[Bio] / FigWebPages / ask_CG03.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG03.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Lcas_Aa_|_CG-03
2 :     MKVVKFGGSSVADAGQFQKVKAIIDQDVNRQIVVISAAGKYGNATRKLTDTLYLIADGME
3 :     AGRDVEPLFNQVLARLEAINIALQLNVPLIKLLHTIRHHLAIRYSRDYLVSRGEFLTAHL
4 :     MAAYLGYTFVDAANLLFFNKAGAIDEAKTQTAYQQLASQHGIVVPGFYGRDADGHVKLMP
5 :     RGGSDISGAWLARLAHADLYENWTDVSGIKMADPRIIKDADSIDVMSYDELRELTYMGFS
6 :     VFQEEAVQPVRECGIPTRILNTNAPEVPGTLIIHDDDPANDLKTITGIAGRKHYLVITVR
7 :     KYQLALHLEVIQHALGVVAAHHLVVDYLPTGIDSFSLLIREPRRQVSVQELTAEIAAACQ
8 :     PDKMEVTENVALIAMVSRKLRQRPAIAGKVLAYLDDNLLNVQLVSQTNDDINLLIGVHDL
9 :     DYDKAVRVIYSSIHQNFQRPAPYIEGIA
10 :     >Ppen_Aa_|_CG-03
11 :     MVKVVKFGGSSLANAAQYQKVIEILRADPERRIVVVSAPGKRFKDDVKVTDLLIKYANAS
12 :     GENVKVARQAVLDRYQEIADAYHVSDSDFEQINVHLIDLANLHHANKACRLAHFKAAGER
13 :     LNAILMALVLKKFNVTARFVDPKQLGIKAHGDYNNAILDQHSYAQIEAVCSNLLDEAEYL
14 :     VVPGFYAYNQNGEVCTFSRGGSDITGAILARGFQAQLYENFTDVDSIYSADPKIIAQPHP
15 :     IREMTYREMRELAYAGFSVFHDEAIIPAIEAQVPIVIKNTDHPNLPGTVIEPEQNYASDL
16 :     EITGVASSSRFAALYIHKYLLNREVGFTLKLLKILYRYDISYEHMPSGIDDLTIIFNQNQ
17 :     ITDEILPSLLSDIREELHTDQLEWIDDYAILMVVGEGMRDKVGVVDRIVNALARKQIGIQ
18 :     MINQGASRISTMLGVHQNQVNQAVREIYREFFKNKGRAD
19 :     >Lpla_Ab_|_CG-03
20 :     MKVIKFGGSSLASSQQLQKVLAIVEADQKRKYVIVSAPGKRFDGDTKVTDLLIQYARQTI
21 :     HHQDTQAVTAAIIDRYAEIGHGFNVPEAQLTPIFETIRNLPKQSYADNTYLMAAFKAHGE
22 :     RLNAQLVAAVFQQSGLNARYLDPKDAGMVVTDVPDDAQIIKSSYDQLAKWANSEQILVIP
23 :     GFFAYNRNGQICTFSRGGSDITGAIIARGVHAERYENFTDVDAIYAVNPSLVAKPAAISE
24 :     MTFTEMRELSYAGFSVFHDEALIPAIEDNITVNVKNTNHPEAPGTLIQSTREPNPHYPVT
25 :     GIASSSSFCSLYLRKYLLNKEVGLGRKILTILENHHISYEHMPSGIDDLTIIFDEHQLTP
26 :     ELEKTLVAEISTAINPDEIYFTHDYSILMLVGENMRNRVGIMSRAATALANDNIKLIMVN
27 :     QGASEISIMFGVHDNDADQAVIALYKEFFD
28 :     >Ooen_Aa_|_CG-03
29 :     MKIVKFGGSSLSSGVQIRKVFQIVKSDPERRIVVVSAPGKRFKGDVKITDLLLKLAEAIL
30 :     NEEKTAQIYEQIFLRYQAIGDFFKIPRSGIEQLKEHLYSVAQADYPSNDFFRAALSAQGE
31 :     NMSAHLITLIFKQLGLKARLLTPKEVGLTVSGEARKAQILPGSYAKIAKTKFTDNEVLIF
32 :     PGFFGITKNGLINTFSRGGSDITGAILARGFGADLYENFTDVDSIYAVNPGLVADPAPIK
33 :     EMTYNEMRELSYAGFAVFHDEAILPAIQGKIPICVKNTNRPEMPGTKIVPRDKVSHKNKI
34 :     TGIASSHHFQAIYLHRYLINREVGFTAKILKIMADLNISYEHMPSGIDDLTIILDKNQLT
35 :     NGRKEKLTQRIKDEIQPDDLQWRNDYAIIMVVGEGLVNRVGAMADIVDPIRDAGISLTMV
36 :     NQGSSEISIMLGVRPEDEQKAVKAIYNDHFENGHPKKELQIPRASFKSVSKSLIANFFV
37 :     >Lmes_Ba_|_CG-03
