[Bio] / FigWebPages / ask_CG21.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG21.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Ftul_Aa_|_CG-21
2 :     MSEIIVAKFGGTSVANQQAIRQCANIVNSDNRIKLVVVSAQSGITNLLIQLANNKDNSKI
3 :     QEIIGQIESIVNPISQSINSESVTTSVSNMIAELRMFANMAAYFSGKQLSDSILAFGEII
4 :     SSFLVANIFNQKGINAYHLDSRKILKTNSHFGCASPDLSALATNAIEHILPKIREGYVCV
5 :     LGGFIGSDAHGNTTTLGRGCGDYSAALYTQAIKASQLKIYTDVTGIYQIDPRVIPRAISL
6 :     SKLGFSEAAELATFGAKVVHPKTFGPAISSNFDIYIGSTFQPELGGTLITQKIDYDRNII
7 :     AVAERKAQTLLTIKSFNMFGSQGFLVKVFSILANHNIAVDLVSTSEVSVAITLDKLGSHS
8 :     MGDDLVTPELLKDLESIGNVNIKVENDLSLVSVVGSNLHQINGVSGELFNSLKDYNIRLF
9 :     SHGASENSICMLVASKDAQKVVNNIYGSFFS
10 :     >Bbac_Ab_|_CG-21
11 :     MAKLVVSKFGGTSMGDADCMLRSAEVSFRQGSGLVVVSATSGTTNDLIALGKTAESQAWS
12 :     ESEKILSKIQDKHNKIAQDLKLPADAKAKLETLFEEMSSLAKGMHLLKDCSVKAMDTLMS
13 :     LGERMSSVLFTEAMSQVLKKHGSAKSAELLDVRTVLRTDDQFGKAKPLTNDVANLCQKNL
14 :     SFLREGKKVMCTQGYIGMTEEGITTTLGRGGSDYSAAILAEGVSADVLEIWTDVAGIATT
15 :     DPRLCPKAQPISEISFKEASELATFGAKVLHPATLLPAIRKNIPVFVGSSFDVEARGTWV
16 :     RMDVEDHPLIRAMALRKKQVLVTLSTPEMLYAHGFLFQIFKIFNDHKVSIDAITTSEISV
17 :     SVTLDDSTLLNKNLIKDLSQIADVQVEENLALISLIGNNINHTPGLGKRIFETIPDINVR
18 :     MICLGASKHNFCFLVADEQGPEVIKRLHACFIEAGIEEMA
19 :     >Patl_Aa_|_CG-21
20 :     MSDSSINVAKFGGTSVATYATMLNCAKVVKGNPATKVVVVSASAGVTNILVELAHKALTK
21 :     DEISAYIEQIQAIEFAILNDLGAPTLVADKLLELLESLKQLAFHEEILHRPDLKDSLLSH
22 :     GERMASLLFSEVLTQQGLPADNFDVRNVLLTDSEFGQAAPQLDGIKQRAAKLMAPEIAKT
23 :     VLVTQGFIGSDEAGNTTTLGRGGSDFTAALLAEALGAQSCEIWTDVIGVYTTDPRITDAA
24 :     RPLPELSFEEAAEMATFGAKVLHPATMEPALRQNIKVFVGSSKEPEKGGTWIVRDCEHEP
25 :     SYRAITRRKDQVMVTVKTPKMMYAQGFLQNVFTIIAKHNLSVDLVTTSEICVSFTLDNPP
26 :     NSVLQRLNRETIEELSQICEVELEEHFDLVTVVGNNMHSAAGVSSRIFAAVSDFNLRMIC
27 :     FGANVHNMSMLVSEKDSSNVVKALHKSLFEAE
28 :     >Cpsy_Aa_|_CG-21
29 :     MNSVQSTSSLTVAKFGGTSVADYQAMLRCANIIKNDNSNRLVVVSASSGVTNLLVRLSQK
30 :     NVSVIEQKDIVENIRAIQVNITQHLSSDVEAQLNQEINSLLDELTQHALTQLLQYSTKTA
31 :     DAILAFGEQFSSRIFAQVLQSVDIPGEYFNVQQVMKTNSLYGKAVVDLNQLSEQSTQLLA
32 :     PKLIDKVIVTQGFIGQDSQGHTTTLGRGGSDYSAALLAEALNGTNLSIWTDVVGIFTTDP
33 :     RITDQARAIKEISFGEAAEMATFGAKILHPATLIPAMRRNIPVFVGSSKEPEKGGTQIKQ
34 :     KVDSNPTYRSIALRREQTLVTVKSPAMLHASGFLAKVFGVLAKHELSIDLITTSEISVAL
35 :     TFDNPSGSTQSLITNAVVAELEQLCEVSVEHGLSLVAVIGNGLTCAKGIGQSIFETINDV
36 :     NIRLICHGASANNLCFLVNEDEANYVVEKLHNTLFA
37 :     >Phal_Ab_|_CG-21
38 :     MGLNPQNCHQYRWRASGSEFSYLIFAAKFFLFYYGLDAVKGDEMTTQSVPHVVLGNKSNY
39 :     TVAKFGGTSVANFAAMDHSSKIIVADKSVRIVALSASAGVTNHLVELCNSSLSEDERQAH
40 :     INGVLAIQQAILAELSLDTDLEQGFAQTLAAFEKLASQTLQTKALHDELLSFGERLSTYL
41 :     FTQVLRSKGLNAIRFDVRQVLKTDSQFGKATPNVAATAQAASALLIPLLDDQVIVTQGFI
