[Bio] / FigWebPages / ask_CG04.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG04.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Wglo_Aa_|_CG-04
MRVLKFGGTSISSLKCFSKVVNIIKKNYKKDQIAVVLSAPKKVTDNLFYMIEKSCQTKDI
KEIFNNTKDIFFYLIKSLFDSNENYYYLNIYNFIELKFNRLLYLLNIVFNLKFCPNSINA
EIVCMGEIISVKLMELYLKNKNIDVFVIDPKKIFLSKGQYLESFIDIKESERRIKKINFP
KNKVILMAGFIAKNKYGELVALGRNGSDYSATALAACLKANVCEIWTDVDGIYTGDPNKI
KNTKLINKLSCKEAISLSYLGAEILHKRSIFPILEFNIPCIIKNTNNSNSYGTSILNIVN
DEKEIIKGITFLKDIAMISIFICYNIKTINIYNRILVAFKKSNIKIIFMMQSSSESNINI
FIFQNNLSESKCIIEYEFCFEINNKLFESIHYKSDLFILSMIGSNIFKNKNIFINIVKFF
NFIHKKMISILYGGYLSNAFSVVLESCNIVNDLNNMHKIFFEKKNFIEIFIIGNKNIKNC
LFNLFYKKKFFF
>Phal_Ad_|_CG-04
MRVLKFGGSSLADFACLEMVAVLAKAQLKDEMLLVLSAPGGMTDSLVALASAAEQGEDFS
HLWQALVNRCDELKKAVEQGYGEIENWPNFTELKNKLDGVSLIKCCPEQVRAFIISFGER
VSVSLMQCLLGDLNAQYLEATNCIVSTGGYIDAEADLVASKVRFQAVLKEQPATIYIMPG
FTASNEQGELTTLGRNGSDYSAAIAAACLEADVCQIWTDVDGVYSADPRYIKTATKVDFL
SYKEAMELSYFGAKVLHPKTILPCAKAGVPCEIKNTRNPNAQGSLISNESVSSEPVKALS
SLQDLAMLTVSGPGMKGKVGMASKVFNALALDNVSIVLITQSSCEFSISFCVHEVDLALA
LEALQTAFKLESQAGLIEPIQVKRNLAIVTLVGDNMRAHKGLAAKFFASLAQAQVNIVAI
AQDSTESSISAVIDGERCNGAVKVCHENFFTHIPSIDVFLL
>Baph_Aa_|_CG-04
MKLLKFGGTSLANAEKFLSVSSIIEENTQTDQIAVVLSAPAKITNYLVKIIENTIKNNQI
LETVHLAENIFMQLINNFLNIQSNFPHKEIEKIIKKEFNELKNIIQGILLLKQCPDNIRA
IIISRGEILSVFIMKSILQSKNYNVTIINPVKNLVAIGDNYLDSTVDISESKKNIQNMNI
NQSNIILMAGFIAGNKDKKLVVLGRNGSDYSAAVLAACLDANCCEIWTDVDGVFTSDPRK
VPNARLLKSISYQEAMELSYFGAKVLHPRTIEPIAQFKIPCLIKNTNNVKSIGTLICEQN
CSEKDFLKGVTHLDEIAMFNISGPHIKDVGSVISRIFTMMSRGNIKILLITQSSSENKIN
FCVYEHDIYKILYLFNKEFQLELKDGLLNPFKIKKNLSILSIVGSNIYKKHNIASKIFSV
LGALKINVIAISQGSSKHSISLVIKKENILKAVQHVHNTLFFNKKTIHMFLI
>Sloi_Ac_|_CG-04
MKVMKFGGTSLANWQRFNSAAQIVLASAAEQPTAVVLSAPATVTNGLLEMVDLAVAGDDF
FPVLSQVHEVFKTLYGQAASEVLSGEQSDSLEAVLAAQLKHWQDKLQGVVLLGECPDAVR
AEIVVGGERLSAALMEQLMLAAGVSANQLVPQQLFVAHGPALESVVDIAASKQRFAELSL
DAHQVWVMPGFTAGDKDGRVVTLGRNGSDYSAAVLSACIDASCCEIWTDVDGVYNTDPRV
VADAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIRNSFNPQAPGTLVSNQV
DETGLNVKAISNLDEQTMFDIAGPGMKGMVGMASRTLGAISRSGVSVSLITQSSSEYSIS
FCVATQDAERVRVALEQEFELELKSEILEQIAMRHNLAIVSLIGDGMRTHKGVAGKFFQA
LAQANVNIVAIAQGSSERSISAVIELRKTKHAIAACHQSLFDVQHYLDVFLV
>Sama_Ad_|_CG-04
MKVMKFGGTSLANWQRFDMAAAIVAEAAKASQVAAVLSAPATVTNGLLDMVDVAVTGGDY
QAVLGRVVGVFEALFDDACQHQVPQCREHLFAALSAQKHAWQTRLEGVALLGECPDGVRA
EIVVAGERLSTELMVALMNAHWLSADKLDPRALFLAHGTPLESVVDIGVSKPRFKQLPLD
SKRVWVMPGFTAADDKGRTVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
ADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPEAPGTLVSNAVD
ETGLQVKAISSLDNQTMFDVSGPGMKGMVGMASRTLGAIARAGVSVSLITQSSCEYSISF
CVAGKDAAKVQSALEQEFELELKSELLEPLEMQSGLAIVSLIGDGMRTHKGVAAKFFSAL
AQASVNIRAIAQGSSERSISAVVEQRKVQNAIGACHQRFFDVQQYLDVFLV
>Sbal_Ad_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAQSSKLEPIATVLSAPATVTNALLEMVDVAVKGEDY
LPVLQHVEWVFTSLYQDAVNSVLSSEQSEQLFSGLNAQLVIWQDRLRGIGLLQECPDGIR
AEIVVAGERLSAALMEQVMISKGITSAQLDPRALFLGRGRPLESVVDIAVSKPRFRALAL
GEKRVWVMPGFTAADEQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
DETGLQVKAISNLDNQTMFDISGPGMKGMVGMASRTLAAISRSGVSVSLITQSSSEYSIS
FCVATSDSAKVKWALEQEFELEIKSDLLEPIAMRHELAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>Sput_Ad_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAKSSKLEPIATVLSAPATVTNALLEMVDVAVKGEDY
SSVLQHVERVFTSLYQDAVTSMLSSEQSEQLFSGLNAQLVIWQDRLRGISLLQECPDGIR
AEIVVAGERLSAALMEQVMLSKGITSAQLDPRALFLGRGRPLESVVDIAISKPRFRALAL
GEKRVWVMPGFTAADEQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
DETGLQVKAISNLDNQTMFDISGPGMKGMVGMASRTLAAISRSGVSVSLITQSSSEYSIS
FCVATSDSAKVKWALEQEFELEIKSDLLEPIAMRHELAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>Sone_Ad_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAKAATMEPVATVLSAPATVTNALLEMVNLAVKGEDY
SPVIQHVERVFTSLYQDAVSSGLSSTQSELLFAGLGAQLARWQDRLHGITLLQECPDGIC
AEIVVAGERLSAALMEQVMLAKGITSAQLDPRKLFLGRGRPLESVVDIAVSKPRFKNLLL
DEKRVWVMPGFTAADEDGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNLA
DASGLQVKAISNLDNQTMFDVSGPGMKGMVGMASRTLAAISRSGVSVSLITQSSCEYSIS
FCVATSESAKVKLALEQEFELEIKSDLLEPIEMRHDLAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>SHEW-3d_|_CG-04
MKVMKFGGTSLANWQRFSMAADIVAKAAKAEPVATVLSAPATVTNALLEMVDVAVKGEDY
SPVIQHVERVFTSLYQDAVSSGLSSSQSEVLFAGLSVQLARWQDRLRGITLLQECPDGVR
AEIVVAGERLSAALMEQVMLAKGITSAQLDPRELFLGRGRPLESVVDIAVSKPRFKNLAL
DEKRVWVMPGFTAADEDGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRV
VTDAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQFHIPCYIKNSFNPDAPGTLVSNQA
DESGLQVKAISNLDNQTMFDVSGPGMKGMVGMASRTLAAISRSGVSVSLITQSSCEYSIS
FCVATSDAAKVKSALEQEFELEIKSDLLEPIEMRHDLAIVSLIGDGMRTHKGVAARFFQA
LAQASVNIIAIAQGSSERSISTVIEQRKTKHAVAACHQGFFDVQQYLDVFLV
>Sden_Ab_|_CG-04
MKVMKFGGTSLANWSRFSMAADIIIEAAAVEAVSTVLSAPATVTNSLLEIADLAVNKEDF
EPVLKHISNVFNELYQGAASELTSVQQALLMQQFQTQFDEWQDRLKGIGLLSECPDSVRA