38 :     MKVTKFGGSSLANGQQLQRVYDIIRADDDRKVVVVSAPGKRFKDDRKVTDLLISYAQATL
39 :     ADEDTTEIIETIKHRYHSIGEYFELPDYELADLDEQIEHLARKHYRSFDYLYAAFAAHGE
40 :     YLNAQLIAKVFNHLGMPARFVDPKEIGLVVDDNARSATFDAASYTTIGELDLSTSERLIV
41 :     PGFFGYTKNGDMATFSRGGSDITGAIMARGLRADLYENFTDVSAIYAVNPSIVEHPAAIQ
42 :     QMTYDEMRELSYAGFAVFHDEAIIPAIQGGIRINIKNTNDPDAPGTFIVPPTEVQQTRPV
43 :     TGIANSNRFAALYLHRYLLNKQVGFTLRILEILKRHNISYEHMPSGIDDLTIIFDKTMLT
44 :     QEQVDNMLSDIAAEIKPDTLKWIPSYGIIMVVGEGMRNRVGALTEIVAPLKERNISLQMV
45 :     NQGASEISIMLGIQPDLSDSAVEAIYTNIFK
46 :     >Lcas_Ab_|_CG-03
47 :     MRVVKFGGSSLANGSQFAKVVAIMKANPARQVIVTSAPGKRHPGDTKVTDLLIQYAQAVM
48 :     RHEAVAAIVAEIVARYQAIADDFELEASIMAAIEEELDQLPKLTFKNNDYLMAGFKARGE
49 :     KLNAFLMTAVLNHEGIEATYGEPKSLGIVVTDHPNDAEVSRETYRNLATFRRPIGVLVVP
50 :     GFYGYTSDDDIATFSRGGSDITGAILANGFHADLYENFTDVDGVAAADPRVVANPQMIRE
51 :     MTYREMRELSYGGFGVFHDEAILPAIAGQVPINLKNTNHPAAPGTMIVPEQHFVPKHAIT
52 :     GIVSSQHFGAIYLHRYLLNKEVGFTLKILQVLAHNGISYEHMPSGIDDLTIILDDRQLTE
53 :     AKRKTICAEIQAAVHPDVLKWIDDYAIIMVVGEGMAQRTGLIQTILQPLATAGVHVSMIN
54 :     EGASQISLMLGTSRESANRAVKTIYNAFFIPINQRLEVH
55 :     >Laci_Aa_|_CG-03
56 :     MKVVKFGGSSLATGNNVNKALNIIKNDSSRQVIVVSAPGKRTDDDIKVTDLLITYAYTSL
57 :     RSNNYDDTVEKIFRRYELIAQYFDLPESDLTKIKRLLLTLPTYDYPNADYRMATFKAHGE
58 :     RLNAILIAKILNHQGIKTRYLEPKDVGLIVTGTPNNAEVNPETYVNLKRINLKNNEKIIF
59 :     PGFYGITPSGHIATFSRGGSDITGAILARGFDAELYENFTDVDAIFSANPNIVTNPAPIK
60 :     KMTYQEMRELSYAGFSVFHDEALIPAIQGEIPVNVKNTNDPEKPGTLIVPEDGFIPKHTI
61 :     TGIAGGKNFAALYLRKYMLNKGAGFTLKLMEIFDRHHVSYEHMPSGIDDLTIIFKKDALS
62 :     DQLIDVICNEIQTSLNPDQMQWIDDYAITMVVGEGMKDKLTLCASILYPLGEKNISIQMI
63 :     NQGASQISIMIGTRRQDEEEVIKTIYQNFIENR
64 :     >Lgas_Aa_|_CG-03
65 :     MKVAKFGGSSVASGAKIAQVINILNNDNKRQVVVVSAPGKRSKSDTKVTDLLIKYANLTL
66 :     RKQNCEKIQAQIYARYAEIGKYFDLSMQGLNEIKALINDLPTHTFPNRDYLMAAFKAHGE
67 :     FLNAKLLTMIMKKQGFKVRLLTPRQAGLVVTGSPNDASVNPETYVNLRNLELDPTEKIIF
68 :     PGFYGISPSGNIATFSRGGSDITGAILARGFTAELYENFTDVDAIFSANPAIVSHPQPIS
69 :     KMTYREMRELSYAGFSVFHDEALIPAIQAQIPVNVKNTQHPERPGTMIVPETNFKAQHTI
70 :     TGIAGGKNFAALYLHKYLLNKGAGFTLKILQILDQHKVAYEHMPSGIDDITIIFKKEDLN
71 :     AELIDQICNEIQVSLNPDQMQWIDDYAITMVVGEGMRDKLSLCASILYPLGQKNISIQMI
72 :     NQGASQISIMIGTRRGDAEEVIRTIYQTFFN
73 :     >Laci_Ab_|_CG-03
74 :     MKVVKFGGSSLASGQSVEQALNIILNDPERQVIVVSAPGKRNNADTKVTDLLIKYAEQVL
75 :     KHEETDAIVKQIFARYQEIGYFFGLNDEKLQIIQNILLALPNQNYPDNNYLMAAFKAHGE
76 :     RLNARLIALILQHENIKSRFLDPVDAGLIVTGEPNDALVNPESYLNLDQIKIDPNEKIIF
