[Bio] / FigWebPages / ask_CG03.fasta Repository:
ViewVC logotype

View of /FigWebPages/ask_CG03.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (annotate)
Thu May 14 14:53:09 2009 UTC (10 years, 5 months ago) by dsouza
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
Supplementary material for Evolutionary Cohesion Group Analysis of Aspartokinase paper with Roy Jensen

>Lcas_Aa_|_CG-03
MKVVKFGGSSVADAGQFQKVKAIIDQDVNRQIVVISAAGKYGNATRKLTDTLYLIADGME
AGRDVEPLFNQVLARLEAINIALQLNVPLIKLLHTIRHHLAIRYSRDYLVSRGEFLTAHL
MAAYLGYTFVDAANLLFFNKAGAIDEAKTQTAYQQLASQHGIVVPGFYGRDADGHVKLMP
RGGSDISGAWLARLAHADLYENWTDVSGIKMADPRIIKDADSIDVMSYDELRELTYMGFS
VFQEEAVQPVRECGIPTRILNTNAPEVPGTLIIHDDDPANDLKTITGIAGRKHYLVITVR
KYQLALHLEVIQHALGVVAAHHLVVDYLPTGIDSFSLLIREPRRQVSVQELTAEIAAACQ
PDKMEVTENVALIAMVSRKLRQRPAIAGKVLAYLDDNLLNVQLVSQTNDDINLLIGVHDL
DYDKAVRVIYSSIHQNFQRPAPYIEGIA
>Ppen_Aa_|_CG-03
MVKVVKFGGSSLANAAQYQKVIEILRADPERRIVVVSAPGKRFKDDVKVTDLLIKYANAS
GENVKVARQAVLDRYQEIADAYHVSDSDFEQINVHLIDLANLHHANKACRLAHFKAAGER
LNAILMALVLKKFNVTARFVDPKQLGIKAHGDYNNAILDQHSYAQIEAVCSNLLDEAEYL
VVPGFYAYNQNGEVCTFSRGGSDITGAILARGFQAQLYENFTDVDSIYSADPKIIAQPHP
IREMTYREMRELAYAGFSVFHDEAIIPAIEAQVPIVIKNTDHPNLPGTVIEPEQNYASDL
EITGVASSSRFAALYIHKYLLNREVGFTLKLLKILYRYDISYEHMPSGIDDLTIIFNQNQ
ITDEILPSLLSDIREELHTDQLEWIDDYAILMVVGEGMRDKVGVVDRIVNALARKQIGIQ
MINQGASRISTMLGVHQNQVNQAVREIYREFFKNKGRAD
>Lpla_Ab_|_CG-03
MKVIKFGGSSLASSQQLQKVLAIVEADQKRKYVIVSAPGKRFDGDTKVTDLLIQYARQTI
HHQDTQAVTAAIIDRYAEIGHGFNVPEAQLTPIFETIRNLPKQSYADNTYLMAAFKAHGE
RLNAQLVAAVFQQSGLNARYLDPKDAGMVVTDVPDDAQIIKSSYDQLAKWANSEQILVIP
GFFAYNRNGQICTFSRGGSDITGAIIARGVHAERYENFTDVDAIYAVNPSLVAKPAAISE
MTFTEMRELSYAGFSVFHDEALIPAIEDNITVNVKNTNHPEAPGTLIQSTREPNPHYPVT
GIASSSSFCSLYLRKYLLNKEVGLGRKILTILENHHISYEHMPSGIDDLTIIFDEHQLTP
ELEKTLVAEISTAINPDEIYFTHDYSILMLVGENMRNRVGIMSRAATALANDNIKLIMVN
QGASEISIMFGVHDNDADQAVIALYKEFFD
>Ooen_Aa_|_CG-03
MKIVKFGGSSLSSGVQIRKVFQIVKSDPERRIVVVSAPGKRFKGDVKITDLLLKLAEAIL
NEEKTAQIYEQIFLRYQAIGDFFKIPRSGIEQLKEHLYSVAQADYPSNDFFRAALSAQGE
NMSAHLITLIFKQLGLKARLLTPKEVGLTVSGEARKAQILPGSYAKIAKTKFTDNEVLIF
PGFFGITKNGLINTFSRGGSDITGAILARGFGADLYENFTDVDSIYAVNPGLVADPAPIK
EMTYNEMRELSYAGFAVFHDEAILPAIQGKIPICVKNTNRPEMPGTKIVPRDKVSHKNKI
TGIASSHHFQAIYLHRYLINREVGFTAKILKIMADLNISYEHMPSGIDDLTIILDKNQLT