QIVVSGERLSAGLMQQVLLARKVSAGLLDPLALFMAHGEVLESVVDIAISKPRFSALTLE
SNKVWVMPGFTAADAKGRVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
HDAKLLTQLSYQEAMELSYFGAKVLHPKTIAPIAQYHIPCYIKNSFNPSAPGSLVSNDLD
TTGLQVKAISNLDHQTMFNVSGPGMKGMVGMASRTLAAISRSGISVSLITQSSSEYSISF
CVATSEAQKAKWALEQEFELEIKSELLEPIELRQGLAIVSLIGDGMKTHKGVAAKFFSAL
AKASVNIIAIAQGSSERSISTVIEQSKTKHAVCACHQAFFDVQQYLDVFLV
>Sfri_Ac_|_CG-04
MKVMKFGGTSLANWSRFSMAADIIADTASTESVATVLSAPATVTNALLEMVDIAVNQQDY
QPVLDHINGVFSGLFSDATSLITAVQHKLLVEKLAAQMQVWKDKLYGIRLLGECPDSVRA
ELVVTGERLSAALMEQVMLAKDITSAQLDPVALFLAHGQPLESVVDIAVSKPRFTLLPLD
QYRVWVMPGFTAADAQGKVVTLGRNGSDYSAAVLAACLDASSCEIWTDVDGVYNTDPRVV
ADAKLLSQLSYQEAMELSYFGAKVLHPKTIAPIAQYQIPCYIKNSFNPSAPGTLVSNDDD
KTGLQVKAISNLDNQTMFNVSGPGMKGMVGMASRTLAVISRSGISVSLITQSSSEYSISF
CVSTSQANKAKWALEQEFELELKSELLEPIELRQDLAIVSLIGDGMKTHKGVAAKFFTAL
AKASVNIIAIAQGSSERSISTVIQQKKTKHAIGACHQAFFDVQQYLDVFLV
>Aple_Ab_|_CG-04
MRVLKFGGTSLANPERFIQAADIIEKAHLKDQAAGVLSAPAKITNHLVAIVDKAIAGESF
ESNLKEATEIFHNIINGLYAINNKVDREGLLALVEAELAQIQSVASEAAKSKSLPDSVAA
TIHCRGEKLSIAMMQAWFEAKGYEVTRIDPVEKLLAHGSYLESSVDIAESTKRVDANSIP
KKNVVLMAGFTAGNENGELVLLGRNGSDYSAACLAACLKADCCEIWTDVDGVYTCDPRLV
PEAICLESMSYQEAMELSYFGAKVIHPRTIGPLVPLNIPCLIKNTANPDAKGTLIDGNVA
TDGLKVKGITNLDNVAMFNVSGAGMQGMVGMAARVFSTMSKAGISVILITQSSSEYSISF
CVPAKFEEKATACLNAEFAQELSKGDLDPIDMIRELSIISVVGDGMRTAKGIAARFFSSL
AQANISIVAIAQGSSERSISAVVPMNKAIEAVKATHQGLFSNKKSIEVFLV
>Hsom_Aa_|_CG-04
MRVLKFGGTSLANPQRFLQAAALIEKAHLEEQAAGVLSAPAKITNHLVALSEKAALNQPT
DGHFDEALEIFYNIINGLYAENTHFDLVGTKALIESEFAQIKGLLENIRQAGKVDDAVKA
TIDCRGEKLSIAMMNAWFEAKGYTVTVINPVEKLLAYGSYLESSVDIAESTKRVDAKSIP
AKNIVLMAGFTAGNDKGELVLLGRNGSDYSAACLAACLGASVCEIWTDVDGVYTCDPRLV
PDARLLSSLSYREAMELSYFGAKVIHPRTIGPLVEPQIPCLIKNTGNPEGAGSIIDNREN
ISEGLQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSAMSKASVSVILITQSSSEYSIS
FCVPTKAIEKAKAALNAEFEQELVAKDLDPVEVIHDLSIISVVGDGMAQSKGIAASFFSA
LASANISIVAIAQGSSERSISAVVPLNKAIEAVKATHQALFNNRKVVDMFLV
>Msuc_Ab_|_CG-04
MRVLKFGGTSLANPERFLQAARLIEKAHLEEQAAAVLSAPAKITNHLVALSEKASLNQPT
ETNFNEALDIFYNIINGLHEKNNNFDLKGTSQLIESEFNQLAELLEQIRQAGKVEDAVKA
TIDCRGEKLSIAMMKAWFEACGYEVTVINPVEKLLAYGNYLESSVDIEESAKRVDVASIP
KNNVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLNASACEIWTDVDGVFTCDPRLV
PDARLLPSLSYREAMELSYFGAKVIHPRTIGPLVRSNIPCLIKNTGNPTAPGSIIDGNEP
QSGELQVKGITNLDNVAMFNVSGPGMQGMVGMAARVFSTMSKAGVSVILITQSSSEYSIS
FCVPSKLAAKAKDALNTEFAKELLDKDLEPVEVIEDLSIISVVGDGMKQAKGIAARFFSA