77 :     PGFFGITPSGNIATFSRGGSDITGAILARGFHANIYENFTDVNGIFAANPNIVMHPISIK
78 :     KMTYREMRELSYAGFSVFHDEALIPAIQGQIPINVKNTQEPDNPGTMIVPEKNFSPDNTI
79 :     TGVTSQKHFSALYLHKYLLNKEAGFTLRILQILYKHNIPYEHMPSGIDDITIIFNNDFLN
80 :     DQLIDQICNEIQATINPDQLEWIDDYAIIMVVGEGMKKTPGVSRQILDSLASQGITPRMI
81 :     NQGASQISIMIGTKKEKADKAVKIIYQDFFN
82 :     >Lreu_Aa_|_CG-03
83 :     MKVVKFGGSSLANGEAFQNAINIITSDPQRRVIVTSAPGKRFADDIKVTDLLIKYAQTVI
84 :     AGQNPQEIVEQILNRYQEIAAYFGLPADKLIPLAERLEGLPNHTYPNDNYLLAAFKAHGE
85 :     RLNAQLMAILLQHLGYEARFVTPSEAGIIVTGTPNNANVIPETYANLSHFTFNENELLIF
86 :     PGFYGLTLAGHIATFSRGGSDITGAILARGLHASTYENFTDVDAIYSANPQIVDHPQPIT
87 :     TMTYREMRELSYAGFSVFHDEALIPAIQGNIPINVRNTNDPEKPGTMIVPDKDFQPSDIV
88 :     TGVVSGKHFAALYLHKYLLNKQAGFTLRILEILAKHNVSYEHMPSGIDDITIILDRNAIN
89 :     DQLIDTICNEIQEEINPDRLEWIDNYAITMVVGEGMRNRTGVIDDILMPLAEKHIAVPMI
90 :     NQGASRIAIMIGTYNEDADEAVRAIYHRFFAN
91 :     >Ssap_Ab_|_CG-03
92 :     MKVAKFGGSSVSNAEQIKKVLNIVNSDVDRKIIIVSAPGKRHSEDVKTTDLLIRLYEKVI
93 :     DRLDYTSKKKEIIQRYADIIDELNMDYHLLTSIDETLESYIAILKDKPSRLLDALLSCGE
94 :     DFNAQLIAEYNNSQGIPTRYVSPGEAGIQVTDLPQNAQILEQSYNTLYKLREYNEKLIIP
95 :     GFFGVSRQNYIVTFPRGGSDITGAIVARGVRADLYENFTDVSGIFRANPTIVKNPEVIDE
96 :     ITYREMRELSYAGFGVFHDEALQPLHKDRIPVVIKNTNRPDDIGTYIRHDREINSNNIVS
97 :     GISCDKGFTVLNIKKYLMNRQVGFTRKILAVLEDYGISFDHMPSGIDNISIIMRSKEIQN
98 :     REEQVLNDIRKNCDVDELSVEHDLAILMIVGEGMHRIVGTANTITHALAESNINLKMMNQ
99 :     GASEISIMFGIHVSDADKAVKSTYEYCYNGICLKS
100 :     >Shae_Ab_|_CG-03
101 :     MKVAKFGGSSVSNATQIKKVLDIVNSDSDRKIIIVSAPGKRHKDDVKTTDLLVRLYEKVM
102 :     NNLNYQDKKKEIIQRYADILHDLDMDDSLLKVIDDTLEEIISTLKDKPLRLYDAILSCGE
103 :     NFNAQLIASYNDSQGFKTTYLSPKDAGILVTDLPQQAQILEEAYEKISKLKDIEGKIIIP
104 :     GFFGVSKNDYVVTFPRGGSDITGAIIARGIRASLYENFTDVSGIYKANPNIINNPDLIEE
105 :     ITYREMRELSYAGFSVFHDEALQPLYKHRIPVVIKNTNRPQDKGTFIRHDRDVSDKNVII
106 :     GISCDKGFSVINIKKYLMNRQVGFTRKILEILEDYNISFDHMPSGIDSISIILRTYQLKG
107 :     KEKDVLNAIRKRCDVDELSIEHDLAILMIVGEGMNKAIGTANTITHALAESNINLKMINQ
108 :     GSSEISMMFGISIEDADKAVLSTYEYCYHGICLKNLNKQA
109 :     >Saur_Ab_|_CG-03
110 :     MKVSKFGGSSVSNATQIKKVLNIVNSDPERKIVIVSAPGKRHDNDIKTTDLLIRLYEKVI
111 :     NHLDYHDKKREIIQRYDDIVKELQMDESILRTIDVTLEHYINQLKNEPKRLLDALLSCGE
112 :     DFNAQLIALYNNSQGIPTKYISPKEAGIFVTDVPQEAQILDSAYSEIKKLRDYDEKLIIP
113 :     GFFGVSHEGYIVTFPRGGSDITGAIISSGVRATIYENFTDVSGIYKANPNIIKDPELIEE
114 :     ITYREMRELSYAGFSVFHDEALQPLYKDRIPVVIKNTNRPQDKGTFIVHDREINAKNVIS
115 :     GISCDKDFTVINIKKYLMNRQVGFTRKILGVLEDNNISFDHMPSGIDTISIVMRSKQIQN
