[Bio] / FigWebPages / ask_CG20.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG20.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Saci_Aa_|_CG-20
2 :     MIKVIKIGGSIQKDEKDYELIADKISKYSDENRTLIVTSAIKGVTDQLTSVINETDKAVD
3 :     KVTEIYDKHIKLLSKLVDGIEFEKAFRDISRLVDELYRIAWSIRVLDEATPRVKDYILSF
4 :     GERLAVILLSSFLRTRKFSVNNLIEPPIVTDENYSEANVLLEDSKELLSKKLEESQQKIV
5 :     VLPGFIGKSKNNRYTTIGRGGSDYTATLIGKLVDAKEVRLVTEVPGIMTADPRKISNSVT
6 :     IQRLSLEEAIELSQLGAKKLHPRTFDPLFDANMKVIIEGLYEEGCTIIEGLCTSKDGLKG
7 :     ITTKEGLSLITIESTRIVGKIGSASTITSEAKNANVNIIALSQPASETTIQFVVDQKDQK
8 :     KFVERLSQLSGLIKNIELSEVGAVSIVGCGLRNKEISSKVLSKASSYNPIFVSRGLKGVS
9 :     ITFIVDKKELDSISKELHEVVVNWSIN
10 :     >Stok_Aa_|_CG-20
11 :     MKVIKIGGSIQKDEKDYELILDKLKKEIDYNDKNIIVTSAIKNITNQLLDIIKNTDKAMD
12 :     IVTDIYDRHVRLLSKLTNGIEFERSFGEISKLADELFKIAWSVRVLDEVTPRVKDYILSF
13 :     GERFAVILLSAFLRSNNIQSSYILDPPLITDENFGEANVLLQQSKENLTKKIDGINGNVI
14 :     VIPGFIGKSTQNKFTTIGRGGSDYTATIVGKILGAKEVKLITEVPGIMTADPKKIPQAKT
15 :     IPRLALEEAIELSQLGAKKLHPRTFDPIFNTNLKVVIEGLYEEGSTVIEGNCTKDDILKG
16 :     IATRNNLELITIESTNIVGKIGSAATIMSEARNANVNLIAISQPVSETVIQLVIESQDKD
17 :     RLIERLNNLNNLIEDIQSRKVSAISIVGCGLRNKEISAKVINKASSLDPIFISRGLKGVS
18 :     LTFIVDEKDENSLAKELHEVILEWQTK
19 :     >Msed_Aa_|_CG-20
20 :     MLVVKIGGSIQKDERDFELIANRISQYSSRDRTIVVTSALKGVTNSLIEATENRDKAVEI
21 :     VSEIYDRHVKLLSKIVDGPEFDNAFKSISKLADELFRIAWSIKVLDEISARVRDYILSFG
22 :     ERMASVTLGAMLRSRKMDAQSYPEPLLVTDDSFGEANVIEDLSAMEARKVLDIPSKIVVV
23 :     PGFIGKTPTERYTTVGRGGSDYTATLLGKLLGFPEVRLVTEVPGIMTADPRKFPGAKTIS
24 :     RLSLEEAMELAQMGAKRLHPRTFEPMFDRDIRVYIEGLYDEGYTLVQGTCDSSDKLKGIA
25 :     VLDDLKLISVESTNIVGKIGSAARVMEKAREAGVNIISLSQPASETTIHIVVDSKNAERL
26 :     SSRLQELRDVDSINVQDASAVSVVGCGLRNKELFREVLREASSFEVASISRGLRNVSATF
27 :     VVKKDEGFNLAKDLHEVVVKWIN
28 :     >Ssol_Aa_|_CG-20
29 :     MALIVKIGGSIQKDEKDYELIVKKIQDFSKKSDKIIVVTSAIKNVTNELISATSNTDNSP
30 :     NIVTEIYERHIKLLSKLADGKEFENSFKDISRLSDELFRVAWSIRVLDEVTPRVRDYILS
31 :     FGERMATLLLSAILRSNGIEAEGIITPPFLTDENYGEANVIEDLSKNEIANILENAKANV
32 :     IVLPGFIGRTREGRYTTLGRGGSDYTATLLGKLVGVREVRLVTEVPGIMTGDPKKFENAK
33 :     TISRLSLEEAIELSQLGAKRLHPRTFDPVFGSDMKVIVESLYEDGFTIINGECQNNDGLK
34 :     GISLLDNAKLITVESTKIVGKIGSAARITNEAKEAGVNIISISQPASETTIQLVVDSLSA
35 :     NRLLSKLEEIRGTLVKDIEVNDINIVGIVGCGIKKKEISTKVLSIASSYDPLAISRGISN
36 :     VSMTFIVNKDEGEKLAKELHKVIVSG

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3