LSQANISIVAIAQGSSERSISAVVAQNKAIEAVKSTHQALFNNKKSVDMFLV
>Hinf_Aa_|_CG-04
MRVLKFGGTSLANPERFSQAAKLIEQAHLEEQAAGVLSAPAKITNHLVALSEKAALNQST
DTHFNEAIEIFYNIINGLHAENNQFDLNGTKALIDAEFAQIKGLLEEIRQAGKVEDAVKA
TIDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAKGGYLESSVEIEESTKRVDAANIA
KDKVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASVCEIWTDVDGVYTCDPRLV
PDARLLPTLSYREAMELSYFGAKVIHPRTIGPLLPQNIPCVIKNTGNPSAPGSIIDGNVK
SESLQVKGITNLDNLAMFNVSGPGMQGMVGMASRVFSAMSGAGISVILITQSSSEYSISF
CVPVKSAEVAKTVLETEFANELNEHQLESIEVIKDLSIISVVGDGMKQAKGIAARFFSAL
AQANISIVAIAQGSSERSISAVVPQNKAIEAVKATHQALFNNKKVVDMFLV
>Pmul_Ab_|_CG-04
MRVLKFGGTSLANPERFSQAAQLIEKAHFEEQAAGVLSAPAKITNHLVALSEKASLNQPT
DANFNEAIEIFYHIIHGLHAENNRFDLEGTKALIDTEFAQISQLLEEIRQQGFVSDAVKA
TIDCRGEKLSIAMMKAWFEARGYDVTVIDPVEKLLAHGSYLESSVDIEESTKRVDAKSIP
TKNVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASACEIWTDVDGVFTCDPRLV
PDARLLPSLSYREAMELSYFGAKVIHPRTIGPLVQTNIPCLIKNTGNPSAPGSIIDGNIQ
SEQLQVKGITNLDNVAMFNVSGPGMQGMVGMASRVFSAMSNAGVSVILITQSSSEYSISF
CVPAKSVEVAKQALEKEFEQELKANDLEPIDVIRDLSIISVVGDGMKQAKGIAARFFSAL
AQANISIVAIAQGSSERSISAVVALNKAIEAVKATHQALFNNKKVVDVFLV
>Bflo_a_|_CG-04
MRVLKFGGTSLSNASQFIHVANILEKNAQKEQIAVVLSAPARVTNYLVEAINNTLRGNNI
LESVLNIENIFNTLLKDIAQFQSKFNYVVFHNTLKQEFNSLKQLLQGISLLNFCPDSVNA
HIICLGEKWSVILMQGILIAKDLKIINLDPVKSILTQGDGYSTSVVNIEESTCRIHNVLL
SHYADIILMAGFMAGNKKGELVTLGRNGSDYSAAILAACLQARRCEIWTDVDGIYTCDPR
QVPDARLLHELSYQEAMELSYFGAKILHPRTIVPIAQFHIPCLIKNTSKPDFSGTLISAK
NKDINIIAKGITYLKDMVMINVSGPGMKGMIGMAARVFAAMSRATCSVVLITQSSSEYSI
SFCVPYQEYAKACDALDEEFNLELKNGLLEPIGVICDLAIISVVGDGMRTQLGLSGKLFG
ALARASINIIAISQGSSERSISVVVKNNVTTIGVKAVHQTLFNTDQIIEVFII
>Sglo_Ab_|_CG-04
MRVLKFGGTSVANAERFIRVADILESNSRQGQVAAVLSAPAKITNHLVAMIDRTLNGSDI
QPNILDAEQIFSRLLDGLAAAQPEFDHAALRSVVEQEFAQLKQLLHGISLLKYCPDNVNA
AIICRGEKLSIALMEALLRARGFGVTVIDPVAKLLAQGGYLESTVDIAESTRHINDAAIP
ADHIILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPHQV
PDVRLLSQLSYQEAMELSYFGAKVLHPRTIVPIAQFQIPCLIKNTTNPQAPGTLIGPTSG
EEGNPVKGITHLNNMAMINVFGPGMKEMIGMAARVFAAMSRAGSSVVLITQSSSEYSISF
CVPQHELAGARRALEEEFYLELKDGLLEPLDVISRLAIISVVGDGMRAQRGLSAKLFVAL
ACANINIIAIAQGSSERSISVVVDNDSTTTGVRVAHQMLFNTDQVIEVFVI
>Plum_Ac_|_CG-04
MRVLKFGGTSVANYQRVLSVADIAEKKFSQGGVALVLSAPAKITNHLVAMIEKTVAGQEI
ITHMHDAEQIFVDLLQGMARAQPGFAYERLKMMVEQEFAQLKQVLHGISLLGQCPDSINA
SLICRGEKLSIAIMESVLQARGHKVTVIDPVENLLAQGHYLESTVDINESTKRIASLNIP
DDHIVLMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRATCCEIWTDVDGVYTCDPRVV
PDARLLKGMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTANPDAPGTLIGDGQK
DESTPVKGITNLSNMAMINVSGPGMKGMVGMAARVFAVMSRKGISVVLITQSSSEYSISF
CVPQRELERARQALSEEFYLELKEGVLDPLDVMENLSIISVVGDGMRTLRGISARFFSAL
ARGNINIVAIAQGSSERSISAVIDNEVATTAVRLCHQMLFNTDQVIEVFVV
>ENTE-2c_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
LPNISDAERIFTELLQGLADLQPGFPLAPLKAFVEQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKLSIAIMAGLLEARGHKVAVIDPVEKLLAVGHYLESTVDIAESTRRIAASKIP
ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTISPIAQFQIPCLIKNTGNPQAPGTLIGASHD
EDDLPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRNGISVVLITQSSSEYSISF
CVPQADCMRARRALEEEFYLELKEELLEPLSIQERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVSNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sent_Nc_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNSRQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
LPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASQIP
ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASSD
DDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMSRAGISVVLITQSSSEYSISF
CVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Styp_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTIGGQDA
LPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASQIP
ADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASSD
DDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMSRAGISVVLITQSSSEYSISF
CVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sdys_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRMP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRVDCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sson_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EGELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVMERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Ecol_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sfle_Ac_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Sboy_Ab_|_CG-04
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTSGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVI
>Patr_Ac_|_CG-04
MRVLKFGGTSVANAERFARVADIIENNARQGQVATVLSAPAKITNHLVAMIEKTVAGQDI
LPHLNDAETIFSSLLQGLAASQPGFEHARLKAFVEQEFAQLKHVLHGIALLGQCPDSVNA
AIICRGEKLSIAIMEAVFQARGYGVSVINPVEKLLAQGHYLESTVDITESTRRIAESAIP
KDHVILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCLIKNTENPQAPGTLIGMDST
DTQYPVKGITNLNNMAMVNVSGPGMKGMVGMAARVFAAMSRAGISVVLITQSSSEYSISF
CVSQNELARARKTLEDEFYLELKEGVLEPLDVMERLAIISVVGDGMRTLRGLSARLFSAL
ATANINIVAIAQGSSERSISVVVNNDVATTGVRVAHQMLFNTDQVIDVFVI
>Yent_Aa_|_CG-04
MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
SPNISDAERIFSELLRGLADAQPGFEYERLKALVAHEFAQLKHVLHGISLLGQCPDSINA
AIICRGEKLSIAIMEALFQAKGYKVSVINPVEKLLAQGHYLESTVDITESTRRIGSSSIP
TDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRVV
PDARLLKSMSYQEAMELSYFGASVLHPRTIAPIAQFQIPCLIKNTSNPQAPGTLIGGESS
DDGFPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
CVPQGELIRARQALEEEFYLELKDGLLEPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
ARANINIIAIAQGSSERSISVVVSNDAVTTGVRVCHQMLFNTDQVIEVFVI
>Ypes_Ab_|_CG-04
MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
SPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHLLHGISLLGQCPDSINA
SIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLESTVDITESTRRIGASGIP
SDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRTV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCLIKNTSNPQAPGTLIGGESI
DEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
CVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
ARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQMLFNTDQVIEVFVI
>Ypse_Ab_|_CG-04
MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITNHLVAMIDKMVAGQDI
SPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHLLHGISLLGQCPDSINA
SIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLESTVDITESTRRIGASGIP
SDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRTV
PDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCLIKNTSNPQAPGTLIGGESI
DEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMSRSGISVVLITQSSSEYSISF
CVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAIISVVGDGMRTLRGISARFFSAL
ARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQMLFNTDQVIEVFVI
>Ppro_Bd_|_CG-04
MRVFKFGGSSLSDAERFLRAADIIANNAQQGDVSVVLSAPGKVTNKLVSVIDSTVKTGEA
DLQVADLETVFNELFSGLKALVPSFDKDLVDAKLASSLGQLKQYVHGMKLLGLCPDNVYA
KIISKGERLSIVTMKALLEAKGQPASLIDPVAYLFAQGDYLEAHVDIEVSTQNFKRNPLP
EGHVNIMPGFTAGNSDGELVTLGRNGSDYSAAVLAACLRAECCEIWTDVDGVYSCDPRIV
PDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFSPQGAGTLIGLDTG
EDNLAIKGITTLKNLTMVNVSGPGMKGMVGMAARVFGAMSISGVSIVLITQSSSEYSISF
CIESDDKVAVQQALQNNFELELKEGLLEPIEFVDDSAIVTLVGDGMRTSQGVASRFFTSL