116 :     KETKVLNEIRQKCDVDELSIEHDLAILMIVGEGMNKVIGTANKITHALAESKINLKMINQ
117 :     GASEISMMFGIHVDDAEKAVLSTYEFCYHGVALKNLCDKN
118 :     >Sepi_Ab_|_CG-03
119 :     MKVAKFGGSSVSTAEQIKKVLTIVNEDPERKIIIVSAPGKRHNDDIKTTDLLIRLYEKVL
120 :     NKLNYESKKQEIIQRYADIVEELGIGNDILITINDTLEEYIKNLSDKPNRLYDALLSCGE
121 :     NFNAQLIAQYNNSQGIPTRYISPKEAGLTVTDLPQQAQILDSAYNDIYKLRDYDEKLIIP
122 :     GFFGVSKQNYIVTFPRGGSDITGAIIARGVRASLYENFTDVSGIYKANPNIINNPELIEE
123 :     ITYREMRELSYAGFGVFHDEALQPLYKDRIPVVIKNTNRPNDKGTYILHDREIDSKNVIS
124 :     GISCDKGFTVINIKKYLMNRLVGFTRKILGVLEDYNISFDHMPSGIDNISIIMRTNQIQG
125 :     KESQVLNAIRKRCEVDELSIDHDLAVLMIVGEGMNQVVGTASKITHALSESNINLIMINQ
126 :     GASEISMMFGIHEADAEKAVLSTYEFCYNGVCLKNLCK
127 :     >Efae_Aa_|_CG-03
128 :     MNVVKFGGSSLASAPQLQKVLQIVKEEPRRTFVVVSAPGKRTPQDIKVTDLLIQYYQRYL
129 :     NNEEIESTISAIIRRYEDLFDELHLDKAVLADIAISIRQLATLPKENNAFLFDYFLASGE
130 :     DNNAKVVASFFKQNGLDARYISPKELGLLVTPEPGNARILPKALEKISVYRETQQILVIP
131 :     GFFGYTEAGEICTFSRGGSDITGSIVAAGVQADLYENFTDVDGIYVAHPGIIEQPQTIQE
132 :     LTYREMRELAYAGFAVLHDEALMPAYRANIPVVIKNTNNPHHPGTLITTSRKVKHAPVVG
133 :     IASDQGFASIYISKYLMNRELGFGRRLLEVLEKLALSYEHMPSGIDDITIVLREDQLTTE
134 :     IENRLMAQLQEVLAPDELRITHHLSMIMIVGEGMRQRIGVTAESTMALAKEKINLEMINQ
135 :     GSSEVSIMFGIKKEQEEKAIKALYRTFFHD
136 :     >Llac_Ca_|_CG-03
137 :     MKVAKFGGSSLASATQIKRVFDIVQADKLRKFIVVSAPGKRSGADTKVTDALISYYKAYK
138 :     TADDKGIQYYQNWIIARFREIYDELELKSSVIDEIADNIHNLAHLDLENVFTYDTFLAAG
139 :     ENNNAKLIADFFTHSGLPSRYVHPSDAGITVSSDPGNARLLVGAYEHIKYLNDLEETLII
140 :     PGFFGVTKEGEVCTFSRGGSDITGSIIAAGVSAELYENFTDVNGIFAAHPGIVKNPAYIA
141 :     ELTYREMRELAYSGFSVLHDEALVPAYRARVPLVIKNTNNPDHPGTKIVVQRETKGSPVV
142 :     GIASSSAFSSLYVSKYLMNREVGFGRKVLSVLENLGVRFEHMPTGIDDMSIIIRSRYLTQ
143 :     PISKALISNLTESLHPDEVYIDRDFSIITIVGEDMKEHVGVTARATAALSKQGISIAMLS
144 :     QGSSEVSVMFIVKEKYEQEALKAIYSAFFD
145 :     >Saga_Ba_|_CG-03
146 :     MKVVKFGGSSLASSQQLYKVLNIIKSDYTRRFVVVSAPGKRYEEDLKMTDALIQYYQNYI
147 :     NGKDIVKDQTWIINRYQEIISDLSLGSTIAEEITRSIEQLASLPIENNQFLYDCFLAAGE
148 :     DNNAKLVATFFNQNDIPARYVHPNEAGIIVTKEPCNARIIPGSYDKIENLCLYNEVLVIP
149 :     GFFGVTEDNQICTFSRGGSDITGSLIAAGIKADLYENFTDVDGIFAAHPGVVKNPHAIPE
150 :     LTYKEMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPQQPGTKIVLKHTRSNIAVTG
151 :     IASDSRFASINVSKYLMNREVGFGRKVLQILEDLNISFEHMPTGIDDLSIVLREKELTPI
152 :     KEQEILNYLTRKLEVDYVDIQHNLSTIVIVGENMKSQIGVTATATQALSREKINITMISQ
153 :     GSSEVSIMFVINSKDEKRAIKALYETFFQK