42 :     GSDEHGQTTTLGRGGSDYSAALLAEAIHAKSVHIWTDVVGIFSTDPRLCVKATPIARLSF
43 :     DEAAEMATFGAKVLHPATILPASRSHINVFVGSSREPERGGTWIEREKSQLPGIRAVTQR
44 :     KNQILLTLKSPEMLLASGFLARVFTILSEFNISVDLVTTSEISVAITLDNAPNASRPELD
45 :     QGCLDKLAEFCHVSVENNLTLVALIGSEIQLRQHEMNLMQVLSDFNIRLICHGASKHNLC
46 :     FLVEQGESDNVVQAIHSRLLESDCAA
47 :     >Iloi_Aa_|_CG-21
48 :     MTFTVAKFGGTSVADYASMLRCAEIIQSNSSIRLVVVSACAGVTNRLVAIADLQGRQIEK
49 :     LLNEIYEIHFAIQKRLKNASQVQKSLEQLHHKLALHCQKTTEDQASWRDELLSFGERCSS
50 :     LLFSSLLVEQGLCSSTLDARQLLKTNSDFGRAQPDEVTTKSHCLEQKQKLESGCVRVTQG
51 :     FIGSDENNQTTTLGRGGSDYSAALLAAGFNATDLQIWTDVAGIYTTDPRICPSARAIAEM
52 :     SFSEAAELATFGAKILHPSSLAPAIKNDIRVFIGNSQDALSGGTYISASPTSRPDVRAIA
53 :     LRRDQTLVTVHSLNMLHASGFLARLFEILARYNVSVDLVTTSEVSIALTLDEGGSAANGQ
54 :     ALLPAAALEELEQFCRVEVETGLSLVAIIGNGIGRDAHISQLTFNTVNDYAVRLICQGAS
55 :     EHNLCFLVADNEGENVIRTLHDRILR
56 :     >Ppro_Bc_|_CG-21
57 :     MSLVDSYVNPYTSLTVAKFGGTSVADFTAMSRSAAIILHAPQTRLVLISACSGVTNILVE
58 :     LANGVTDTQQRHALLTRLTDIHQSVLSQLKQPQQADEAITLLLKNVAELAKKAAIEKSVA
59 :     LTDQLVSHGELLSTHLFAQILRELGIKAIRFDIRDVMRTDGQFGKAIPQPSIIRQLSEQH
60 :     LLPQLKKHVVVSQGFIGSDEQGNTTTLGRGGSDYSAALMAEAIGASTLEIWTDVPGMYTT
61 :     DPRIATKAKPIKEISFSEASEMANFGAKILHPSTLVPAIRQQIPVFIGSSKAPEQGGTWI
62 :     RETVSDAPLFRALALRCNQTMVTLTSLNMFHAYGFLAEVFRILAEHKISVDLITTSEVSV
63 :     SLTLDQTDTSGGAPTLPAQALAELSELCRVEVEQDLCLVALIGNQMSSTKGSAKTVFSTL
64 :     EYYNLRMICYGASPHNLCFLVKAQDAKSAIKDLHCAIFE
65 :     >Vfis_Ab_|_CG-21
66 :     MNPINVAKFGGTSVANFEAMTKSASVIEQNPNTHLVVISACSGVTNLLVELANGVQDNHR
67 :     KKAILEGLKTIHFSVLDQLADPLIPEQAILDILDDIEKTAETAASQSNDKLTDHLVSCGE
68 :     LMSTHLFTQLLIERGNPAVRFDIRTVLRTDSRFGKGEPQLNDISRLAQKKLTPLCQQQIV
69 :     VTQGFIGSDSEGNTTTLGRGGSDYSAALIAESVDACGLEIWTDVPGIYTTDPRIAPKASP
70 :     IPEISFSEASEMANYGAKILHPSTLLPALRHQIPVFVGSSKEPEKGGTWIKEKVDSTPLF
71 :     RALTLRCNQTMVTLHSPSMFHAYGFLAEVFKILAKYQISVDLITTSEVSVALTLDQTNTN
72 :     GKAPELPLEAQQELEELCTVEVEHNLCLIALIGNKMSHSKGSAKQVFGTLEEFNLRMICY
73 :     GASQHNLCFLLHESESKQAVKILHKELFEQ
74 :     >Vcho_Fb_|_CG-21
75 :     MLYKKHSLHNIGRWVTNNSFFRKSGRIAVSTFNVAKFGGTSVANFEAMSRCSAIIENNPQ
76 :     TRLVVSSACSGVTNLLVELANGVASTERRQAILQQLADIHYVIIDQLADPTRVEKEVKAV
77 :     LDSVASAAEAASFQSSKKLTDHLVACGELISTYILTQLMRERGVDAVRFDIREVLRTDDH
78 :     YGRAEPQLKEIAQLAKEKLVPLCEQYVVVTQGFIGSDAQGNTTTLGRGGSDYSAALIAEA
79 :     VQASGLEIWTDVPGIYSTDPRIAPKAAPIPEISFSEASEMANFGAKILHPSTLLPAVRHG
80 :     IPVFVGSSKEPEKGGTWIRKQVESAPLYRALALRCNQTMVTLRSAQMFHAYGFLAKVFEI
81 :     LAKHKISVDLITTSEISVSLTLDKTDTSGGAPELPEAVRAELEELCTVEVEYNLCLIALI
82 :     GNKMKESRGYAKQVFSVLEDYNLRMICYGASAHNLCFLLHESVSKQAVQKLHKELFEQE
83 :     >Vpar_Ab_|_CG-21
84 :     MSAFNVAKFGGTSVANFEAMSRCATIIENNPNTRLVVSSACSGVTNILVELANGVQDQEH
85 :     RAELLKNLAEIHDSILAQLEDATEASSEVYGILDTVTSLAEAASIQANTKLTDHLVACGE
