[Bio] / FigWebPages / ask_CG21.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG21.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 6 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Ftul_Aa_|_CG-21
MSEIIVAKFGGTSVANQQAIRQCANIVNSDNRIKLVVVSAQSGITNLLIQLANNKDNSKI
QEIIGQIESIVNPISQSINSESVTTSVSNMIAELRMFANMAAYFSGKQLSDSILAFGEII
SSFLVANIFNQKGINAYHLDSRKILKTNSHFGCASPDLSALATNAIEHILPKIREGYVCV
LGGFIGSDAHGNTTTLGRGCGDYSAALYTQAIKASQLKIYTDVTGIYQIDPRVIPRAISL
SKLGFSEAAELATFGAKVVHPKTFGPAISSNFDIYIGSTFQPELGGTLITQKIDYDRNII
AVAERKAQTLLTIKSFNMFGSQGFLVKVFSILANHNIAVDLVSTSEVSVAITLDKLGSHS
MGDDLVTPELLKDLESIGNVNIKVENDLSLVSVVGSNLHQINGVSGELFNSLKDYNIRLF
SHGASENSICMLVASKDAQKVVNNIYGSFFS
>Bbac_Ab_|_CG-21
MAKLVVSKFGGTSMGDADCMLRSAEVSFRQGSGLVVVSATSGTTNDLIALGKTAESQAWS
ESEKILSKIQDKHNKIAQDLKLPADAKAKLETLFEEMSSLAKGMHLLKDCSVKAMDTLMS
LGERMSSVLFTEAMSQVLKKHGSAKSAELLDVRTVLRTDDQFGKAKPLTNDVANLCQKNL
SFLREGKKVMCTQGYIGMTEEGITTTLGRGGSDYSAAILAEGVSADVLEIWTDVAGIATT
DPRLCPKAQPISEISFKEASELATFGAKVLHPATLLPAIRKNIPVFVGSSFDVEARGTWV
RMDVEDHPLIRAMALRKKQVLVTLSTPEMLYAHGFLFQIFKIFNDHKVSIDAITTSEISV
SVTLDDSTLLNKNLIKDLSQIADVQVEENLALISLIGNNINHTPGLGKRIFETIPDINVR
MICLGASKHNFCFLVADEQGPEVIKRLHACFIEAGIEEMA
>Patl_Aa_|_CG-21
MSDSSINVAKFGGTSVATYATMLNCAKVVKGNPATKVVVVSASAGVTNILVELAHKALTK
DEISAYIEQIQAIEFAILNDLGAPTLVADKLLELLESLKQLAFHEEILHRPDLKDSLLSH
GERMASLLFSEVLTQQGLPADNFDVRNVLLTDSEFGQAAPQLDGIKQRAAKLMAPEIAKT
VLVTQGFIGSDEAGNTTTLGRGGSDFTAALLAEALGAQSCEIWTDVIGVYTTDPRITDAA
RPLPELSFEEAAEMATFGAKVLHPATMEPALRQNIKVFVGSSKEPEKGGTWIVRDCEHEP
SYRAITRRKDQVMVTVKTPKMMYAQGFLQNVFTIIAKHNLSVDLVTTSEICVSFTLDNPP
NSVLQRLNRETIEELSQICEVELEEHFDLVTVVGNNMHSAAGVSSRIFAAVSDFNLRMIC
FGANVHNMSMLVSEKDSSNVVKALHKSLFEAE
>Cpsy_Aa_|_CG-21
MNSVQSTSSLTVAKFGGTSVADYQAMLRCANIIKNDNSNRLVVVSASSGVTNLLVRLSQK
NVSVIEQKDIVENIRAIQVNITQHLSSDVEAQLNQEINSLLDELTQHALTQLLQYSTKTA
DAILAFGEQFSSRIFAQVLQSVDIPGEYFNVQQVMKTNSLYGKAVVDLNQLSEQSTQLLA
PKLIDKVIVTQGFIGQDSQGHTTTLGRGGSDYSAALLAEALNGTNLSIWTDVVGIFTTDP
RITDQARAIKEISFGEAAEMATFGAKILHPATLIPAMRRNIPVFVGSSKEPEKGGTQIKQ
KVDSNPTYRSIALRREQTLVTVKSPAMLHASGFLAKVFGVLAKHELSIDLITTSEISVAL
TFDNPSGSTQSLITNAVVAELEQLCEVSVEHGLSLVAVIGNGLTCAKGIGQSIFETINDV
NIRLICHGASANNLCFLVNEDEANYVVEKLHNTLFA
>Phal_Ab_|_CG-21
MGLNPQNCHQYRWRASGSEFSYLIFAAKFFLFYYGLDAVKGDEMTTQSVPHVVLGNKSNY
