[Bio] / FigWebPages / ask_CG08.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG08.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Phal_Ac_|_CG-08
MTNNIHKFGGSSLSSAERYKSVAKIIIGQAQPGDCVVVSAAGKTTDTLVKLWQSYQQHDT
QALADIVLQLNNHQSDLITQLLQGDLKRSALTTLNEELSLVAKLASTEQLQEAALLAHGE
LWSARLLAAYLQQLNVAACMQDARGLFTLSDGQLLHSQNTQQCSELISQHKINVVTGFIA
ANTQGDTVTLGRNGSDYSATLLASYCNAKQVYIWTDTQGIFSTDPRKVNKAIKYAKVCRA
QANLLARLGNPVLHAKTLSPLKNTDIKLAVRSSFDVQASSTNVVKEGCVKQKRFITTLEN
IDLLSVEGLVEGEVTQVSQLIQHSLHHFSSAGETYLIVPAVATHQVVSYFAGRANISESN
LHGCALVAPEQDINSLSTQARELLNLHNIEPRFVHQDSGYVLLLTDQLIDSDVLNVLHDK
LITKGQEIALIVA
>Cpsy_Ac_|_CG-08
MSSNEIADIDFIAEVAAENKLAKHAIQVHKFGGSSLATPKCIKRALEIIRENCQLNDIVV
VSANGKTTDRLFALYSLVERTIAEDTIQKSDELTQAIDELAKEQAQLITELLNANNTKQL
LLRLHKDIEQLTTWLTADIVQHHNDVLALGEVWSARLLSALLNEQVCPSNSIDSRDFLVI
DNEQSCVVDTALSAAQLRQRRQFGKLAVITGYISKDSRGKSCTLGRNGSDYSATIIASLV
AAGNVTLWTDVDGIYSADPRVVPSARKLHRLPNGVAKELGRLGNPVLHAKTLLPLINPLS
EHHTHLHVASSFDAQVIGTEIGKFGQIAKQELSVTYLNDLLLAQSVSFIGEAATRAKAEF
SPICIDDQKGFMVITQGQQKALSDWLASHDVEITFKPVAIIATVGHRVAERGDIRARFKR
SLKAAKPLNLVGSDNNHSVIAILPEPCSIELLNTVHHEMTKDARHIGLVVA
>Iloi_Ab_|_CG-08
MTTTQLTEEQKQAVADSVQVHKFGGSSLADAFCYRRVARIVTEYAGASDLVVVSAAGDTT
NRILAIINAKAQPGDTASILLDQLESFQQGLITELLSGNLQQQLLQQSQQDFARWRRWLA
CDETISHNAELLSYGELWSARLLSALLQKQGTRADHIDARDFLLAADAPEPVIQVEHSRE
KLLQRVAPHSGTRFIVTGFIARGLHGESLTLGRNGSDYSATLVGSLLDTRQVTIWKDVAG
VYSADPRKVERVVSLPTLDWTEAEELARLGSPVLHPRTFQPVDRQRMVISVRSSLKVENQ
QTRIGQFQNTQPRGKVFTSLSEVVLFKVELHDKALVKRLDELELEPLVSWTEPENHQQYL
VFHQNHLDYLTGWLDSLGAGDAITQIRGYSMLAIVGNRIQETDQFSTFKLQLSEQKVRRF
ALTQNGDSAVAILEQKLDNRLLNRLHSQLFNYRRSLGVLVI
>Sloi_Ab_|_CG-08
MTRCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLIVVSAAGKSTNFLYRLLELCDTDQ
LWQEELQVLVSYQQNLIEQLLSNEQARSLRERLATDKSQLTSLLSLDELNDYQRNQVVSF
GERWSSCLLAALLRESGVAATDVDARTLLVADEGAVPQIRLGESRQKVQALLEAHPQERL
VITGFICANEQGDTLLLGRNGSDFSATLLASLADIERVTIWTDVEGVFNADPNRINDAKL
LKSMSLTEANRLAHLGSPVLHNRTLQPLFDTEVSLAVRSSYAPHTDFTLIAPKSSSASAP
VVTSLSSVSLFSLTISVELPQLLACFAQAGLTPLAYWSLAHGRAELAFTHENQKQAQAIF
EAKRSELGIDELQLRDDLGLVALVSADASLYRRGFSRLLSREAHPLCNDGLSLVTLVPKA
QVNLLTQKVHRRCAGPRKRIGVLLL
>Sama_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTQGHSDDLVVVSAAGKTTNFLYKLLSLRDAGE
LWQEELQVLISYQQNLIEQLLSAEQARYLRERLSTDKAQLVSLLSLATLNDYQTSHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEGAVPNIREQESREKVAAMLAEHENERI
VITGFICANPAGETLLLGRNGSDFSATLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTQVSMAVRSSYAPHTDFTLVAPTSSQASAP
VVTNLSEVALFSLTTQADTDALLATLSASGLTPLASWQGSRGGLELAYTPENLKQVSAFL
KANAEAYGLGDVSISNDFGLVALVSADAVLYRKSFARLLSREAKPLYHDTLSLVTLVPKA
QVNLLTQKVHRRCAGPRKRIGVILL