86 :     LMSTHILAQLMRERGINAVRFDIREVLRTDDNFGRAEPNVEAIAQLAQEKLIPLCLDSVV
87 :     ITQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAPKASP
88 :     IPEISFSEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHQVESSPLF
89 :     RALALRCNQTMVTLRSANMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDQTDTS
90 :     GGAPQLPQAAREELEELCKVEVEHDLCLVALIGNKMSERKGYAKQVFGTLEDLNLRMICY
91 :     GASPHNLCFLVNESVAKQAIQKLHTELFEQ
92 :     >Vvul_Ac_|_CG-21
93 :     MSALNVAKFGGTSVANFEAMSRCSAIIENNPETRLVVSSACSGVTNLLVELANGVQSQER
94 :     RAELLAQLAEIHDAILNQLEDATEAAAEVYAILDTITSLAEAASIQASNKLTDHLVACGE
95 :     LMSTHILAQLMRERGVNAVRFDIREVLRTDDNFGRAEPDVAKIAELAQEKLLPLCRDYVV
96 :     VTQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWTDVPGIYTTDPRIAAKAAP
97 :     IPEISFAEASEMANFGAKILHPSTLVPALRHDIPVFVGSSKEPEKGGTWIRHEAQSSPLF
98 :     RALALRCNQTMVTLRSAKMFHAYGFLAKVFEILAKHKISVDLITTSEISVSLTLDKTDTS
99 :     GGAPELPQAAREELEELCTVEVEHNLCLVALIGNHMETKGYAKEVFSTLGDFNLRMICYG
100 :     ASDHNLCFLVDAHDSKSVIQKLHQDLFER
101 :     >Sden_Aa_|_CG-21
102 :     MSLVVAKFGGTSVACHYSMVRCAQIVINSPMTRLVVVSASSGVTNCLVELTQSNINDQQR
103 :     QTLLTEIAKIQYGICDGLSRRAEVLSNIDVILSRIAELSDALVLNRSKALMDELLATGEQ
104 :     CSALLFAAVLREQGANAQAFDVRQVLRTDNHFGRAEPQIAFIADLAQTQLAPLLQSQVIV
105 :     TQGFVGADVDGNTTTLGRGGSDYSAALLAEALQASAVEIWTDVAGIYTTDPRLAPNARPL
106 :     KEISFNEAAEMATFGAKVLHPATILPAVRQQINVFVGSSKAPEEGGTWIRHQTEDSPVFR
107 :     AVTLRKDQTLLNLHSLQMLHTQGFLAETFATLAKHKISVDLITTSEVNVSLTLDKTGSDS
108 :     SGQGLLTEALLADLSEHCRVKVEDQLALVAIIGNKIASTAGICARVFNVLVDFNVRMICQ
109 :     GASPHNLCVLVSAADASAVVQALHSDLFE
110 :     >Sloi_Aa_|_CG-21
111 :     MSIVVAKFGGTSVADYEAMNRCADIVLANPETRVVVVSASSGVTNLLVELTQEHVDFERR
112 :     QQLLKAIASIQYKILDELGQPHDVAARLDAILSKIASLSESLSQNRNKATTDELLAQGEQ
113 :     CSSVLFAAVLREKGERASAFDVRQVMRTDSHFGRAEPQIEAVKQLCTEHLLPLLSEQRIV
114 :     TQGFIGADEQGATTTLGRGGSDYSAALLAEALDASAVEIWTDVPGIFTTDPRLAPNARPI
115 :     PEISFNEAAEMATFGAKVLHPATILPAVRHKIQVFVGSSKAPELGGTWIRHQVNDEPIYR
116 :     AVAVRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
117 :     AGNSLLSEALLQELSQHCRVRVEDGLALVAIVGNKIATTSGVCRRVFEVLEPHNVRMICQ
118 :     GASPHNLCVLVAESEAAQVVSALHQNLFEGSL
119 :     >Sama_Ab_|_CG-21
120 :     MSLVVAKFGGTSVADFNAMSRCAAIVLANSATRLVVVSASSGVTNLLVELTQATVTDERR
121 :     LQLLKQIAQIQYAILDKLERPQDVAAALDALLSRISVLSESLILNRSKAIMDELLSMGEQ
122 :     CSALLFSAVLRQQGAKSSSFDVRQVMRTDSHFGRAEPQIEDIAALARDFLQPLLERDIVV
123 :     TQGFIGADAEGRTTTLGRGGSDYSAALLAEALRADAVEIWTDVAGIYTTDPRLAPNARPI
124 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSREPEKGGTWIRHQVDNPPIYR
125 :     AVAVRRDQTLLNLHSLQMLHARGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
126 :     TGSGLLSEALLQELSQHCRVRVEDNLALVAIIGNRIASTPGICRQVFTVLENHNVRMICQ
127 :     GASPHNLCVLVAESEAAQVVKALHENLFEGQA