154 :     >Spne_Aa_|_CG-03
155 :     MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAEDTKVTDALIKYYRDYV
156 :     AGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLPIEENEFLYDTFLAAGE
157 :     NNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSSYDKIEELTNTNEVLVIP
158 :     GFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIHQPHSIPE
159 :     LTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIVLKHSNDEFPVVG
160 :     IAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEHMPTGIDDLSIILRSRQLTPI
161 :     KEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIGVTATATRALSENKINIQMMSQ
162 :     GSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED
163 :     >Ssan_Aa_|_CG-03
164 :     MKVVKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRHDDDIKVTDALIKYYREYI
165 :     AGNDVTPNQQWIINRYADMVAELGLKPKVLEKISKSITSLATLPIEDNAFLYDTFLAAGE
166 :     NNNAKLIAAYFSQNGVPASYVHPREAGLVVSSGLVVSSEPGNARILPSSYDKIEELNNSD
167 :     EVLVIPGFFGVTQDGQICTFSRGGSDITGSIIAAGVKADVYENFTDVDGIFAAHPGIVHK
168 :     PHSIPELTYREMRELAYAGFTVLHDEALLPAYRGKIPLVIKNTNNPEHPGTQIVHKHSKD
169 :     HLPVVGIAGDAGFVSINMSKYLMNREIGFGRRVLQILEDLNIGWEHMPTGIDDLSIILRE
170 :     RELTPIKEEEILRQLVQKAEVDHAEIEHDLSIIMIVGEKMKSHIGVTSTATKALSENNIN
171 :     IQMMSQGSSEVSIMFVVEKNQEKAAIRALYRAFFEPQTQE
172 :     >Ssui_Aa_|_CG-03
173 :     MRMKVIKFGGSSLASAGQLEKVFNIVQSDSERRFVVVSAPGKRNAEDTKVTDALIKYYKE
174 :     YVNGKDVTASQEWIINRYQAMVDELGFTANSMKKIADSIISLASLPIDDNEFLYDAFLAA
175 :     GEDNNAKLIAEYFTHRGLPARYVHPKKAGIIVSSEPGNARILPSSYDKIEELRDTDEVLI
176 :     IPGFFGVTVDNQICTFSRGGSDITGSIIAAGVKADLYENFTDVDGIFAAHPGIIKNPHSI
177 :     KELTYREMRELAYAGFSVLHDEALLPAYRGRIPLVIKNTNNPTHPGTRIVHKHTEQTVPV
178 :     VGIAADDGFVSINLSKYLMNREVGFGRKVLQILEDLNIRWEHMPTGIDDLSIVVRERELT
179 :     PIKEEEILRQLNTKMEVDKAEIEHGLSIIMIVGENMKSHVGVTATATTALSKQNVNLAMI
180 :     SQGASEVSVMFVVKTEEKKRALHALYEAFFNEQ
181 :     >Smut_Aa_|_CG-03
182 :     MKVVKFGGSSLASATQLEKVLNIIKSDEERRFVVVSAPGKRDAQDTKVTDALIRYYRSYT
183 :     SDKDVTADQSWIINRYRAIIDELGLGQNILEKITKAIVDLANLPIEDNDFLYDTFLAAGE
184 :     DNNAKLIAEYFRKNGLSARYIHPKKAGIIVTSEPGNARIIPSSYDKLEELRDSDEVLVIP
185 :     GFFGVTIDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHKPHSISE
186 :     LTYREMRELAYAGFSVLHDEALIPAYRGKIPLVIKNTNNPEHPGTKIVLAHTGATIPVVG
187 :     IAGDDDFVSINLSKYLMNREIGFGRKILQVLEELNIRWEHIPTGIDDMSIILRGRELTPI
188 :     KEQEIISQLTRKLEVDEVEIERNLSIIMIVGENMKNHIGVTAKAAEAFSKKHINLEMISQ
189 :     GSSEVSVMFVIKTEQEKQAVRALYQTFFMKDE
