA
18 :     VTELLHDCLFK
19 :     >Cpne_Aa_|_CG-22
20 :     MSKIVYKFGGTSLATAENICLVCDIICKDKPSFVVVSAIAGVTDLLVDFCSSSLREREEV
21 :     LRKIEGKHEEIVKNLAIPFPVSTWTSRLLPYLQHLEISDLDFARILSLGEDISASLVRAV
22 :     CSTRGWDLGFLEARSVILTDDSYRRASPNLDLMKAHWHQLELNQPSYIIQGFIGSNGLGE
23 :     TVLLGRGGSDYSATLIAELARATEVRIYTDVNGIYTMDPKVISDAQRIPELSFEEMQNLA
24 :     SFGAKVLYPPMLFPCMRAGIPIFVTSTFDPEKGGTWVYAVDKSVSYEPRIKALSLSQYQS
25 :     FCSVDYTVLGCGGLEEILGILESHGIDPELMIAQNNVVGFVMDDDIISQEAQEHLVDVLS
26 :     LSSVTRLHHSVALITMIGDNLSSPKVVSTITEKLRGFQGPVFCFCQSSMALSFVVASELA
27 :     EGIIEELHNDYVKQKAIVAT
28 :     >Cabo_Aa_|_CG-22
29 :     MPPVVYKFGGTSLGTAESIRKVYDIVHKDTPWFIVVSAVAGITDLLDMFCSVSSEYREHI
30 :     ILDIANKHNEIIHDLQLTFSIAPWMEKLQRCMHKEKISLRDRAEILAIGEDISASLFHAF
31 :     CCSHDFSLEFLEARTVILTDGEYSCATPDIPRMRENWHALNFRSDVCYITQGFIGANAAG
32 :     ETTLLGRGGSDYSGALIAEMSHAKEVRIYTDVNGIYTMDPRIIEDAQLIPELSFEEMQNL
33 :     ATFGAKILYPPMLSPCVRSGIPIFVTSTFDLSKGGTWIYAMDKIMSHEPRVKALSLRQHQ
34 :     RLWSIDCSGSSTVGFDKILSILDTHHVLPGLITSQDSTVSFTTDDDDVSDDVIRELYDQL
35 :     SSIGTVHMLYDLALITMIGSGLASTKVVTTVTEKLRHYPSPIFCCCQSCMALSLVVPENL
36 :     AGNVVEQLHNDYVKQKFSVV
37 :     >Cfel_Aa_|_CG-22
38 :     MLPVVYKFGGTSLGTAESIKKVYDIVCKNTPRFIVVSAVAGITDLLDLFCAVSRESREQI
39 :     IFDIAKKHNEIIRDLQLIFSISPSMERLYNCVDKEEISPSDRAEILALGEDISASLFQAF
40 :     CRSNNFSLEFLEARTVILTDDEYDRATPDVFRMHSNWQTLNLQRDVCYITQGFIGANSSG
41 :     KTTLLGRGGSDFSGALIAEMSNAREVRIYTDVNGIYTMDPRIIKDAQLIPELSFEEMQNL
42 :     ATFGAKILHPPMLSPCVRAGIPIFVTSTFDVSKGGTWIYAMDKIVGYEPRVKALSLRLHQ
43 :     RLWSVDCGNLGAASLDKVLSILESYRVFPGLITSQDSAVSFTTDDDDVSDNVIRDLYGQL
44 :     SSIGSVHMLYDLALITMIGSGLASTKVVTTVTEKLRNYLSPVFCCCQSCMALNLVVPENL
45 :     AGSIVEQLHNDYVKQKFSVV
46 :     >Ccav_Aa_|_CG-22
47 :     MSPVVYKFGGTSLGTAESIRKVYAIVCKNTPRFIVVSAVAGITDLLDMFCCVSSEYREQI
48 :     VLDIAKKHDEIIHELQLAFSLSPWIEKLNKWVDKKEISLGDRAEILALGEDISASLFQAF
49 :     CHSNNFPIEFLEARTVILTDDEYHRATPDISRMRENWHTLNLKGDACYITQGFIGASTSG
50 :     KTTVLGRGGSDYSGALIAEMSCAEEVRIYTDVNGIYTMDPRIIEDAQLIPELSFEEMQNL
51 :     ATFGAKILYPPMLSPCVRAGIPIFVTSTFDVSKGGTWIYAMDKTVSYEPRVKALSLRQHQ
52 :     RLWSVDCGILGAVSLDKILPILDTYRILPGLITSQDAKVSFTTDDDDISEEIIQDLYSQL
53 :     SNIGTVHMLYDLALITMIGSGLASTKVVTTVTDKLRNYPAPVFCCCQSCMALSLVVPENL
54 :     AGSIVEQLHNDYVKQKFSVV

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3