128 :     >Sfri_Ab_|_CG-21
129 :     MSFVQSEIDTPELVVAKFGGTSVADYASMSRCADIVLANQATRLVVVSASSGVTNLLVEL
130 :     TQANVNDERRLVLLKQIAQIQYAILDELGRPQDVAASIDKILSRMSVLSESLELNRSKAV
131 :     MDELLSTGEQCSSILFSAVIREKGTASNHFDVRQVLRTDSHFGRAEPQIEAISTLAGDFL
132 :     QPLLARYVIVTQGFIGADEEGRTTTLGRGGSDYSAALLAEALRATAVEIWTDVAGIYTTD
133 :     PRLAPNARPIAEISFNEAAEMATFGAKVLHPATILPAVRQKIQVFVGSSKAPELGGTWIR
134 :     HQVEDTPVFRAVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVS
135 :     LTLDKTGSDSSGQGLLSESLLQELSQHCRVRVEENLALIAIIGNRIASTAGICSRVFKVL
136 :     ENHNVRMICQGASPHNLCVLVAESEAAQVVNALHQNLFE
137 :     >Sbal_Ab_|_CG-21
138 :     MSLVVAKFGGTSVADYNAMNRCADIVLANPHCRLVVVSASSGVTNLLVELTQESINDDGR
139 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMSVLSDALASQRSKATMDELLSLGEQ
140 :     CSSALFSAVIREKGVNSSAFDVRRVLRTDSHFGRAEPQVEQIATLARDYLQPLLAEQVIV
141 :     TQGFIGADEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAFPI
142 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
143 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
144 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
145 :     GASPHNLCVLVTESEAAQVVKSLHQNLFEGA
146 :     >Sput_Ab_|_CG-21
147 :     MSLVVAKFGGTSVADYGAMNRCADIVLANPDCRLVVVSASSGVTNLLVELTQEAITDDAR
148 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMALLSEALVSVRSKATIDELLSLGEQ
149 :     CSSALFSAVLREKGASSSAFDVRKVLRTDSHFGRAEPQVEQIALLSYEHLLPLLSEQVIV
150 :     TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALRASAVEIWTDVAGIYTTDPRLAPNAHPI
151 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
152 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
153 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTPGICRRVFEVLEPHNVRMICQ
154 :     GASPHNLCVLVAESEAAQVVKALHENLFETA
155 :     >Sone_Ab_|_CG-21
156 :     MSLVVAKFGGTSVADYGAMNRCAEIVLGNPDCRLVVVSASSGVTNLLVELTQESINDDGR
157 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALVSARSKATMDELLSLGEQ
158 :     CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIALLSREHLLPLLSEQVIV
159 :     TQGFIGADEAGQTTTLGRGGSDYSAALLAEALTASAVEIWTDVAGIYTTDPRLAPNAHPI
160 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
161 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
162 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
163 :     GASPHNLCVLVAESEAAQVVKALHENLFEGA
164 :     >SHEW-3b_|_CG-21
165 :     MSLVVAKFGGTSVADYGAMNRCADIVLGNPDCRLVVVSASSGVTNLLVELTQESMNDDGR
166 :     LQRLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALASQRSKATMDELLSLGEQ
167 :     CSSALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIAILSREHLLPLLSEQVIV
168 :     TQGFIGSDEAGQTTTLGRGGSDYSAALLAEALKASAVEIWTDVAGIYTTDPRLAPNAHPI
169 :     AEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFR
170 :     AVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDS
171 :     SGQGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQ
172 :     GASPHNLCVLVAESEAAQVVKALHENLFEGA
173 :     >Hduc_Aa_|_CG-21
174 :     MSHFSVAKFGGTSVADFNAMNACANIVVKDNHTRVVVLSASAGITNYLVELANGCAPLRR
175 :     VEILQNVRSVQYNIIQQLQQPEAISAEIDRLLQHISVLAESASVTTSATLTDELIAHGEL
176 :     MSSKIFTQLLIEREIPAIWVDVRDVIATNSHHGKATPDDKKTQQQADAIVKPLLEANKII
177 :     ITQGFIARDQQGNTTTLGRGGSDYSAALLAEVLSAKDVLIWTDVPGIYTTDPRIVPNAQR
178 :     IATIAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPTCRPIF
179 :     RAIALRRNQTLVTLSSLAMLHAQEFLASVFSILAKYQVSVDIITTSEVSITLTLDKTDST
180 :     ASTAQILSDALVHELSQFCHIKIENDLSLLAIIGNDLHLQQGIAKELFQTIEPFNIRLIN
181 :     YGASTNNIYMLVKNSDADHILLALHYDLFES
182 :     >Aple_Aa_|_CG-21
183 :     MSHLSVAKFGGTSVANFDAMTSCANIVTSDANTRVVVLSASAGVTNYLVELANGCEKERR
184 :     EEILDAVRTIQYNIIEKLQNQSEVSAEIDELLQHIAALAESASLATSNALTDELICHGEM
185 :     MSTKIFTQLLKERNFPAVWVDVRDIVATNSNYGKAAPNDEKTQQQSDAIIKPLIAAGNVV
186 :     ITQGFIGRDDEGKTTTLGRGGSDYSAALLAEVLNANDVLIWTDVPGIYTTDPRVVPNAQR
187 :     IDTMAFNEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
188 :     RAIALRRNQTLLTLSSLSMLHAQGFLANVFAILAKHKISVDVITTSEVSVALTLDKTGSA
189 :     SSGADMLSKELLDELNAYCHVQVEHDLALIAIIGNNLHTQAGVAKQLFHTIENFNIRLIS
190 :     YGASTNNVCTLIKNDEADEVVRALHAGLFE
191 :     >Msuc_Aa_|_CG-21
192 :     MANLSVAKFGGTSVANYAAMTACAKIVIADPNTRVVVLSASAGVTNLLVALANGCEATQR
193 :     AKLLAEVRQIQENILNELKDAGTVRLEIEELLTNIEYLAEAASLATSSALTDELISHGEM
194 :     MSTKIFVQVLRELNAQATWVDVRTVVATNSNFGKAAPDDEQTQKNSDNVLKPLIDRGELV
195 :     ITQGFIGRDPNGKTTTLGRGGSDYSAALIAEVLNAKDVLIWTDVAGIYSTDPRIVPNAQR
196 :     IDTMSFAEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEQGGTWVTRDPQPRPTF
197 :     RAIALRRDQTLLTLSSLNMLHAQGFLANVFNILAKHKISVDTITTSEVSVALTLDKTGSA
198 :     SSGAELLSSDLLNELSEVCTVKVDTGLALVALIGNDLHLSAGIAKRIFGTIEEYNIRMIS
199 :     YGASTNNICTLVHSAHADDVVRALHKELFE
200 :     >Pmul_Aa_|_CG-21
201 :     MSHLSIAKFGGTSVANYAAMSASAKIVVNDPNTRVVVLSASAGVTNLLVALANGCDNEER
202 :     TKLINEVRQIQENILSELKDDSLVRNKVEKLLANIESLAEAASLATSPALTDELISHGEM
203 :     MSSLIFVEILREFNTPSTWIDVRNIIATDSHFGKAVPNDHKTQENSTHILKPLIDRGELI
204 :     ITQGFIGRDEQGKTTTLGRGGSDYSAALLAEVLNAEDVLIWTDVAGIYTTDPRIVPNAKR
205 :     IDTMSFSEAAEMATFGAKVLHPATLLPAVRSNIPVYVGSSKAPEAGGTWVTRDPQHRPIF
206 :     RAIALRRDQTLLTLSSLNMLHAQGFLANVFTILAKHKISVDVVTTSEVSIALTLDKTGSA
207 :     SSGLSLLSSALIDELSQLCSVKVDSDLALVALIGNDLHITSGIAKRIFDTLAPYNIRSIS
208 :     YGASTNNVCLLVTNAHADAVVSALHKNLFE
209 :     >Ahyd_Ab_|_CG-21
210 :     MSPINVAKFGGTSVANAAAMNNCAEVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
211 :     QEAQLARLTEIQQAILTELGDPGDLSDLIHGQLGEIRTMARQAHLHTDAELADRLIACGE
212 :     LMSTRLFTELLRQRGVKACWQDARQLLRTDSRFGKASVDLAATRALCQAALGPLLGDSLI