>Sden_Ac_|_CG-08
MARSHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLDLRDTGQ
LWQEELQVLISFQQALIEQLLSNEQARDLRERLSNDKAQLASLLSLEQRNEYQISHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEGAVPKIRVEESKAKIQTLLAERTNERL
VITGFICANAQGDTLLLGRNGSDFSATLIASLADIGRVTIWTDVEGIFNADPNKINDAKL
LKSMSLAEADRLARLGSPALHSRTLQPLFNTQVSLAVRSSYASHTDFTLIAPQSSSASAP
VVTSLSQVVLFSFKLETHNKIESDSQSKPQPQSQFESVLAALTSAGLTPLAHWEYGADKH
ELAFMLENQKQVNALLSKQAPTFGITELQLNLDLGLVALVSADAEHFRRSFARLLSRDAK
PIYQDNLSLVTLVPRAQVNLLTQKVHRRCAGPKMRIGVLLL
>Sfri_Aa_|_CG-08
MTRSHLHKFGGSSLADADCYRRVAHILLTHGQSDDLVVVSAAGKTTNFLYKLLSLRDSGQ
LWQEELQILISYQQTLIEQLLSNEQARDLRERLSTDKSQLVSLLSLEQRNDYQLNQVVSF
GERWSARLMAALLREMGVAATHVDACSILVADEGAVPNILVAESRDKVQALLALHPQERL
VITGFICANRHGDTLLLGRNGSDFSATLIASLADIDRVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPLSSSASAP
VVTNLNEVVLFSFKMNADIEPLLAILDKAGITPLAYWSLAQHKFELALTLESQKQVQALL
NQYSSEFLIEELSAQTDLGLVALVSADAHHFRRSFARLLSRDAKPIYQDALSLVTLVPQA
QVSLLTQKVHRRCAGPRMRIGVLLL
>Sone_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKTTNFLYKLLSLRDSNQ
LWQEELQVLISYQQGLIEQLLSNEQARDLRERLTTDKAQLISLLSLDVRNDYQISHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKIAGDVASLLDQLVEAGLTPLAHWVSAHQRLELAYTAENQKQVQKLL
DAQAEALGIRDLQINTELGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGVLLL
>SHEW-3c_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKTTNFLYKLLSLRDSNQ
LWQEELQVLISYQQGLIEQLLSNEQARDLRERLTTDKAQLISLLSLDSRNDYQISHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRTKVQTLLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKIAGDVASLLEQLVEAGLTPLAHWLSAHQRLELAYTAENQKQVQKLL
DAQAEALGIKDLQINTELGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGVLLL
>Sbal_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLALRDVGQ
LWQEELQVLTSYQQGLVEQLLSNEQARDLRERLATDQAQLISLLSLDERNEYQVNHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKLTGELTSLLDSLIAAGLTPLAHWTSAHQRVELAYTAENQKQVQRLL
DAEAQVLGISDQQINTDLGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGVLLL
>Sput_Ac_|_CG-08
MARCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLVVVSAAGKSTNFLYKLLSLRDAAQ
LWQEELQVLISYQQGLIEQLLSHEQARDLRERLATDKAQLISLLSLDVRNDYQINHVVSF
GERWSARLMAALLRESGVAASHVDACSILVADEAAVPQIRVQESRAKVQALLAAHPNERL
VITGFICANERGDTLLLGRNGSDFSASLIASLADIERVTIWTDVEGVFNADPNKINDAKL
LKSMSLAEADRLARLGSPVLHSRTLQPLFNTEVSLAVRSSYASHTDFTLIAPHSSSASAP
VVTNLNAVVLFGFKLTGELTRLLDLLIAAGLTPLAHWTSAHQRVELAYTAENQKQVQRLL
DAEAEALGISDQQINTDYGLVALVSADAEHYRRSFARLLSRDAKPLFSGDLSLVTLVPQS
QVNLLTQKVHRRCAGPRKRIGILLL
>Ahyd_Ad_|_CG-08
MEQQQQGEIAVATEAGLKRRHVHKFGGSSLADPVCYRRVASILEQQAEQQGGGRELVVVS