TVAKFGGTSVANFAAMDHSSKIIVADKSVRIVALSASAGVTNHLVELCNSSLSEDERQAH
INGVLAIQQAILAELSLDTDLEQGFAQTLAAFEKLASQTLQTKALHDELLSFGERLSTYL
FTQVLRSKGLNAIRFDVRQVLKTDSQFGKATPNVAATAQAASALLIPLLDDQVIVTQGFI
GSDEHGQTTTLGRGGSDYSAALLAEAIHAKSVHIWTDVVGIFSTDPRLCVKATPIARLSF
DEAAEMATFGAKVLHPATILPASRSHINVFVGSSREPERGGTWIEREKSQLPGIRAVTQR
KNQILLTLKSPEMLLASGFLARVFTILSEFNISVDLVTTSEISVAITLDNAPNASRPELD
QGCLDKLAEFCHVSVENNLTLVALIGSEIQLRQHEMNLMQVLSDFNIRLICHGASKHNLC
FLVEQGESDNVVQAIHSRLLESDCAA
>Iloi_Aa_|_CG-21
MTFTVAKFGGTSVADYASMLRCAEIIQSNSSIRLVVVSACAGVTNRLVAIADLQGRQIEK
LLNEIYEIHFAIQKRLKNASQVQKSLEQLHHKLALHCQKTTEDQASWRDELLSFGERCSS
LLFSSLLVEQGLCSSTLDARQLLKTNSDFGRAQPDEVTTKSHCLEQKQKLESGCVRVTQG
FIGSDENNQTTTLGRGGSDYSAALLAAGFNATDLQIWTDVAGIYTTDPRICPSARAIAEM
SFSEAAELATFGAKILHPSSLAPAIKNDIRVFIGNSQDALSGGTYISASPTSRPDVRAIA
LRRDQTLVTVHSLNMLHASGFLARLFEILARYNVSVDLVTTSEVSIALTLDEGGSAANGQ
ALLPAAALEELEQFCRVEVETGLSLVAIIGNGIGRDAHISQLTFNTVNDYAVRLICQGAS
EHNLCFLVADNEGENVIRTLHDRILR
>Ppro_Bc_|_CG-21
MSLVDSYVNPYTSLTVAKFGGTSVADFTAMSRSAAIILHAPQTRLVLISACSGVTNILVE
LANGVTDTQQRHALLTRLTDIHQSVLSQLKQPQQADEAITLLLKNVAELAKKAAIEKSVA
LTDQLVSHGELLSTHLFAQILRELGIKAIRFDIRDVMRTDGQFGKAIPQPSIIRQLSEQH
LLPQLKKHVVVSQGFIGSDEQGNTTTLGRGGSDYSAALMAEAIGASTLEIWTDVPGMYTT
DPRIATKAKPIKEISFSEASEMANFGAKILHPSTLVPAIRQQIPVFIGSSKAPEQGGTWI
RETVSDAPLFRALALRCNQTMVTLTSLNMFHAYGFLAEVFRILAEHKISVDLITTSEVSV
SLTLDQTDTSGGAPTLPAQALAELSELCRVEVEQDLCLVALIGNQMSSTKGSAKTVFSTL
EYYNLRMICYGASPHNLCFLVKAQDAKSAIKDLHCAIFE
>Vfis_Ab_|_CG-21
MNPINVAKFGGTSVANFEAMTKSASVIEQNPNTHLVVISACSGVTNLLVELANGVQDNHR
KKAILEGLKTIHFSVLDQLADPLIPEQAILDILDDIEKTAETAASQSNDKLTDHLVSCGE
LMSTHLFTQLLIERGNPAVRFDIRTVLRTDSRFGKGEPQLNDISRLAQKKLTPLCQQQIV
VTQGFIGSDSEGNTTTLGRGGSDYSAALIAESVDACGLEIWTDVPGIYTTDPRIAPKASP
IPEISFSEASEMANYGAKILHPSTLLPALRHQIPVFVGSSKEPEKGGTWIKEKVDSTPLF
RALTLRCNQTMVTLHSPSMFHAYGFLAEVFKILAKYQISVDLITTSEVSVALTLDQTNTN
GKAPELPLEAQQELEELCTVEVEHNLCLIALIGNKMSHSKGSAKQVFGTLEEFNLRMICY
GASQHNLCFLLHESESKQAVKILHKELFEQ
>Vcho_Fb_|_CG-21
MLYKKHSLHNIGRWVTNNSFFRKSGRIAVSTFNVAKFGGTSVANFEAMSRCSAIIENNPQ
TRLVVSSACSGVTNLLVELANGVASTERRQAILQQLADIHYVIIDQLADPTRVEKEVKAV
LDSVASAAEAASFQSSKKLTDHLVACGELISTYILTQLMRERGVDAVRFDIREVLRTDDH
YGRAEPQLKEIAQLAKEKLVPLCEQYVVVTQGFIGSDAQGNTTTLGRGGSDYSAALIAEA
VQASGLEIWTDVPGIYSTDPRIAPKAAPIPEISFSEASEMANFGAKILHPSTLLPAVRHG