213 :     ITQGFIGADGDGRTTTLGRGGSDYSAALLAEALDAGTIEIWTDVPGIYTTDPRLVTRARP
214 :     IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTRTNPLF
215 :     RAVALRRNQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
216 :     SNGEPILGDKVLAELGQLCKVQVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
217 :     YGASAHNLCFLVKEDEAGHIVNRLHQELLD
218 :     >Asal_Ab_|_CG-21
219 :     MSPMNVAKFGGTSVANAAAMNNCANVVLANPATRVVVLSASAGVTNLLVALAQGDLDEAG
220 :     QEAQLAKLAEIQQAILTALGDPADVSTLIHATLGEIRTMARQASQHTDAELADRLIACGE
221 :     LMSTRLFTELLHQRGIKAHWQDVRQLMRTDSRFGKATVDLGATRGLCQQALGPLLGDSLI
222 :     ITQGFIGSDADGRTTTLGRGGSDYSAALLAEALDAGSIEIWTDVPGIYTTDPRLVTRARP
223 :     IPEISFVEAAEMATFGAKVLHPATLQPAVRQDIPVFVGSSKDPAAGGTWIRASTSTNPLF
224 :     RAVALRRQQVLVTLHSLNMFHAYGFLAEVFGILARHRISVDLITTSEVSVSLTLDHTGSQ
225 :     SNGEPVLSDKVLAELGQLCKVKVETGLALVALIGNRMSEAAGVGSQVFDAIREHNIRMIC
226 :     YGASAHNLCFLVKEEEAGHIVNRLHQELLD
227 :     >Plum_Aa_|_CG-21
228 :     MSAVSSQCPEIGGHVVAKFGGTSVANFDAMNNSADIVLANKAVRVVVLSASAGITNLLVA
229 :     LAAGCDADKRADYLKQIHSIQYAIIDRLHESDTIRQEIDRLLENIKTLAKAASLATSAAL
230 :     TDELVSHGELMSTRLFTELLRQRGKDAEWFDIRKVMYTDESFGRAEPNYEQLQSLATEHL
231 :     LPQLKNSLIVTQGFIGREENGRTTTLGRGGSDYTAALLGEALGLKRVDIWTDVPGIYTTD
232 :     PRVVPAAQRIDKIAFDEAAEMATFGAKILHPATLFPAIRCGIPVFVGSSKNPQAGGTLVC
233 :     DTTEAPPQFRAIALRQKQTLLTLHSLKMLHAQGFLAEIFTILSRHNISVDLITTSEVNVA
234 :     LTLDTTGSTSTNGSLLTNALMTELSTLCRVEVEEDLALVAIIGNQLSQTNGLGKKVFSVL
235 :     EKFNLRMISHGASNHNLCLLVQGKDAEQIVQTLHQRLFE
236 :     >Sglo_Aa_|_CG-21
237 :     MSNNSAVPLRVAKFGGTSVADFDAMDRSADIVLANPSVRLVVLSASAGVTNVLVTLSEGN
238 :     EAERRAYYLDEIRRIQYSIIDRLAEQTVIREEIDRMIDNIAMLAEAAGLATSLALTDELV
239 :     SHGELMSTLLFVEVLRQRGVPAAWFDVRKVMRTNDQFGRAEPDSHALKAQARTLLLPRLE
240 :     TELVITQGFIGSEAKERTTTLGRGGSDYTAALLGEALEAGRIDIWTDVPGIYTTDPRVVP
241 :     TAKRIDEISFEEAAEMATFGAKILHPATLLPAVRSAIPVFVGSSKDPGAGGTLVYNHTDN
242 :     PPLFSALALRRRQTLLTLHSLNMLHARGFLAEVFNILARHAISVDPITTSEVSVALTMDT
243 :     TGSTTTCASLLTQALLTELSSLCRVEVEEDLALVALIGNKLSQACGVGKEVFGVLDPFNI
244 :     RLICYGASSHNLCLLVPGHDAEQVVRTLHSALFD
245 :     >Patr_Aa_|_CG-21
246 :     MSATEVSANANATVIAKFGGTSVADFDAMNRSADVVLSNPNVRVVVLSASAGITNLLVAL
247 :     AEGQTQETRAEHLAKIRQIQYAIIDRLTNQSVIRDEIDRMLDSVTTLSEAAALATSNALT
248 :     DELVSHGELMSTLLFVEILRQRDVIAEWFDVRKIMRTDDHFGRAQPDCDVLGELTRSLLQ
249 :     PRLEQGLVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALNVNRIDIWTDVPGIYTTDP
250 :     RVVPTAKRIDQIMFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPAAGGTLVCN
251 :     KTENPPLFRALALRRKQTLLTLHSLNMLHTRGFLAEVFSILARHNISVDLITTSEVNVAL
252 :     TLDTTGSTSTGGSLLSSALLTELSSLCRVEVEENLSLVALIGNKLSQACGVGKEVFGVLE
253 :     PFRIRLICYGASSNNLCFLVPGDDAERVVQTLHRSLFE
254 :     >Ypes_Aa_|_CG-21