AAGKTTNRLIQLVELAEAGDEAAGEAISALQAYQQSLIDGLLEGELHLELSQQLADDMQL
IAKTLEGQFDRFERNGLLAFGEVWSARLLAALLTSRGDKAIWLDARSFLRAEDGALVKVD
TALSSELLKARLAEHAGRIVVTGFIAADMEGRSLLLGRNGSDYSASLLALLADGESTTIW
SDVAGVYSADPRRVKEARLLERLSLAEANELARLGSSVLHSRTLQPVADSRQRLTLRCSY
NPDEGCTHILRRAPRSGGARIVSSVDQIALIELKVLPQTHYEQTVAAIEAHLARHRLNPL
TLQRQPDRRILRLAYTLEVAQGAFELLRDFQLQGSFTGLIQREGYSLVALVGAGVTDNAE
QCHRFYQLLADQPLEFVQVAKDGLSLVAVLRQVVLEPLLIALHSALFSRPNRVGLVVF
>Asal_Ac_|_CG-08
MKRRQVHKFGGSSLADPVCYRRVAAIVEQQVGGDELVVVSAAGKTTNRLIQLVELADAGD
EAAGEAISALQAYKQSLIDGLLEGELQLDLSQQLADDMQLIAKTLEGQFDRFARNGLLAF
GEVWSARLLAALLSSRGEKAIWLDARSFLRAEDGALVKVDTALSSELLKARLAEHAGRIV
VTGFIAADMEGRSLLFGRNGSDYSASLLAALADGESTTIWSDVAGVYSADPRRVKEARLL
ERLSLAEANELARLGSSVLHSRTLQPVADSRQRLTLRCSYNPDEGCTHILRRAPRSGGAR
IVSSVDQIALIELKVLPQTHYEQTVAAIEAHLARHRLNPLTLQRQPDRRVLRLAYTLEVA
EGAFEILRDFQLQGSFTGLIQKEGFSLVALVGAGVTDNAEQCHRFYQLLADQPLEFVQVA
RDGLSLVAVLRQVVLEPLLIALHSALFSRPTRVGLVVF
>ENTE-2b_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSMPGDMMVVSAAGSTTNQLISW
LKLSQTDRLSAHQVQQTLRRYQSDLISGLLPAQAADGLISAFVHDLERLAALLDSGITEA
VYAEVVGHGEVWSARLMAAVLEQQGLEAAWLDARDFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRIVVTGFISRSNAGETVLLGRNGSDYSATQIGALAGASRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDICLIEFQVPAGQDVKLAHKDIDLILKRAQVRPLAVGVHSDRHLL
QFCYTAEVADSALKTLDEAGLPGELRLRQGLALVAMVGAGVSRNPLHCHRFWQQLKGQPV
EFTWQSEEGISLVAVLRKGPTESLIQGLHTTLFRAEKRIGLVLF
>Sent_Nb_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLISW
LKLSQTDRLSAHQVLQTLRRYQCDLISGLLPADAADDLTSAFISDLERLAALLDGGVTDA
VYAEIVGHGEIWSARLMSAVLNQQGLDAAWLDARAFLRAERAAQPQVDEGLSYPLLQQLL
AQHPGKRLVVTGFISRNHDGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDICLIEFQVPASQDFRLAHKELDQILKRAQARPLAVGVHRDRQLL
QFCYTAEVADSVLKLLDDVGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSEEGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLMLF
>Styp_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLISW
LKLSQTDRLSAHQVLQTLRRYQCDLISGLLPADAADDLTSAFISDLERLAALLDGGVTDA
VYAEIVGHGEIWSARLMSAVLNQQGLDAAWLDARAFLRAERAAQPQVDEGLSYPLLQQLL
AQHPGKRLVVTGFISRNHDGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSDIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDICLIEFQVPASQDFRLAHKELDHILKRAQVRPLAVGVHRDRQLL
QFCYTAEVADSVLKLLDDVGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSEEGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLMLF
>Sdys_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRSERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPTSQDFKLAHKEIDQILQRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Ecol_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Sson_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Sfle_Ab_|_CG-08