AEVNVNIIAIAQGSSERAISAVIPAMKVAEAVKACHENLFNSKHFLDVFVI
>Vfis_Ae_|_CG-04
MRVLKFGGSSLADSDRFLRAADIIANNAQQQEVSVVLSAPGKVTNKLVSVVDNLLTNGEA
ELQISELESVFTQLFSGISNTLPQVDLKLLENKLKDSISQLRQYAHGITLLGMCPDNVYA
KIISKGERISIVMMKAVLEAKGQPASLIDPVKYLYAKGDYLEGAVDVDVSTLNFKNEPLP
QGHVNIMPGFTAGNAKGELVTLGRNGSDYSAAVLAACLRAECCEIWTDVDGVYNCDPRLV
DDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
EDNLAIKGITTLNNLTMVNVSGPGMKGMVGMASRVFGAMSATGISIVLITQSSSEYSISF
CIEAEDKCKAEQVLREAFELELKDGLLEPVEFTDNVAIVTLVGDGMRTSKGVASQFFTSL
TEVNVNIIAIAQGSSERAISAVIPEDKVSESIKACHENLFNSKHFLDVFVV
>Vcho_Fd_|_CG-04
MHLEEGMRVLKFGGSSLADPERFLRAADIIANNAQQEEVAVVLSAPGKTTNKLVAVIESA
LRQGEVEAQIVELESSFYALLDGIKAQLPNLDDSAYQQQVHSSMTQLRQFVHGITLLGMC
PDNVNARIISKGERVSIQLMKAVMEAKGLPANLVDPVKYLLAKGDHLEAMVDVEISTQRF
RQAPLPQQHVNIMPGFTAGNAQGELVCLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYN
CDPRLVDDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFQIPCLIKNSFNPQGAGTL
IGQDTGEDKLAIKGITTLSNLTMVNVSGPGMKGMVGMASRVFGAMSAADVSIVLITQSSS
EYSISFCIEAQHKALAQQALADAFELELKDGLLEPVEFVDNVAIITLVGDGMRTSRGVAS
QFFSSLAEVHVNVIAIAQGSSERAISAVIPDDKISEAIKACHENLFNSKHFLDVFVV
>Vpar_Ae_|_CG-04
MRVLKFGGSSLADADRFLRAADIIANNAQQEEVAVVLSAPGKTTNKLVAVIEGALRNGEA
ELQINELEESFKTLFADIQAVLPNLEGAAFDNQVKTSLSQLRQFVHGINLLGMCPNNVNA
RIISKGERVSIQLMKAVLEAKGQKANLIDPVEYLYAKGDHLEAMVDVDVSTQNFRQNPLP
KDHVNIMPGFTAGNEKGELVTLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYNCDPRLV
EDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
EDNLAIKGITTLNDLTMVNVSGPGMKGMVGMASRVFGAMSSAGVSIVLITQSSSEYSISF
CIEADDKLKAQQVLADAFELELKDGLLEPVDFIDDVSIVTLVGDGMRTSRGVASRFFSSL
AEVNVNIVAIAQGSSERAISAVIPEDKISEAIKACHENLFNSKYFLDVFVV
>Vvul_Ab_|_CG-04
MRVLKFGGSSLADADRFLRAADIVANNAKQEEVSVVLSAPGKTTNKLVAVIESALKNGEA
ERQVDELDSAFKQLLSDIKQQLPSLNGDAYLKQVADSLSQLRQFVHGIGLLGMCPDNVNA
RIISKGERVSIQLMKAVLEAKGHLVNLIDPVDYLLAHGDHLEGMVDVDVSTQNFRSNPLP
QGHVHIMPGFTAGNKHGELVTLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYNCDPRLV
EDARLLKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTG
EDNLAIKGITTLNNLTMVNVSGPGMKGMVGMASRVFGAMSASGVSIVLITQSSSEYSISF
CIEAADRPLAEQALSDAFELELKDGLLEPVEFLTNVSIITLVGDGMRTSKGVASQFFASL
AEVSVNVIAIAQGSSERAISAVIPEDKISQAIKACHENLFNSKHYLDVFVV
>Ping_Ab_|_CG-04
MRVLKFGGSSLANAERFNQVADIVINNQQQSQIALVLSAPAGVTNNLVAVVEKTSMGISS
ESHLIDIQNIFADLIKTLKGTYAEFADELLETIFERELSHLSDLLEGVRLLAQCPASIEA
QILSKGELLSVACMKQLLIAKGHQVEIIKPQEKLISYKGGYLEAQIDIDVSRALFEKETI