255 :     MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
256 :     VALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
257 :     ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
258 :     LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
259 :     TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPMFVGSSKDPAAGGTL
260 :     VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
261 :     VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
262 :     VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
263 :     >Ypse_Aa_|_CG-21
264 :     MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
265 :     VALADGSEPEKRADHLEEIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
266 :     ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
267 :     LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
268 :     TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPVFVGSSKDPAAGGTL
269 :     VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
270 :     VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
271 :     VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
272 :     >ENTE-2a_|_CG-21
273 :     MTSFVVAKFGGTSVADYAAMNRSADVVLADPDTRLVVLSASAGVTNLLVALSEGLEATER
274 :     FVKLDALRKIQFDILERMQNPHVIREEIERLLENITTLAEAASLATSTALTDELVSHGEL
275 :     MSTLLFVEILRERDVMAQWFDVRKVMRTSDRFGRAEPDVATLSELSKQQLAPRLAEGIVI
276 :     TQGFIGSEAKGRTTTLGRGGSDYTAALLGEALYATRVDIWTDVPGIYTTDPRVVPAAKRI
277 :     DVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPKAGGTLVCKNTVNPPLFR
278 :     ALAMRRKQTLVTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSIALTLDTTGSTS
279 :     TGDTLLTQSLLMELSALCRVEVEEDLALVAIIGNKLSRACGVGKEVFGVLDPFNIRMICY
280 :     GASSYNLCFLVPGHEAEQVVQKLHHNLFE
281 :     >Sent_Na_|_CG-21
282 :     MTEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGMEPGER
283 :     FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
284 :     MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
285 :     TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
286 :     DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
287 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
288 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
289 :     GASSHNLCFLVPGDDAEKVVQKLHQNLFE
290 :     >Styp_Aa_|_CG-21
291 :     MTEIVVSKFGGTSVADFDAMNRSADIVLSDTNVRLVVLSASAGITNLLVALAEGMEPGER
292 :     FATLDAIRKIQFDILDRLRHPNVIREEIERLLENITILAEAASLATSAALTDELVSHGEL
293 :     MSTLLFVEILRERDVQAHWFDVRKVMRTSDRFGRAEPDVAALAELAAQQLLPRLSETLVI
294 :     TQGFIGSESKGRTTTLGRGGSDYTAALLAEALHAARVDIWTDVPGIYTTDPRVVPVAQRI
295 :     DEIDFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPQAGGTLVCNKTQNPPLFR
296 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
297 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNNLSKACGVGKEVFGVLEPFNIRMICY
298 :     GASSHNLCFLVPGDDAEKVVQKLHQNLFE
299 :     >Sdys_Aa_|_CG-21
300 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPSER
301 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLTEAAALATSPALTDELVSHGEL
302 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
303 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
304 :     DEIAFAEAAEMATFGAKVLHPATLLPTVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
305 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
306 :     TDDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
307 :     GASSHNLCFLVPGEDAEQVVQKLHFNLFE
308 :     >Sboy_Aa_|_CG-21
309 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
310 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
311 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNDGLVI
312 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
313 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
314 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
315 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
316 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE
317 :     >Ecol_Aa_|_CG-21
318 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
319 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
320 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
321 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
322 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
323 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
324 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
325 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE
326 :     >Sfle_Aa_|_CG-21
327 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
328 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
329 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
330 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
331 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
332 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
333 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
334 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE
335 :     >Sson_Aa_|_CG-21
336 :     MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
337 :     FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
338 :     MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDVAALAELAALQLLPRLNEGLVI
339 :     TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
340 :     DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
341 :     ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
342 :     TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
343 :     GASSHNLCFLVPGEDAEQVVQKLHSNLFE

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3