IPVFVGSSKEPEKGGTWIRKQVESAPLYRALALRCNQTMVTLRSAQMFHAYGFLAKVFEI
LAKHKISVDLITTSEISVSLTLDKTDTSGGAPELPEAVRAELEELCTVEVEYNLCLIALI
GNKMKESRGYAKQVFSVLEDYNLRMICYGASAHNLCFLLHESVSKQAVQKLHKELFEQE
>Vpar_Ab_|_CG-21
MSAFNVAKFGGTSVANFEAMSRCATIIENNPNTRLVVSSACSGVTNILVELANGVQDQEH
RAELLKNLAEIHDSILAQLEDATEASSEVYGILDTVTSLAEAASIQANTKLTDHLVACGE
LMSTHILAQLMRERGINAVRFDIREVLRTDDNFGRAEPNVEAIAQLAQEKLIPLCLDSVV
ITQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAPKASP
IPEISFSEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHQVESSPLF
RALALRCNQTMVTLRSANMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDQTDTS
GGAPQLPQAAREELEELCKVEVEHDLCLVALIGNKMSERKGYAKQVFGTLEDLNLRMICY
GASPHNLCFLVNESVAKQAIQKLHTELFEQ
>Vvul_Ac_|_CG-21
MSALNVAKFGGTSVANFEAMSRCSAIIENNPETRLVVSSACSGVTNLLVELANGVQSQER
RAELLAQLAEIHDAILNQLEDATEAAAEVYAILDTITSLAEAASIQASNKLTDHLVACGE
LMSTHILAQLMRERGVNAVRFDIREVLRTDDNFGRAEPDVAKIAELAQEKLLPLCRDYVV
VTQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAAKAAP
IPEISFAEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHEAQSSPLF
RALALRCNQTMVTLRSAKMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDKTDTS
GGAPELPQAAREELEELCTVEVEHNLCLVALIGNHMETKGYAKEVFSTLGDFNLRMICYG
ASDHNLCFLVDAHDSKSVIQKLHQDLFER
>Sden_Aa_|_CG-21
MSLVVAKFGGTSVACHYSMVRCAQIVINSPMTRLVVVSASSGVTNCLVELTQSNINDQQR
QTLLTEIAKIQYGICDGLSRRAEVLSNIDVILSRIAELSDALVLNRSKALMDELLATGEQ
CSALLFAAVLREQGANAQAFDVRQVLRTDNHFGRAEPQIAFIADLAQTQLAPLLQSQVIV
TQGFVGADVDGNTTTLGRGGSDYSAALLAEALQASAVEIWTDVAGIYTTDPRLAPNARPL
KEISFNEAAEMATFGAKVLHPATILPAVRQQINVFVGSSKAPEEGGTWIRHQTEDSPVFR
AVTLRKDQTLLNLHSLQMLHTQGFLAETFATLAKHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLTEALLADLSEHCRVKVEDQLALVAIIGNKIASTAGICARVFNVLVDFNVRMICQ
GASPHNLCVLVSAADASAVVQALHSDLFE
>Sloi_Aa_|_CG-21
MSIVVAKFGGTSVADYEAMNRCADIVLANPETRVVVVSASSGVTNLLVELTQEHVDFERR
QQLLKAIASIQYKILDELGQPHDVAARLDAILSKIASLSESLSQNRNKATTDELLAQGEQ
CSSVLFAAVLREKGERASAFDVRQVMRTDSHFGRAEPQIEAVKQLCTEHLLPLLSEQRIV
TQGFIGADEQGATTTLGRGGSDYSAALLAEALDASAVEIWTDVPGIFTTDPRLAPNARPI
PEISFNEAAEMATFGAKVLHPATILPAVRHKIQVFVGSSKAPELGGTWIRHQVNDEPIYR
AVAVRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
AGNSLLSEALLQELSQHCRVRVEDGLALVAIVGNKIATTSGVCRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVSALHQNLFEGSL
>Sama_Ab_|_CG-21
MSLVVAKFGGTSVADFNAMSRCAAIVLANSATRLVVVSASSGVTNLLVELTQATVTDERR
LQLLKQIAQIQYAILDKLERPQDVAAALDALLSRISVLSESLILNRSKAIMDELLSMGEQ
CSALLFSAVLRQQGAKSSSFDVRQVMRTDSHFGRAEPQIEDIAALARDFLQPLLERDIVV
TQGFIGADAEGRTTTLGRGGSDYSAALLAEALRADAVEIWTDVAGIYTTDPRLAPNARPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSREPEKGGTWIRHQVDNPPIYR
AVAVRRDQTLLNLHSLQMLHARGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
TGSGLLSEALLQELSQHCRVRVEDNLALVAIIGNRIASTPGICRQVFTVLENHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFEGQA
>Sfri_Ab_|_CG-21
MSFVQSEIDTPELVVAKFGGTSVADYASMSRCADIVLANQATRLVVVSASSGVTNLLVEL
TQANVNDERRLVLLKQIAQIQYAILDELGRPQDVAASIDKILSRMSVLSESLELNRSKAV
MDELLSTGEQCSSILFSAVIREKGTASNHFDVRQVLRTDSHFGRAEPQIEAISTLAGDFL
QPLLARYVIVTQGFIGADEEGRTTTLGRGGSDYSAALLAEALRATAVEIWTDVAGIYTTD
PRLAPNARPIAEISFNEAAEMATFGAKVLHPATILPAVRQKIQVFVGSSKAPELGGTWIR
HQVEDTPVFRAVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVS
LTLDKTGSDSSGQGLLSESLLQELSQHCRVRVEENLALIAIIGNRIASTAGICSRVFKVL
ENHNVRMICQGASPHNLCVLVAESEAAQVVNALHQNLFE
>Sbal_Ab_|_CG-21
MSLVVAKFGGTSVADYNAMNRCADIVLANPHCRLVVVSASSGVTNLLVELTQESINDDGR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMSVLSDALASQRSKATMDELLSLGEQ
CSSALFSAVIREKGVNSSAFDVRRVLRTDSHFGRAEPQVEQIATLARDYLQPLLAEQVIV
TQGFIGADEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAFPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVTESEAAQVVKSLHQNLFEGA
>Sput_Ab_|_CG-21
MSLVVAKFGGTSVADYGAMNRCADIVLANPDCRLVVVSASSGVTNLLVELTQEAITDDAR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMALLSEALVSVRSKATIDELLSLGEQ
CSSALFSAVLREKGASSSAFDVRKVLRTDSHFGRAEPQVEQIALLSYEHLLPLLSEQVIV
TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAHPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFETA
>Sone_Ab_|_CG-21
MSLVVAKFGGTSVADYGAMNRCAEIVLGNPDCRLVVVSASSGVTNLLVELTQESINDDGR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALVSARSKATMDELLSLGEQ
CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIALLSREHLLPLLSEQVIV
TQGFIGADEAGQTTTLGRGGSDYSAALLAEALTASAVEIWTDVAGIYTTDPRLAPNAHPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFEGA
>SHEW-3b_|_CG-21
MSLVVAKFGGTSVADYGAMNRCADIVLGNPDCRLVVVSASSGVTNLLVELTQESMNDDGR
LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALASQRSKATMDELLSLGEQ
CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIAILSREHLLPLLSEQVIV
TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALKASAVEIWTDVAGIYTTDPRLAPNAHPI
AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
GASPHNLCVLVAESEAAQVVKALHENLFEGA
>Hduc_Aa_|_CG-21
MSHFSVAKFGGTSVADFNAMNACANIVVKDNHTRVVVLSASAGITNYLVELANGCAPLRR
VEILQNVRSVQYNIIQQLQQPEAISAEIDRLLQHISVLAESASVTTSATLTDELIAHGEL
MSSKIFTQLLIEREIPAIWVDVRDVIATNSHHGKATPDDKKTQQQADAIVKPLLEANKII
ITQGFIARDQQGNTTTLGRGGSDYSAALLAEVLSAKDVLIWTDVPGIYTTDPRIVPNAQR
IATIAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPTCRPIF
RAIALRRNQTLVTLSSLAMLHAQEFLASVFSILAKYQVSVDIITTSEVSITLTLDKTDST
ASTAQILSDALVHELSQFCHIKIENDLSLLAIIGNDLHLQQGIAKELFQTIEPFNIRLIN
YGASTNNIYMLVKNSDADHILLALHYDLFES
>Aple_Aa_|_CG-21
MSHLSVAKFGGTSVANFDAMTSCANIVTSDANTRVVVLSASAGVTNYLVELANGCEKERR
EEILDAVRTIQYNIIEKLQNQSEVSAEIDELLQHIAALAESASLATSNALTDELICHGEM
MSTKIFTQLLKERNFPAVWVDVRDIVATNSNYGKAAPNDEKTQQQSDAIIKPLIAAGNVV
ITQGFIGRDDEGKTTTLGRGGSDYSAALLAEVLNANDVLIWTDVPGIYTTDPRVVPNAQR
IDTMAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
RAIALRRNQTLLTLSSLSMLHAQGFLANVFAILAKHKISVDVITTSEVSVALTLDKTGSA
SSGADMLSKELLDELNAYCHVQVEHDLALIAIIGNNLHTQAGVAKQLFHTIENFNIRLIS
YGASTNNVCTLIKNDEADEVVRALHAGLFE
>Msuc_Aa_|_CG-21
MANLSVAKFGGTSVANYAAMTACAKIVIADPNTRVVVLSASAGVTNLLVALANGCEATQR
AKLLAEVRQIQENILNELKDAGTVRLEIEELLTNIEYLAEAASLATSSALTDELISHGEM
MSTKIFVQVLRELNAQATWVDVRTVVATNSNFGKAAPDDEQTQKNSDNVLKPLIDRGELV
ITQGFIGRDPNGKTTTLGRGGSDYSAALIAEVLNAKDVLIWTDVAGIYSTDPRIVPNAQR
IDTMSFAEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
RAIALRRDQTLLTLSSLNMLHAQGFLANVFNILAKHKISVDTITTSEVSVALTLDKTGSA
SSGAELLSSDLLNELSEVCTVKVDTGLALVALIGNDLHLSAGIAKRIFGTIEEYNIRMIS
YGASTNNICTLVHSAHADDVVRALHKELFE
>Pmul_Aa_|_CG-21
MSHLSIAKFGGTSVANYAAMSASAKIVVNDPNTRVVVLSASAGVTNLLVALANGCDNEER
TKLINEVRQIQENILSELKDDSLVRNKVEKLLANIESLAEAASLATSPALTDELISHGEM
MSSLIFVEILREFNTPSTWIDVRNIIATDSHFGKAVPNDHKTQENSTHILKPLIDRGELI
ITQGFIGRDEQGKTTTLGRGGSDYSAALLAEVLNAEDVLIWTDVAGIYTTDPRIVPNAKR
IDTMSFSEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEAGGTWVTRDPQHRPIF
RAIALRRDQTLLTLSSLNMLHAQGFLANVFTILAKHKISVDVVTTSEVSIALTLDKTGSA
SSGLSLLSSALIDELSQLCSVKVDSDLALVALIGNDLHITSGIAKRIFDTLAPYNIRSIS