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEFSQPDDMMVVSAAGSTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPSKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLF
>Plum_Ab_|_CG-08
MGALVVATAENDRQLHKFGGSSLADVKCYQRVAKIMANYSQPGDLMVVSAAGSTTNQLIN
WLKLSQSDRISAHQVQQVLRRYQQDLIRGLLPETVAEELVKRFIADLEKLSALLDKPVSD
VTYAEVVGHGEIWSARLMSAVLEAQGIPSAWVDARQFLRAERAAQPQIDVTLSQPLLNQL
LTQNLNKRLVVTGFISSNHDGETVLLGRNGSDYSATQVGALAGARRVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSFSDIDLLLRCSYQPEQGSTRIE
RVLASGTGAKIVTSHDDVCLIELHVAAHHNFKQTYKDIDLLLKREQIRPLATGIHLDCNL
IQLCYTSEVVNSALSVLEDATLPGKLSLREGLALVALVGAGVCKNPLHCHRFYQQLKDQP
VEFIWHAEDGISLVAVLRTNQTEHVIQGLHQSLFRAEKRIGLILF
>Patr_Ab_|_CG-08
MSALGVAPSVTGRQLHKFGGSSLADVKCYLRVAGIMAEYSHPGDLMVVSAAGSTTNQLIS
WLKLSQSDRLSAHQVQQALRRYQSELIAGLLPAQDAEALTAQFIRDLERLAALLDGKITD
AVYAEVVGHGEIWSARLMCAVLNHRDMNAAWLDARDFLCAERAAQPQVDEGRSWPLLQQY
LTQHSGQRLVVTGFICRNDAGETVLLGRNGSDYSATQIGALAGVERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGTGAKIVTSHDDVCLIEVQVPSEHDFVLLQKEVEQILNRAQLKPLAIGVHQDRSL
LQLCYTSEVVESALQLLTQAALPVELSERDGLAMVAMVGAGVGKNPLHSHRFYQQLKDQP
IEFVRQADDGISLVAVLRVGPTEHLIRGLHHSLFRAEKRIGLVLF
>Yent_Ab_|_CG-08
MNATAVAAAVTGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
WLKLSQTDRLSAHQVQQNLRRYQHDLISGLLSPEMAEPLISEFIHDLERLAGLLDNKVDD
AIYAEVVGHGEIWSARLMSAVLNKLDMAADWLDARSFLRAERAAQPQIDEGRSYPLLQQL
MAQHPHQRLVVTGFISRNNAGETVLLGRNGSDYSATLVGALAGVERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGSGAKIVTSHDDVCLIELQIAGHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
LQLCYTSEVVNSALRVLEDATLPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
VEFIWQAEDGISLVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
>Ypes_Ac_|_CG-08
MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
WLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFIHDLERLAGLLDNKIDD
VIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERAAQPQIDESRSYPLLQQL
MAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALAGAERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
LQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
VEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
>Ypse_Ac_|_CG-08
MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
WLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFIHDLERLAGLLDNKIDD
VIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERAAQPQIDESRSYPLLQQL
MAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALAGAERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
LQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
VEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLF
>Ppro_Be_|_CG-08
MKRQLHKFGGSSLADPECYRRVTDILREYSHPNDLIVVSAAGKTTNCLIEWVERLNKDGR
QAHETLQEIRQFQQHLIEASVNGEQADRLLSQLHAELSELAKLSGLEITEAVRSSILGHG
EIWSARLLAALLNRNNMPAVSLDSRDFLRAERAVQPEVDRTLSRPLLQQQLVQHNKCRIV
ITGFMARNQASETVLLGRNGSDYSATVIGALADVSRVTIWSDVAGVYSADPRKVADACLL
PLLRLDEADELARLAAPVLHSRTLQPVAQSTIDLTLRCSHQPESGSTRVERVLASGRGAK
IVTSLDEVCLIELDVPRSHDFDAIKTDIERTLQRAQLLPLAQSAEVELGRILLAYTSEMV
NCVLELLQNRGVAAELRLREGFSMVAAVGAGVVNNPVHCHGFYQQLKGLPVEFMTEAESG
LSLIAVLRKVDTEGLVARIHQSLFQAQKRVGIVLC
>Vfis_Ad_|_CG-08
MTIPCSRQLHKFGGSSLADPECYRRVATILKEYSNEHDLIVVSAAGNTTNRILEWIDDLS
KDGRLAHETLESLRTYQQGLITELLSAENAEPLLTVLYQELIAIGQLHAPLTEVQQADVL
GHGEVWSSRLLSAYLNQIDLQAAPLDSRTFLRAERAAQPEVDRVQSWPLFKEQVAQHPHG
RIVITGFMARNQRGETVLLGRNGSDYSATMIGVLGEVSCVTIWSDVAGVFSADPRKVEDA
CLLPLLRLDEASELARLAAPVLHSRTLQPVAQSALDLSLRCSYQPESGSTRIERVLASGR
GAKIVTSLEDVYLIQLGFGRGQYFERAQQEVLSLLTRSQLQPLALEPQADQFTLLLAYTS
EVVNEALEVLQNSAVHAEIKLKEGYSMVAAVGAGVTANAIHSHGFYHQLKNCPLEFVYAS
ESGLSLVAILRKVDTSSIINAIHNSLFQAQKRVGLILC
>Vcho_Fc_|_CG-08
MTHPRQLHKFGGSSLADPECYQRVAKILKSYSKSDDLVVVSAAGKTTNRLISFVEALSKD
GRVAHETLHALRQYQSELITKLLSNEAAEPLLSQLQQEISVLGELTAPLSNAQYAWVLGH
GELWSARLLAALLNQQDLPAVAQDARTFLRAEAGTQPEVDRARSYPLLKAVLAQHTQRRV
VITGFMAQNEQGDTVLLGRNGSDYSATVIGALAEVSRVTIWSDVAGVYSADPRIVSDACL
LPLLRLDEANELARLAAPVLHSRTLQPVAQSTMELHLRCSHQPESGSTRIERVLASGRGA
KIITSLDDVLLIELSFAHHHDFQRVQEDVLQHLQRVQLQPLTYEAQPDQYRLRLAYTAEI
APGAFAALQDAAFEAEIKLKEGYDLIAAVGAGVTKNPNHCYGFYQQLNALPVEFISASES
SLSLVAVLRQTPIHSLVNAIHKQLFQAQKHVAIALC
>Vpar_Ad_|_CG-08
MSVQRQLHKFGGSSLANPECYLRVADILKEYSAENDLVVVSAAGKTTNRLIEFLEGLDKD
GRIAHEALQGLRQFQSELIESLLEGEVQTQLLASLHDEFSTLAELTAPLTDAQKAAVLGH
GEVWSSRLLAALLSQQNVPAVAQDARAFLRAEAGTQPEVDRARSYPLIKEALAQHSHKRV
IITGFMAQNEAGETVLLGRNGSDYSATVIGALAEVTTVTIWSDVAGVYSADPRLVSDACL
LPLLRLDEASELARLAAPVLHSRTLQPVAQSTMDLSLKCSYQPESGSTRIERVLASGRGA
KIITSLDEVLLIQLSFRHGHDFNKTQSDVLKSLQRAQLEPLSYEVQADQQKLRLAYTAEI
ATGALKYLQDLAVEAEIKLKEGYSLVAAVGAGVTKNANHCFGFYQKLKHAPVEFVSETES
GLSLVAVLRRTDTEALVQLIHSQLFQAQKRVAVTLC
>Vvul_Aa_|_CG-08
MSQVRQLHKFGGSSLADPDCYRRVVNILKEYSGDNDLVVVSAAGKTTNRLIEFSEALEKD
GRLAHEALQALRQYQTGLVEALIASNQRSELLDQLADEFSTLAEFSAPLTTAQKAAILGH
GEVWSSRLLASLLNQHDLAAVAQDARAFLRAETGTQPEVDRARSYPLIKEVLAQHSHRRV
VITGFMAQNQAGETVLLGRNGSDYSATVIGALAEVAKVTIWSDVAGVYSADPRLVSDACL
LPLLRLDEASELARLAAPVLHSRTLQPVAQSATELNLRCSYTPESGSTRIERVLASGRGA
KIITSLDDVMLVQLNFSAGHDFERQQQEVLRALKRAQLEPLAFEAQKDQFKLRLAYTTEI
AGGALAHLQELGLAAEIKLKEGFSLVAAVGAGVTNNASHCFGFYQQLKHSPVEFISEAES
GLSLVAVMRRVDLPVLVKAIHTQLFQAQKRVALALC

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3