NGRKEKLTQRIKDEIQPDDLQWRNDYAIIMVVGEGLVNRVGAMADIVDPIRDAGISLTMV
NQGSSEISIMLGVRPEDEQKAVKAIYNDHFENGHPKKELQIPRASFKSVSKSLIANFFV
>Lmes_Ba_|_CG-03
MKVTKFGGSSLANGQQLQRVYDIIRADDDRKVVVVSAPGKRFKDDRKVTDLLISYAQATL
ADEDTTEIIETIKHRYHSIGEYFELPDYELADLDEQIEHLARKHYRSFDYLYAAFAAHGE
YLNAQLIAKVFNHLGMPARFVDPKEIGLVVDDNARSATFDAASYTTIGELDLSTSERLIV
PGFFGYTKNGDMATFSRGGSDITGAIMARGLRADLYENFTDVSAIYAVNPSIVEHPAAIQ
QMTYDEMRELSYAGFAVFHDEAIIPAIQGGIRINIKNTNDPDAPGTFIVPPTEVQQTRPV
TGIANSNRFAALYLHRYLLNKQVGFTLRILEILKRHNISYEHMPSGIDDLTIIFDKTMLT
QEQVDNMLSDIAAEIKPDTLKWIPSYGIIMVVGEGMRNRVGALTEIVAPLKERNISLQMV
NQGASEISIMLGIQPDLSDSAVEAIYTNIFK
>Lcas_Ab_|_CG-03
MRVVKFGGSSLANGSQFAKVVAIMKANPARQVIVTSAPGKRHPGDTKVTDLLIQYAQAVM
RHEAVAAIVAEIVARYQAIADDFELEASIMAAIEEELDQLPKLTFKNNDYLMAGFKARGE
KLNAFLMTAVLNHEGIEATYGEPKSLGIVVTDHPNDAEVSRETYRNLATFRRPIGVLVVP
GFYGYTSDDDIATFSRGGSDITGAILANGFHADLYENFTDVDGVAAADPRVVANPQMIRE
MTYREMRELSYGGFGVFHDEAILPAIAGQVPINLKNTNHPAAPGTMIVPEQHFVPKHAIT
GIVSSQHFGAIYLHRYLLNKEVGFTLKILQVLAHNGISYEHMPSGIDDLTIILDDRQLTE
AKRKTICAEIQAAVHPDVLKWIDDYAIIMVVGEGMAQRTGLIQTILQPLATAGVHVSMIN
EGASQISLMLGTSRESANRAVKTIYNAFFIPINQRLEVH
>Laci_Aa_|_CG-03
MKVVKFGGSSLATGNNVNKALNIIKNDSSRQVIVVSAPGKRTDDDIKVTDLLITYAYTSL
RSNNYDDTVEKIFRRYELIAQYFDLPESDLTKIKRLLLTLPTYDYPNADYRMATFKAHGE
RLNAILIAKILNHQGIKTRYLEPKDVGLIVTGTPNNAEVNPETYVNLKRINLKNNEKIIF
PGFYGITPSGHIATFSRGGSDITGAILARGFDAELYENFTDVDAIFSANPNIVTNPAPIK
KMTYQEMRELSYAGFSVFHDEALIPAIQGEIPVNVKNTNDPEKPGTLIVPEDGFIPKHTI
TGIAGGKNFAALYLRKYMLNKGAGFTLKLMEIFDRHHVSYEHMPSGIDDLTIIFKKDALS
DQLIDVICNEIQTSLNPDQMQWIDDYAITMVVGEGMKDKLTLCASILYPLGEKNISIQMI
NQGASQISIMIGTRRQDEEEVIKTIYQNFIENR
>Lgas_Aa_|_CG-03
MKVAKFGGSSVASGAKIAQVINILNNDNKRQVVVVSAPGKRSKSDTKVTDLLIKYANLTL
RKQNCEKIQAQIYARYAEIGKYFDLSMQGLNEIKALINDLPTHTFPNRDYLMAAFKAHGE
FLNAKLLTMIMKKQGFKVRLLTPRQAGLVVTGSPNDASVNPETYVNLRNLELDPTEKIIF
PGFYGISPSGNIATFSRGGSDITGAILARGFTAELYENFTDVDAIFSANPAIVSHPQPIS
KMTYREMRELSYAGFSVFHDEALIPAIQAQIPVNVKNTQHPERPGTMIVPETNFKAQHTI
TGIAGGKNFAALYLHKYLLNKGAGFTLKILQILDQHKVAYEHMPSGIDDITIIFKKEDLN
AELIDQICNEIQVSLNPDQMQWIDDYAITMVVGEGMRDKLSLCASILYPLGQKNISIQMI
NQGASQISIMIGTRRGDAEEVIRTIYQTFFN
>Laci_Ab_|_CG-03
MKVVKFGGSSLASGQSVEQALNIILNDPERQVIVVSAPGKRNNADTKVTDLLIKYAEQVL
KHEETDAIVKQIFARYQEIGYFFGLNDEKLQIIQNILLALPNQNYPDNNYLMAAFKAHGE
RLNARLIALILQHENIKSRFLDPVDAGLIVTGEPNDALVNPESYLNLDQIKIDPNEKIIF