190 :     >Sthe_Aa_|_CG-03
191 :     MKVIKFGGSSLASATQLEKVLNIVKSDPERRFVVVSAPGKRNDEDTKVTDALIKYYKHYI
192 :     KGADVKADQEWIINRYQAMVDELGFKSKEMVKIAKAITDLATLPIEDNDFLHDTFLAAGE
193 :     DNNAKLIAEYFRNNDIEARYVHPREAGILVSSEPGNARILPGSYDKLEELRESDEVLIIP
194 :     GFFGVTSDNQICTFSRGGSDITGSIVAAGVKADLYENFTDVDGIFAAHPGVVHEPHSIPE
195 :     LTYKEMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIILEHQGATVPVVG
196 :     IASDDKFVSINMSKYLMNREVGFGRKVLQILEDLNIRWEHMPSGIDDLSIIIRERELTPI
197 :     KEQEILSYLTRELGVDEVEIEHGLSILVIVGENMRDHIGVTATAAKALSEKNINLEMISQ
198 :     GSSEVSVMFVIETEQEKEAVRALYDAFFRSNN
199 :     >Oihe_Ab_|_CG-03
200 :     MKVAKFGGSSVANAEQIQKVANIIKADPSRKVVVVSAPGKRFKDDVKITDLLIEFAGSHQ
201 :     RKQFEQSEKTLTIIMDRFKEIVDNLNLHTSIIDDIKQTIEEDLNKDLSPNQLLDAIKAIG
202 :     EDSSAKIVSAYLQHIGIDATYMNPKDAGIYVSNEPGHAQLLPESFPIIKKLRDIDKVVVI
203 :     PGFFGYAENGELVTFSRGGSDITGSILAAGTKAELYENFTDVDSVYAVNPTIVNNPKEIN
204 :     VLTYKEMRELSYAGFSVFHDEALIPAFREQIPVCIKNTNNPDSPGTMIVSERDARDNCVV
205 :     GIASDVGFCSLYVSKFLMNREVGFGRKLLNIFEDEDISFEHAPSGIDDMSVIFRDHKFTP
206 :     EKERIVIDRIKNELHVDTVSIHRDLAVIMVVGEGLVNTIGVAARATSSFSKARVNIEMIN
207 :     QGSSEVSMMFGIHAEDIDKAIQSLYHEFFEVSQKVEEAETKILT
208 :     >Cthe_Aa_|_CG-03
209 :     MKVAKFGGSSLADANQIRKVCDIILSDKDRKLIVVSAPGKRCKEDTKVTDLLIALGEKYY
210 :     KEGKADAELQAVIDRFDDIVKGLELSPDITQMVADDLKKRLECNNGNKDKFMDTIKAAGE
211 :     DNNAKVVAAYLVSRGIDAEYVNPKDAGLLLSEEYGNARVLPESYENLKRLRERDKIMIFP
212 :     GFFGYSKKGDVVTFPRGGSDITGAILAAAVKADVYENFTDVDSVFAANPNIIENPKPIAT
213 :     FTYREMRELSYSGFSVLHEETLEPVYRMEIPVCIKNTNNPSAPGTTIVPKRKLDNGPVIG
214 :     IASGTGFCCIYISKYMMNREIGFGRKVLSILEDEGLSYEHIPSGIDNMSIIIEQKQLDKA
215 :     KEERVVRRIKDELNVDDIKIEYDRALVMIVGEGMMSTVGIAARACTALAKANVNIEMINQ
216 :     GSSEVSMMFGVKAEDNVKAVKALYDEFFS
217 :     >Bcla_Ab_|_CG-03
218 :     MKVAKFGGSSVANAEQIKKVAAIIKADNKRKIVVVSAPGKRYADDAKMTDLLIALAEAKV
219 :     ADQPVEAAFNAVMNRYESIANDLELNRDVIAEIEADLKNRLEQTVTGKGRFLDIMKASGE
220 :     DNNAKLIAAYLSKIGLKATYINPKDAGLLVSDEPGNAQVLPEAYEALAKLAEIDGIVVFP
221 :     GFFGFSKLGNLVTFPRGGSDITGAILAAAVQAELYENFTDVDSVYAANPFIVEDPVEIKR
222 :     MTYREMRELSYAGFSVFHDEALIPAFRNDIPVCVKNTNNPKCSGTLILAERERSLNPIIG
223 :     IASDEGFATIYVRKYLMNREVGFGRHLLQILEDAGISYEHIPSGIDDTSVIIRQTQLSDQ
224 :     LENAIIERIKEELNVDDVHIEHDFAMVMLVGEGMHNTVGVTARASSALAKAGVNIEMINQ
225 :     GSSEVSLVFGIHSKDTKQAVRVLYEEFFGQKQ
226 :     >Bhal-1_Ac_|_CG-03
227 :     MKVTKFGGTSVASAEQIRKVATIVADDVERKIVVVSAPGKRHSSDTKVTDLLIRLGETYL
228 :     EKGYANEELEAVLRRYEEIAKGLELGQEIIDQIANDLHTRLTFNQSNPGAFMDQLKASGE
