[Bio] / FigWebPages / ask_CG13.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG13.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Atha_b_|_CG-13
2 :     MAATRVRCCHSNAAFTRLPLTRHRNSPTLPISLNRVDFPTLKKLSLPIGDGSSIRKVSGS
3 :     GSRNIVRAVLEEKKTEAITEVDEKGITCVMKFGGSSVASAERMKEVADLILTFPEESPVI
4 :     VLSAMGKTTNNLLLAGEKAVSCGVSNASEIEELSIIKELHIRTVKELNIDPSVILTYLEE
5 :     LEQLLKGIAMMKELTLRTRDYLVSFGECLSTRIFAAYLNTIGVKARQYDAFEIGFITTDD
6 :     FTNGDILEATYPAVAKRLYDDWMHDPAVPIVTGFLGKGWKTGAVTTLGRGGSDLTATTIG
7 :     KALGLKEIQVWKDVDGVLTCDPTIYKRATPVPYLTFDEAAELAYFGAQVLHPQSMRPARE
8 :     GEIPVRVKNSYNPKAPGTIITKTRDMTKSILTSIVLKRNVTMLDIASTRMLGQVGFLAKV
9 :     FSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQQELDHVVEELEKIAVVNLLKGRA
10 :     IISLIGNVQHSSLILERAFHVLYTKGVNVQMISQGASKVNISFIVNEAEAEGCVQALHKS
11 :     FFESGDLSELLIQPRLGNGSPVRTLQVEN
12 :     >Atha_a_|_CG-13
13 :     MASLQLYGVKTPGLALSSKRLEFASKGACFSVTLPSSSAVFRDVEHSCRNIGLRVSCEAL
14 :     RVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVESAERMKEVANLILSFPDERPVIVLSA
15 :     MGKTTNKLLKAGEKAVTCGVTNVESIEELSFIKELHLRTAHELGVETTVIEKHLEGLHQL
16 :     LKGISMMKELTLRTRDYLVSFGECMSTRLFSAYLNKIGHKARQYDAFEIGFITTDDFTNA
17 :     DILEATYPAVSKTLVGDWSKENAVPVVTGYLGKGWRSCAITTLGRGGSDLTATTIGKALG
18 :     LREIQVWKDVDGVLTCDPNIYPGAQSVPYLTFDEAAELAYFGAQVLHPLSMRPARDGDIP
19 :     VRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFTTF
20 :     EDLGISVDVVATSEVSISLTLDPAKLWGRELIQRVNELDNLVEELEKIAVVKLLQRRSII
21 :     SLIGNVQKSSLILEKVFQVFRSNGVNVQMISQGASKVNISLIVNDEEAEQCVRALHSAFF
22 :     ETDP
23 :     >Atha_c_|_CG-13
24 :     MAASMQFYGVKTPELALNSKRIEFSSKGLNFSALVSSARVFSRNVDRSCKNIALRVTCEA
25 :     GRVELLERKASETFKLNKTEKKLTCVMKFGGSSVASAERMIQVAKLILSFPDEKPVVVLS
26 :     AMAKTTNKLLMAGEKAVCCGVTNVDTIEELSYIKELHIRTAHELGVETAVIAEHLEGLEQ
27 :     LLKGVAMMKELTLRSRDYLVSFGECMSTRLFAAYLNKIGHKARQYDAFEIGIITTDDFTN
28 :     ADILEATYPAVSKKLLGDWSKENALPVVTGFLGKGWRSCAVTTLGRGGSDLTATTIGKAL
29 :     GLREIQVWKDVDGVLTCDPNIYCGAQPVPHLTFDEAAELAYFGAQVLHPLSMRPAREGNI
30 :     PVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDITSTRMLGQYGFLAKVFST
31 :     FEKLGISVDVVATSEVSISLTLDPSKFCSRELIQHELDQVVEELEKIAVVNLLRHRSIIS
32 :     LIGNVQRSSFILEKGFRVLRTNGINVQMISQGASKVNISLIVNDDEAEHCVKALHSAFFE
33 :     TDTCEAVSECPTGYIAASS

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3