PGFFGITPSGNIATFSRGGSDITGAILARGFHANIYENFTDVNGIFAANPNIVMHPISIK
KMTYREMRELSYAGFSVFHDEALIPAIQGQIPINVKNTQEPDNPGTMIVPEKNFSPDNTI
TGVTSQKHFSALYLHKYLLNKEAGFTLRILQILYKHNIPYEHMPSGIDDITIIFNNDFLN
DQLIDQICNEIQATINPDQLEWIDDYAIIMVVGEGMKKTPGVSRQILDSLASQGITPRMI
NQGASQISIMIGTKKEKADKAVKIIYQDFFN
>Lreu_Aa_|_CG-03
MKVVKFGGSSLANGEAFQNAINIITSDPQRRVIVTSAPGKRFADDIKVTDLLIKYAQTVI
AGQNPQEIVEQILNRYQEIAAYFGLPADKLIPLAERLEGLPNHTYPNDNYLLAAFKAHGE
RLNAQLMAILLQHLGYEARFVTPSEAGIIVTGTPNNANVIPETYANLSHFTFNENELLIF
PGFYGLTLAGHIATFSRGGSDITGAILARGLHASTYENFTDVDAIYSANPQIVDHPQPIT
TMTYREMRELSYAGFSVFHDEALIPAIQGNIPINVRNTNDPEKPGTMIVPDKDFQPSDIV
TGVVSGKHFAALYLHKYLLNKQAGFTLRILEILAKHNVSYEHMPSGIDDITIILDRNAIN
DQLIDTICNEIQEEINPDRLEWIDNYAITMVVGEGMRNRTGVIDDILMPLAEKHIAVPMI
NQGASRIAIMIGTYNEDADEAVRAIYHRFFAN
>Ssap_Ab_|_CG-03
MKVAKFGGSSVSNAEQIKKVLNIVNSDVDRKIIIVSAPGKRHSEDVKTTDLLIRLYEKVI
DRLDYTSKKKEIIQRYADIIDELNMDYHLLTSIDETLESYIAILKDKPSRLLDALLSCGE
DFNAQLIAEYNNSQGIPTRYVSPGEAGIQVTDLPQNAQILEQSYNTLYKLREYNEKLIIP
GFFGVSRQNYIVTFPRGGSDITGAIVARGVRADLYENFTDVSGIFRANPTIVKNPEVIDE
ITYREMRELSYAGFGVFHDEALQPLHKDRIPVVIKNTNRPDDIGTYIRHDREINSNNIVS
GISCDKGFTVLNIKKYLMNRQVGFTRKILAVLEDYGISFDHMPSGIDNISIIMRSKEIQN
REEQVLNDIRKNCDVDELSVEHDLAILMIVGEGMHRIVGTANTITHALAESNINLKMMNQ
GASEISIMFGIHVSDADKAVKSTYEYCYNGICLKS
>Shae_Ab_|_CG-03
MKVAKFGGSSVSNATQIKKVLDIVNSDSDRKIIIVSAPGKRHKDDVKTTDLLVRLYEKVM
NNLNYQDKKKEIIQRYADILHDLDMDDSLLKVIDDTLEEIISTLKDKPLRLYDAILSCGE
NFNAQLIASYNDSQGFKTTYLSPKDAGILVTDLPQQAQILEEAYEKISKLKDIEGKIIIP
GFFGVSKNDYVVTFPRGGSDITGAIIARGIRASLYENFTDVSGIYKANPNIINNPDLIEE
ITYREMRELSYAGFSVFHDEALQPLYKHRIPVVIKNTNRPQDKGTFIRHDRDVSDKNVII
GISCDKGFSVINIKKYLMNRQVGFTRKILEILEDYNISFDHMPSGIDSISIILRTYQLKG
KEKDVLNAIRKRCDVDELSIEHDLAILMIVGEGMNKAIGTANTITHALAESNINLKMINQ
GSSEISMMFGISIEDADKAVLSTYEYCYHGICLKNLNKQA
>Saur_Ab_|_CG-03
MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLYEKVI
NHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALLSCGE
DFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEKLIIP
GFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPELIEE
ITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAKNVIS
GISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSKQIQN
KETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLKMINQ
GASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
>Sepi_Ab_|_CG-03
MKVAKFGGSSVSTAEQIKKVLTIVNEDPERKIIIVSAPGKRHNDDIKTTDLLIRLYEKVL
NKLNYESKKQEIIQRYADIVEELGIGNDILITINDTLEEYIKNLSDKPNRLYDALLSCGE
NFNAQLIAQYNNSQGIPTRYISPKEAGLTVTDLPQQAQILDSAYNDIYKLRDYDEKLIIP
GFFGVSKQNYIVTFPRGGSDITGAIIARGVRASLYENFTDVSGIYKANPNIINNPELIEE
ITYREMRELSYAGFGVFHDEALQPLYKDRIPVVIKNTNRPNDKGTYILHDREIDSKNVIS
GISCDKGFTVINIKKYLMNRLVGFTRKILGVLEDYNISFDHMPSGIDNISIIMRTNQIQG
KESQVLNAIRKRCEVDELSIDHDLAVLMIVGEGMNQVVGTASKITHALSESNINLIMINQ
GASEISMMFGIHEADAEKAVLSTYEFCYNGVCLKNLCK
>Efae_Aa_|_CG-03
MNVVKFGGSSLASAPQLQKVLQIVKEEPRRTFVVVSAPGKRTPQDIKVTDLLIQYYQRYL
NNEEIESTISAIIRRYEDLFDELHLDKAVLADIAISIRQLATLPKENNAFLFDYFLASGE
DNNAKVVASFFKQNGLDARYISPKELGLLVTPEPGNARILPKALEKISVYRETQQILVIP
GFFGYTEAGEICTFSRGGSDITGSIVAAGVQADLYENFTDVDGIYVAHPGIIEQPQTIQE
LTYREMRELAYAGFAVLHDEALMPAYRANIPVVIKNTNNPHHPGTLITTSRKVKHAPVVG
IASDQGFASIYISKYLMNRELGFGRRLLEVLEKLALSYEHMPSGIDDITIVLREDQLTTE
IENRLMAQLQEVLAPDELRITHHLSMIMIVGEGMRQRIGVTAESTMALAKEKINLEMINQ
GSSEVSIMFGIKKEQEEKAIKALYRTFFHD
>Llac_Ca_|_CG-03
MKVAKFGGSSLASATQIKRVFDIVQADKLRKFIVVSAPGKRSGADTKVTDALISYYKAYK
TADDKGIQYYQNWIIARFREIYDELELKSSVIDEIADNIHNLAHLDLENVFTYDTFLAAG
ENNNAKLIADFFTHSGLPSRYVHPSDAGITVSSDPGNARLLVGAYEHIKYLNDLEETLII
PGFFGVTKEGEVCTFSRGGSDITGSIIAAGVSAELYENFTDVNGIFAAHPGIVKNPAYIA
ELTYREMRELAYSGFSVLHDEALVPAYRARVPLVIKNTNNPDHPGTKIVVQRETKGSPVV
GIASSSAFSSLYVSKYLMNREVGFGRKVLSVLENLGVRFEHMPTGIDDMSIIIRSRYLTQ
PISKALISNLTESLHPDEVYIDRDFSIITIVGEDMKEHVGVTARATAALSKQGISIAMLS
QGSSEVSVMFIVKEKYEQEALKAIYSAFFD
>Saga_Ba_|_CG-03
MKVVKFGGSSLASSQQLYKVLNIIKSDYTRRFVVVSAPGKRYEEDLKMTDALIQYYQNYI
NGKDIVKDQTWIINRYQEIISDLSLGSTIAEEITRSIEQLASLPIENNQFLYDCFLAAGE
DNNAKLVATFFNQNDIPARYVHPNEAGIIVTKEPCNARIIPGSYDKIENLCLYNEVLVIP
GFFGVTEDNQICTFSRGGSDITGSLIAAGIKADLYENFTDVDGIFAAHPGVVKNPHAIPE
LTYKEMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPQQPGTKIVLKHTRSNIAVTG
IASDSRFASINVSKYLMNREVGFGRKVLQILEDLNISFEHMPTGIDDLSIVLREKELTPI
KEQEILNYLTRKLEVDYVDIQHNLSTIVIVGENMKSQIGVTATATQALSREKINITMISQ
GSSEVSIMFVINSKDEKRAIKALYETFFQK
>Spne_Aa_|_CG-03
MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAEDTKVTDALIKYYRDYV
AGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLPIEENEFLYDTFLAAGE
NNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSSYDKIEELTNTNEVLVIP
GFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIHQPHSIPE
LTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIVLKHSNDEFPVVG
IAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEHMPTGIDDLSIILRSRQLTPI
KEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIGVTATATRALSENKINIQMMSQ
GSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED
>Ssan_Aa_|_CG-03
MKVVKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRHDDDIKVTDALIKYYREYI
AGNDVTPNQQWIINRYADMVAELGLKPKVLEKISKSITSLATLPIEDNAFLYDTFLAAGE
NNNAKLIAAYFSQNGVPASYVHPREAGLVVSSGLVVSSEPGNARILPSSYDKIEELNNSD
EVLVIPGFFGVTQDGQICTFSRGGSDITGSIIAAGVKADVYENFTDVDGIFAAHPGIVHK
PHSIPELTYREMRELAYAGFTVLHDEALLPAYRGKIPLVIKNTNNPEHPGTQIVHKHSKD
HLPVVGIAGDAGFVSINMSKYLMNREIGFGRRVLQILEDLNIGWEHMPTGIDDLSIILRE
RELTPIKEEEILRQLVQKAEVDHAEIEHDLSIIMIVGEKMKSHIGVTSTATKALSENNIN
IQMMSQGSSEVSIMFVVEKNQEKAAIRALYRAFFEPQTQE
>Ssui_Aa_|_CG-03
MRMKVIKFGGSSLASAGQLEKVFNIVQSDSERRFVVVSAPGKRNAEDTKVTDALIKYYKE
YVNGKDVTASQEWIINRYQAMVDELGFTANSMKKIADSIISLASLPIDDNEFLYDAFLAA
GEDNNAKLIAEYFTHRGLPARYVHPKKAGIIVSSEPGNARILPSSYDKIEELRDTDEVLI
IPGFFGVTVDNQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIKNPHSI
KELTYREMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPTHPGTRIVHKHTEQTVPV
VGIAADDGFVSINLSKYLMNREVGFGRKVLQILEDLNIRWEHMPTGIDDLSIVVRERELT
PIKEEEILRQLNTKMEVDKAEIEHGLSIIMIVGENMKSHVGVTATATTALSKQNVNLAMI
SQGASEVSVMFVVKTEEKKRALHALYEAFFNEQ
>Smut_Aa_|_CG-03
MKVVKFGGSSLASATQLEKVLNIIKSDEERRFVVVSAPGKRDAQDTKVTDALIRYYRSYT
SDKDVTADQSWIINRYRAIIDELGLGQNILEKITKAIVDLANLPIEDNDFLYDTFLAAGE
DNNAKLIAEYFRKNGLSARYIHPKKAGIIVTSEPGNARIIPSSYDKLEELRDSDEVLVIP
GFFGVTIDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHKPHSISE
LTYREMRELAYAGFSVLHDEALIPAYRGKIPLVIKNTNNPEHPGTKIVLAHTGATIPVVG
IAGDDDFVSINLSKYLMNREIGFGRKILQVLEELNIRWEHIPTGIDDMSIILRGRELTPI
KEQEIISQLTRKLEVDEVEIERNLSIIMIVGENMKNHIGVTAKAAEAFSKKHINLEMISQ
GSSEVSVMFVIKTEQEKQAVRALYQTFFMKDE
>Sthe_Aa_|_CG-03
MKVIKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRNDEDTKVTDALIKYYKHYI
KGADVKADQEWIINRYQAMVDELGFKSKEMVKIAKAITDLATLPIEDNDFLHDTFLAAGE
DNNAKLIAEYFRNNDIEARYVHPREAGILVSSEPGNARILPGSYDKLEELRESDEVLIIP
GFFGVTSDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHEPHSIPE
LTYKEMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIILEHQGATVPVVG
IASDDKFVSINMSKYLMNREVGFGRKVLQILEDLNIRWEHMPSGIDDLSIIIRERELTPI
KEQEILSYLTRELGVDEVEIEHGLSILVIVGENMRDHIGVTATAAKALSEKNINLEMISQ
GSSEVSVMFVIETEQEKEAVRALYDAFFRSNN
>Oihe_Ab_|_CG-03
MKVAKFGGSSVANAEQIQKVANIIKADPSRKVVVVSAPGKRFKDDVKITDLLIEFAGSHQ
RKQFEQSEKTLTIIMDRFKEIVDNLNLHTSIIDDIKQTIEEDLNKDLSPNQLLDAIKAIG
EDSSAKIVSAYLQHIGIDATYMNPKDAGIYVSNEPGHAQLLPESFPIIKKLRDIDKVVVI
PGFFGYAENGELVTFSRGGSDITGSILAAGTKAELYENFTDVDSVYAVNPTIVNNPKEIN
VLTYKEMRELSYAGFSVFHDEALIPAFREQIPVCIKNTNNPDSPGTMIVSERDARDNCVV
GIASDVGFCSLYVSKFLMNREVGFGRKLLNIFEDEDISFEHAPSGIDDMSVIFRDHKFTP
EKERIVIDRIKNELHVDTVSIHRDLAVIMVVGEGLVNTIGVAARATSSFSKARVNIEMIN
QGSSEVSMMFGIHAEDIDKAIQSLYHEFFEVSQKVEEAETKILT
>Cthe_Aa_|_CG-03
MKVAKFGGSSLADANQIRKVCDIILSDKDRKLIVVSAPGKRCKEDTKVTDLLIALGEKYY
KEGKADAELQAVIDRFDDIVKGLELSPDITQMVADDLKKRLECNNGNKDKFMDTIKAAGE
DNNAKVVAAYLVSRGIDAEYVNPKDAGLLLSEEYGNARVLPESYENLKRLRERDKIMIFP
GFFGYSKKGDVVTFPRGGSDITGAILAAAVKADVYENFTDVDSVFAANPNIIENPKPIAT
FTYREMRELSYSGFSVLHEETLEPVYRMEIPVCIKNTNNPSAPGTTIVPKRKLDNGPVIG
IASGTGFCCIYISKYMMNREIGFGRKVLSILEDEGLSYEHIPSGIDNMSIIIEQKQLDKA
KEERVVRRIKDELNVDDIKIEYDRALVMIVGEGMMSTVGIAARACTALAKANVNIEMINQ
GSSEVSMMFGVKAEDNVKAVKALYDEFFS
>Bcla_Ab_|_CG-03
MKVAKFGGSSVANAEQIKKVAAIIKADNKRKIVVVSAPGKRYADDAKMTDLLIALAEAKV
ADQPVEAAFNAVMNRYESIANDLELNRDVIAEIEADLKNRLEQTVTGKGRFLDIMKASGE
DNNAKLIAAYLSKIGLKATYINPKDAGLLVSDEPGNAQVLPEAYEALAKLAEIDGIVVFP
GFFGFSKLGNLVTFPRGGSDITGAILAAAVQAELYENFTDVDSVYAANPFIVEDPVEIKR
MTYREMRELSYAGFSVFHDEALIPAFRNDIPVCVKNTNNPKCSGTLILAERERSLNPIIG
IASDEGFATIYVRKYLMNREVGFGRHLLQILEDAGISYEHIPSGIDDTSVIIRQTQLSDQ
LENAIIERIKEELNVDDVHIEHDFAMVMLVGEGMHNTVGVTARASSALAKAGVNIEMINQ
GSSEVSLVFGIHSKDTKQAVRVLYEEFFGQKQ
>Bhal-1_Ac_|_CG-03
MKVTKFGGTSVASAEQIRKVATIVADDVERKIVVVSAPGKRHSSDTKVTDLLIRLGETYL
EKGYANEELEAVLRRYEEIAKGLELGQEIIDQIANDLHTRLTFNQSNPGAFMDQLKASGE
DNNAKLIAAYLQTKGMNAVYVSPKEAGLLVSDEPGNAQVLPEAYDHLKKLRERDEMIVFP
GFFGFSPDGALVTFPRGGSDITGAILAAGVKAELYENFTDVDSVFAANPNVVESPAQIRR
MTYREMRELSYAGFSVFHDEALIPAFRQKIPVCVKNTNNPSSPGTMILAEREYFLNPVIG
IAADKGFATIYVRKYLMNREIGFGRRLLQIIEDEGLSYEHIPSGIDDASVILRQEQLTDE
IEHRILARIKEELCVDDVFVEKDFAMVMIVGEGMHNTVGISARATAALARAHVNIEMINQ
GSSEVSLVLGIHEKDADAAVRELYEEFFGGAEETVQ
>Gkau_Ab_|_CG-03
MKVAKFGGSSVASAAQFRKVADIVSSDIERRIVVVSAPGKRYKDDVKVTDMLIQLAEQVV
AGEPHEETMEAIVKRYADIANELGLEADGFLAELVDDLQSKISAYRSEPPRLFDAIKASG