229 :     DNNAKLIAAYLQTKGMNAVYVSPKEAGLLVSDEPGNAQVLPEAYDHLKKLRERDEMIVFP
230 :     GFFGFSPDGALVTFPRGGSDITGAILAAGVKAELYENFTDVDSVFAANPNVVESPAQIRR
231 :     MTYREMRELSYAGFSVFHDEALIPAFRQKIPVCVKNTNNPSSPGTMILAEREYFLNPVIG
232 :     IAADKGFATIYVRKYLMNREIGFGRRLLQIIEDEGLSYEHIPSGIDDASVILRQEQLTDE
233 :     IEHRILARIKEELCVDDVFVEKDFAMVMIVGEGMHNTVGISARATAALARAHVNIEMINQ
234 :     GSSEVSLVLGIHEKDADAAVRELYEEFFGGAEETVQ
235 :     >Gkau_Ab_|_CG-03
236 :     MKVAKFGGSSVASAAQFRKVADIVSSDIERRIVVVSAPGKRYKDDVKVTDMLIQLAEQVV
237 :     AGEPHEETMEAIVKRYADIANELGLEADGFLAELVDDLQSKISAYRSEPPRLFDAIKASG
238 :     EDHNARLMALYLQDCGLEASYVSPLEAGIIVTDEPGNAQVLPESYDKLKQLRERRGVLVI
239 :     PGFFGYSRSGHIVTFPRGGSDITGSIVAAGVKADVYENFTDVDSIYCVNPSIVADARKLK
240 :     EITYREMRELSYSGFSVFHDEALEPVYRAGIPVCVKNTNNPAAPGTWIVAKRNHIDEPVA
241 :     GIASDTGFCSINISKYLMNREIGFGRRVLQILEDEGISYEHTPSGIDNMSVILRADQLAD
242 :     GKDERILARIREELAVDEVTIEYGLALIMVVGEGMEKTIGMAAKATTALANANINLEMIN
243 :     QGSSEVSMMFGVKEEVVNEAVRALYNAYFQQATVNHLS
244 :     >Linn_Ac_|_CG-03
245 :     MKVIKFGGSSLASGIQLNKVFQLVAEDSERKIVVVSAPGKRFKDDTKVTDLLIDCAAKAL
246 :     LGEDTSELFEAVIARYAGIALDTGMDDAIITQIRADLQKTISSDKSDPDKFLDRMKASGE
247 :     DNNAKLIAAYFKFKGLNANYVNPKDAGLFVTDEHASAQVLPESYDRLFALREREGIIVFP
248 :     GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
249 :     LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
250 :     IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
251 :     TERTIMTRLKEELNADQVIMQHGISLIMVVGEAMRHNVGITSRASKALSDAKVNIEMINQ
252 :     GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
253 :     >Lmon_Ac_|_CG-03
254 :     MKVIKFGGSSLASGIQLNKVFQLVAEDPDRKIVVVSAPGKRFKEDTKVTDLLIDCAAKAL
255 :     LGEDTSELFESVIARYAGIALDTGMSDEIINQIRADLQATISSDKSDPDKFLDRMKASGE
256 :     DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
257 :     GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
258 :     LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
259 :     IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFGED
260 :     TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
261 :     GSSEVSIMFGVKEEQENTAVRALYNEFFSEVLV
262 :     >Lwel_Ac_|_CG-03
263 :     MKVIKFGGSSLASGIQLNKVFQLVAEDSDRKIVVVSAPGKRFKADTKVTDLLIDCATKAL
264 :     LGEDTSELFEAVIARYAGIALDTGMDDTIIKQIRSDLQATISSDKSDPDKFLDRMKASGE
265 :     DNNAKLIAAYFKFKGLNANYINPKDAGLLVTDEHASAQVLPESYDRLFALREREGIIVFP
266 :     GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