YGASTNNVCLLVTNAHADAVVSALHKNLFE
>Ahyd_Ab_|_CG-21
MSPINVAKFGGTSVANAAAMNNCAEVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
QEAQLARLTEIQQAILTELGDPGDLSDLIHGQLGEIRTMARQAHLHTDAELADRLIACGE
LMSTRLFTELLRQRGVKACWQDARQLLRTDSRFGKASVDLAATRALCQAALGPLLGDSLI
ITQGFIGADGDGRTTTLGRGGSDYSAALLAEALDAGTIEIWTDVPGIYTTDPRLVTRARP
IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTRTNPLF
RAVALRRNQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
SNGEPILGDKVLAELGQLCKVQVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
YGASAHNLCFLVKEDEAGHIVNRLHQELLD
>Asal_Ab_|_CG-21
MSPMNVAKFGGTSVANAAAMNNCANVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
QEAQLAKLAEIQQAILTALGDPADVSTLIHATLGEIRTMARQASQHTDAELADRLIACGE
LMSTRLFTELLHQRGIKAHWQDVRQLMRTDSRFGKATVDLGATRGLCQQALGPLLGDSLI
ITQGFIGSDADGRTTTLGRGGSDYSAALLAEALDAGSIEIWTDVPGIYTTDPRLVTRARP
IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTSTNPLF
RAVALRRQQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
SNGEPVLSDKVLAELGQLCKVKVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
YGASAHNLCFLVKEEEAGHIVNRLHQELLD
>Plum_Aa_|_CG-21
MSAVSSQCPEIGGHVVAKFGGTSVANFDAMNNSADIVLANKAVRVVVLSASAGITNLLVA
LAAGCDADKRADYLKQIHSIQYAIIDRLHESDTIRQEIDRLLENIKTLAKAASLATSAAL
TDELVSHGELMSTRLFTELLRQRGKDAEWFDIRKVMYTDESFGRAEPNYEQLQSLATEHL
LPQLKNSLIVTQGFIGREENGRTTTLGRGGSDYTAALLGEALGLKRVDIWTDVPGIYTTD
PRVVPAAQRIDKIAFDEAAEMATFGAKILHPATLFPAIRCGIPVFVGSSKNPQAGGTLVC
DTTEAPPQFRAIALRQKQTLLTLHSLKMLHAQGFLAEIFTILSRHNISVDLITTSEVNVA
LTLDTTGSTSTNGSLLTNALMTELSTLCRVEVEEDLALVAIIGNQLSQTNGLGKKVFSVL
EKFNLRMISHGASNHNLCLLVQGKDAEQIVQTLHQRLFE
>Sglo_Aa_|_CG-21
MSNNSAVPLRVAKFGGTSVADFDAMDRSADIVLANPSVRLVVLSASAGVTNVLVTLSEGN
EAERRAYYLDEIRRIQYSIIDRLAEQTVIREEIDRMIDNIAMLAEAAGLATSLALTDELV
SHGELMSTLLFVEVLRQRGVPAAWFDVRKVMRTNDQFGRAEPDSHALKAQARTLLLPRLE
TELVITQGFIGSEAKERTTTLGRGGSDYTAALLGEALEAGRIDIWTDVPGIYTTDPRVVP
TAKRIDEISFEEAAEMATFGAKILHPATLLPAVRSAIPVFVGSSKDPGAGGTLVYNHTDN
PPLFSALALRRRQTLLTLHSLNMLHARGFLAEVFNILARHAISVDPITTSEVSVALTMDT
TGSTTTCASLLTQALLTELSSLCRVEVEEDLALVALIGNKLSQACGVGKEVFGVLDPFNI
RLICYGASSHNLCLLVPGHDAEQVVRTLHSALFD
>Patr_Aa_|_CG-21
MSATEVSANANATVIAKFGGTSVADFDAMNRSADVVLSNPNVRVVVLSASAGITNLLVAL
AEGQTQETRAEHLAKIRQIQYAIIDRLTNQSVIRDEIDRMLDSVTTLSEAAALATSNALT
DELVSHGELMSTLLFVEILRQRDVIAEWFDVRKIMRTDDHFGRAQPDCDVLGELTRSLLQ
PRLEQGLVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALNVNRIDIWTDVPGIYTTDP
RVVPTAKRIDQIMFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPAAGGTLVCN
KTENPPLFRALALRRKQTLLTLHSLNMLHTRGFLAEVFSILARHNISVDLITTSEVNVAL
TLDTTGSTSTGGSLLSSALLTELSSLCRVEVEENLSLVALIGNKLSQACGVGKEVFGVLE
PFRIRLICYGASSNNLCFLVPGDDAERVVQTLHRSLFE
>Ypes_Aa_|_CG-21
MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
VALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPMFVGSSKDPAAGGTL
VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
>Ypse_Aa_|_CG-21
MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
VALADGSEPEKRADHLEEIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPVFVGSSKDPAAGGTL
VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
>ENTE-2a_|_CG-21
MTSFVVAKFGGTSVADYAAMNRSADVVLADPDTRLVVLSASAGVTNLLVALSEGLEATER
FVKLDALRKIQFDILERMQNPHVIREEIERLLENITTLAEAASLATSTALTDELVSHGEL
MSTLLFVEILRERDVMAQWFDVRKVMRTSDRFGRAEPDVATLSELSKQQLAPRLAEGIVI
TQGFIGSEAKGRTTTLGRGGSDYTAALLGEALYATRVDIWTDVPGIYTTDPRVVPAAKRI
DVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPKAGGTLVCKNTVNPPLFR
ALAMRRKQTLVTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSIALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEDLALVAIIGNKLSRACGVGKEVFGVLDPFNIRMICY
GASSYNLCFLVPGHEAEQVVQKLHHNLFE
>Sent_Na_|_CG-21
MTEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGMEPGER
FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGDDAEKVVQKLHQNLFE
>Styp_Aa_|_CG-21
MTEIVVSKFGGTSVADFDAMNRSADIVLSDTNVRLVVLSASAGITNLLVALAEGMEPGER
FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGDDAEKVVQKLHQNLFE
>Sdys_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPSER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLTEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPTVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TDDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHFNLFE
>Sboy_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNDGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Ecol_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Sfle_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
>Sson_Aa_|_CG-21
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3