EDHNARLMALYLQDCGLEASYVSPLEAGIIVTDEPGNAQVLPESYDKLKQLRERRGVLVI
PGFFGYSRSGHIVTFPRGGSDITGSIVAAGVKADVYENFTDVDSIYCVNPSIVADARKLK
EITYREMRELSYSGFSVFHDEALEPVYRAGIPVCVKNTNNPAAPGTWIVAKRNHIDEPVA
GIASDTGFCSINISKYLMNREIGFGRRVLQILEDEGISYEHTPSGIDNMSVILRADQLAD
GKDERILARIREELAVDEVTIEYGLALIMVVGEGMEKTIGMAAKATTALANANINLEMIN
QGSSEVSMMFGVKEEVVNEAVRALYNAYFQQATVNHLS
>Linn_Ac_|_CG-03
MKVIKFGGSSLASGIQLNKVFQLVAEDSERKIVVVSAPGKRFKDDTKVTDLLIDCAAKAL
LGEDTSELFEAVIARYAGIALDTGMDDAIITQIRADLQKTISSDKSDPDKFLDRMKASGE
DNNAKLIAAYFKFKGLNANYVNPKDAGLFVTDEHASAQVLPESYDRLFALREREGIIVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
TERTIMTRLKEELNADQVIMQHGISLIMVVGEAMRHNVGITSRASKALSDAKVNIEMINQ
GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
>Lmon_Ac_|_CG-03
MKVIKFGGSSLASGIQLNKVFQLVAEDPDRKIVVVSAPGKRFKEDTKVTDLLIDCAAKAL
LGEDTSELFESVIARYAGIALDTGMSDEIINQIRADLQATISSDKSDPDKFLDRMKASGE
DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
>Lwel_Ac_|_CG-03
MKVIKFGGSSLASGIQLNKVFQLVAEDSDRKIVVVSAPGKRFKADTKVTDLLIDCATKAL
LGEDTSELFEAVIARYAGIALDTGMDDTIIKQIRSDLQATISSDKSDPDKFLDRMKASGE
DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFSEH
TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
GSSEVSIMFGVKEEQENTAVRALYDEFFSEVFV
>Blic_Ac_|_CG-03
MKVVKFGGSSLASGAQLEKVFQIVTSDPERRAVVVSAPGKRHPEDTKVTDLLIECAQQYL
LSKEATGLVEAIVGRYADIALELGLADDVINRIRADLLQLLEGDKTNPERFIDAIKASGE
DNNAKLVAAYFRHRGVEAHYVSPKDAGLFVTSEPGNAQVLPESYDNLFQLRQQKGIIIFP
GFFGFSQEGEVMTFSRSGSDITGSILANGLKAELYENFTDVDAVYSVNPAIVSNPKEIRE
LTYREMRELSYAGFSVFHDEALIPAFRARIPVQIKNTNNPDAEGTRVVATRDNTNGPVVG
IAGDSGFCSIYISKYLMNREIGFGRRVLQILEDEGLTYEHIPSGIDDITIILRQNQMDQA
AEKRMIKRIKEELDADEVAIEHNIALIMVVGEAMRHNVGTTARASKALSEAGVNIEMINQ
GSSEVSMMFGVKEAQEKQAVRALYQEFFAKVLV
>Bsub_Ac_|_CG-03
MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAEDTKVTDLLIACAEQYL
ATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVENPKEISE
LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
IASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEHVPSGIDDMTIILRQGQMDAA
TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
>Ldel_Ba_|_CG-03
MSKVVKFGGSSVANSEQFKKVKQIILADPDRKYVVTSACGKSGQEDHKVTDLLYLCAAHI
TYDVSYESIFQSIVDKYMEIKRSLGLKIDLAGEFAKIRQNMAQNLNLDYLVSRGEYLTGL
CLAEYLDADFRDASQVIRFHYDGSIDLDKSQELLKAQVDPGRRVVIPGFYGSLPNGVIKV