VKDAIYLMPGFTAGNEQGETLVLGRNGSDYSAAVLAACLKAECCEIWTDVDGVYSCDPRL
VKDAKLLSSLSYAEAMELSYFGAKVLHPKTITPIAQHHIPCLIKNTYNPQANGTLIGVEH
GDEALQVKGISDLKGLSMLSISGPGMKGIVGMAGRIFTTVSRSGVSIILITQSSSEYSLS
FCIHSSETQKALYALNEEFSLEFKNHLLEPIDVVEKQAIISLVGDGMKKARGVAARFLTA
LTEASINITAIAQGSSERSISAVVSEEKAKEAVIACHQNFFGSVQYIDMFLI
>Ahyd_Ac_|_CG-04
MRVLKFGGSSLADAERFLRVADIAVNTHGQSQVALVLSAPAKVTNHLVALVEQTSRGMDA
SSTLFEINGIFSRLLAGLKAAYPALDDKALQARLTSELDQVERLMQGIRLLGLCPDNVQA
RILSRGENLSIAFMHELLRVRGLELDIIVPEQLLVTDGGYLEAHVDIEASRLRFAAKGLR
SDCLYLMPGFTGGSDKGETVLLGRNGSDYSAAVLAACVDAECCEIWTDVEGCYNCDPRLV
PDAYLLKTLSYKEAMELSYFGAKVLHPKTIAPVAQFHIPCLIKNSFNPQGPGTLIGVEQG
DDDLKVKAISDLSGMCMFNVSGPGMKGMVGMAGRIFSAVSRAGVSIVLITQSSSEYSVSF
CIHSYDCDKTRKVLEREFELEFKNQLLDPLEIMQDLAIISLIGDGMRTSKGMAARFFTSL
AQASINIVAIAQGSSERSISAVVRDRKVAEAIKACHQNFFGSQQFIDLFVV
>Asal_Ad_|_CG-04
MRVLKFGGSSLADAERFLRVADIAVNTHGQSQVALVLSAPAKVTNHLVALVEQTSRGMDA
SSTLFEINGIFSRLLAGLKAAYPALDDKALQARLTAELDQVERLMQGIRLLGLCPDNVQA
RILSRGENLSIAFMHELLRVRGLELGIIVPEQLLVTDGGYLEAHVDIEASRLRFAAKGLR
PAVEGQSPAGKASCLYLMPGFTGGSDKGETVLLGRNGSDYSAAVLAACVDAECCEIWTDV
EGCYNCDPRLVPDAYLLKTLSYKEAMELSYFGAKVLHPKTIAPVAQFHIPCLIKNSFNPQ
GPGTLIGVEQGDDDLKVKAISDLSGMCMFNVSGPGMKGMVGMAGRIFSAVSRAGVSIVLI
TQSSSEYSVSFCIHSYDQEKTRKVLEREFELEFKNQLLEPLDIISDLAIISLIGDGMRTS
KGMAARFFTSLAQASINIVAIAQGSSERSISAVVRDRKVAEAIKACHQNFFGSQQFIDLF
VV
>Patl_Ab_|_CG-04
MKVLKFGGSSLADAERYLRVKDICLDTHASNGAAVVLSAPKGVTNALSLLCEEAGSGKDY
GELFAKLNMVLFGILDDLKDTLPEFDDSELAPYIQRILNELNQHLEGFALLRCAPESVVA
KILSIGEYMSVNIFSQILTTLGTKNQIIDPAELILAEGDYLDSIADVAVSKARFSDVDSS
GDVVLIMPGFVAVNAEGEKVTLGRNGSDYSAAILAACIDAECCEIWTDVDGVYNADPNQV
DGAVLLDKLTYQEAMELSYFGAKVLHPKTIGPIAQHHIPCLIRNTLNPAAPGTLISNEKS
TKWTSVKGISHLDDMTMFNVAGPGMKGMVGMASRVFEVMSNANISISLITQSSSEYSISF
CIHSKDATRAQDLLEDSFALELANNLLDPIEVRHDLAIVTLVGDGMRHSQGLAAKFFSSL
AQARVNNVAIAQGSSERSISTVIESSKARKAVKVVHQNFFSNLHAIDVFLV
>Cpsy_Ab_|_CG-04
MRVLKFGGSSLASAERFRQVADIIHDKSKSSKLAVVVSAPQGVTNHLVAMTENISDEEKV
VADLGHFKRAITTIIDDLSASISNFNNQHCEQALANYEHQISRYMQGAMLLTYCPDHIRA
RIISTGERLSVAILDAVLQAYSVQVSLLAPEKFLYTNKSSLNAVADLVLSKEKFEHEYTE
LNQVSLMPGFIGVNADNNDGTPEVTTLGRNGSDYSAAVLAVCAVAECCEIWTDVDGVYNA
DPRYIKEAKLLDYLSYQEAMELSYFGASVLHPKTIGPIAQYHIPCLIKNTSNPSAPGTLI
SNENDQQKRVKAISNLDDLTMVNVSGPGMKGMVGMASRVFATMSRENISLVLISQSSSEY
CISFCIYSSDSARAKQSLHEEFELELLNGLLEPLALKGELSIVSLVGDGMHHQRGVAAKF
FSSLAQARVNVVAIAQDSSERSISVVVEQRKCMDAMKVSHQNFFSHKPTIDVFLV

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3