[Bio] / FigWebPages / ask_CG19.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG19.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Aper_Aa_|_CG-19
VVGCAPNDLVVVKFGGSVLNGSPGFLAAGRLVLGLLESGLEPVVVVSAVKGVTDALLSSF
ERRDPGVGGAVGKTYLSIARELGLPPESVRDVSLASAEVSKLLWAAEVLGQWTPRVRDLV
VSYGERLSAALMAGLLRRLGVEARWLGGGEAGIVTDGEFGDATPLYGYTEGVIRERLEPM
LEEGVVPVVAGFTGATREGDTTLLGRGGSDLTATLLASALGAGRVVLYTDVPGILSGDPR
VVGEPRRVGYMSYEEAWEVARLGLRKFHPRTFEPLIAGGLGVEVVVSDLRGRSTRIGPGR
GGPPLKVVSLSRGVARLVVRGPSMAGKRGFLSRLAGLLAGRGVNILAIRQPPSETAIELV
VDERDLPAAVEELGARSGAAGVRLEVERGFDVVSIVGWGAVEALPEALSAAEKTGGRLLS
TGELSPSISILARGRTSPELARLLHRRVVESWVTG
>Mkan_Aa_|_CG-19
MEVHKFGGTSVASEEGLRTLEASAASGHVIVVSALAGVTDALEDFVRRAAEGSADPTPIL
ERHREFITEHLEQRHEEVESFLKDMETLLHGVATVLEQLGRPEERLRDLVLSLGERASAR
IVAAYLKERGIKAMAYDAWDVGLVTTDDPGNADIVGWDGTRSRLLRDLRSGRVPVVTGFI
GRSDRGHVTTLGRGGSDYTATVLAGVLGSRSVIWTDVDGIMTTDPELADAEVVERLSYEE
AMMAGASGAGVIHPKAVEAAKNLGVTVLIGNSFTGEIGTVISDSTEPGPKVVASRDDVAL
IRVSGAKMVDEPGVVGRVTSALGNAGVNLLAVFTTVSEPYINLLVEETALRSAEEALNGL
DYDWEVDKDVGLVTVVGEGMSARDVSTFLAACEGFDLLGSAHGVVAVSVVVPESEVREVT
RRLAERLLA

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3