MSRGGSDITGSIVANAFDVDVYENWTDVSGFYVADPRIIKDPVQIPRVTYSELRQMSYMG
ANVLHDDAVFPVRQKNIPINVRNTNHPENPGTMIMNDCSELDAQEPPHVITGITGKQDFT
VITMVKSHVSAEAGFLRKVLAVFEKFQISIESVPVTVDTFSIVVQTKKIERYLYEIVAEL
QQDLHLDDIQVESQQAMLAVVGRVMRQMPGMSGKILSTLGDQQINIRTINQACDEQSIVI
GVNNQDLVPAIKAIYQQFISEERVER
>Cnov_Ab_|_CG-03
MNDIIVAKFGGSSLASAEQFRKVKKIVMEDSNRKYVVPSAPGKRDDNDYKITDLLYLCHA
HVENRISFDDVFKIIEERYKEIVKELGLSIDINFHLVNMKKIISQGVSVDYTVSRGEYLN
GIILANFLGYEFVDAAEIIAFDKYGCFDSDKTKELISNNLKNIERAVIPGFYGAMPNGDI
KTFSRGGSDITGAIVAKDVKAKLYENWTDVSGFLMADPRVVDNPKPIEKITYKELRELAY
MGASVLHEEAIFPAKEGNIPINIKNTNRPQDKGTLIVNEVNYKNGGGRITGIAGRKDFTT
IVIQKTYMNAEIGFGRRLLSALETYGISFEHMPSGIDTISIVIDDAQLDNKLDKLLEEIK
RQCNPDSIHVIPNMALIATVGMGMAKAVGTSEKIFSALAKSHVNIGMIDQGSSEINIIIG
VDAKDFETAIKSIYEAFE
>Ctet_Ab_|_CG-03
MNNIIVTKFGGSSLADVNQFKKVKNIVLGDQRRKYVVPSAPGKRHKEDQKITDLLYLCHA
NVEQNVEIDYIFTIIEKRFKDLAKELGVNIDIDTELENIKKNIKNGATADYTASRGEYLN
GLILSNYLGYEFVDPAEIIFFRRNGVFDSDKTQEAVSKRLCNIQKAVIPGFYGSLPNGDI
KTFSRGGSDVTGAIIARGVAADLYENWTDVSGFLMVDPNIVENPKNIEKITYRELRELAY
MGATVLHEEAVFPVRSAGIPINIKNTNRPEDKGTLIIDDLKPASYAGSITGIAGKKDFVV
IAIEKNMMNIEQGYCRKVLSVLEENYVSFEHMPSGVDAVSLVISKNQLNGKLDGILEEIE
MKCKPDSIEVYPNMALVAIVGRGMLRTVGMSAKIFDALAREKVNIRMIIQGSSEINIIVG
VENEDFEKALKSIYDEFAK
>Cace_Ab_|_CG-03
MKIVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAH
VKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNG
VILAKYLNAEFIDAAEVIFFDKSGCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVK
TFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYM
GATVLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVI
AIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKK
QCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGV
ETVDFEKAVKSIYNAFN
>Cbot_Bc_|_CG-03
MGKVIVAKFGGSSLSDSEQFRKVKSIIYDNENRRYIVPSAPGKRFKKDYKITDLLYLCHA
HRESAISFDDVFKHIEERYLNLAKELRVKVDIKNKLEEIKREIEAGASRDFAASRGEYLN
GLILADYLNYEFIDAAEIIHFKKYGSLDLRKTEKAIKEKIKNVKKAVIPGFYGALPDGTI
KTFSRGGSDVTGAIVARAVEASLYENWTDVSGFLMADPNIINDPKPIEVISYKELRELSY
MGAKVLHEESIFPVRDVKIPINIKNTNRAEDKGTLIVDDDKALNYTGSITGIAGKKGFTV
IAIHKMLMNSELGFCRKLLSILEENGVAFENIPSGIDSVSLVIEDSQLGNKLDIILEEIK
RQCNPDSLEVHVNMALIATVGNGMNRTKGISAKIFKGLLEEDVNIRMINQGSSEINIIVG
VENDDFERAIRGIYNTFIK

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3