267 :     LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENNNGPVVG
268 :     IASDDGFCSIYISKYLMNREIGFGRKVLQILEDAGLNYEHMPSGIDDLTIIIRENQFSEH
269 :     TEQTIMSRLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
270 :     GSSEVSIMFGVKEEQENTAVRALYDEFFSEVFV
271 :     >Blic_Ac_|_CG-03
272 :     MKVVKFGGSSLASGAQLEKVFQIVTSDPERRAVVVSAPGKRHPEDTKVTDLLIECAQQYL
273 :     LSKEATGLVEAIVGRYADIALELGLADDVINRIRADLLQLLEGDKTNPERFIDAIKASGE
274 :     DNNAKLVAAYFRHRGVEAHYVSPKDAGLFVTSEPGNAQVLPESYDNLFQLRQQKGIIIFP
275 :     GFFGFSQEGEVMTFSRSGSDITGSILANGLKAELYENFTDVDAVYSVNPAIVSNPKEIRE
276 :     LTYREMRELSYAGFSVFHDEALIPAFRARIPVQIKNTNNPDAEGTRVVATRDNTNGPVVG
277 :     IAGDSGFCSIYISKYLMNREIGFGRRVLQILEDEGLTYEHIPSGIDDITIILRQNQMDQA
278 :     AEKRMIKRIKEELDADEVAIEHNIALIMVVGEAMRHNVGTTARASKALSEAGVNIEMINQ
279 :     GSSEVSMMFGVKEAQEKQAVRALYQEFFAKVLV
280 :     >Bsub_Ac_|_CG-03
281 :     MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAEDTKVTDLLIACAEQYL
282 :     ATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGDKSNPEQYLDAVKASGE
283 :     DNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPESYQNLYRLRERDGLIIFP
284 :     GFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVDAVYSVNPSFVENPKEISE
285 :     LTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPSAEGTRVVSKRDNTNGPVVG
286 :     IASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEHVPSGIDDMTIILRQGQMDAA
287 :     TERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVGTTARAAKALSEAQVNIEMINQ
288 :     GSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS
289 :     >Ldel_Ba_|_CG-03
290 :     MSKVVKFGGSSVANSEQFKKVKQIILADPDRKYVVTSACGKSGQEDHKVTDLLYLCAAHI
291 :     TYDVSYESIFQSIVDKYMEIKRSLGLKIDLAGEFAKIRQNMAQNLNLDYLVSRGEYLTGL
292 :     CLAEYLDADFRDASQVIRFHYDGSIDLDKSQELLKAQVDPGRRVVIPGFYGSLPNGVIKV
293 :     MSRGGSDITGSIVANAFDVDVYENWTDVSGFYVADPRIIKDPVQIPRVTYSELRQMSYMG
294 :     ANVLHDDAVFPVRQKNIPINVRNTNHPENPGTMIMNDCSELDAQEPPHVITGITGKQDFT
295 :     VITMVKSHVSAEAGFLRKVLAVFEKFQISIESVPVTVDTFSIVVQTKKIERYLYEIVAEL
296 :     QQDLHLDDIQVESQQAMLAVVGRVMRQMPGMSGKILSTLGDQQINIRTINQACDEQSIVI
297 :     GVNNQDLVPAIKAIYQQFISEERVER
298 :     >Cnov_Ab_|_CG-03
299 :     MNDIIVAKFGGSSLASAEQFRKVKKIVMEDSNRKYVVPSAPGKRDDNDYKITDLLYLCHA
300 :     HVENRISFDDVFKIIEERYKEIVKELGLSIDINFHLVNMKKIISQGVSVDYTVSRGEYLN
301 :     GIILANFLGYEFVDAAEIIAFDKYGCFDSDKTKELISNNLKNIERAVIPGFYGAMPNGDI
302 :     KTFSRGGSDITGAIVAKDVKAKLYENWTDVSGFLMADPRVVDNPKPIEKITYKELRELAY
303 :     MGASVLHEEAIFPAKEGNIPINIKNTNRPQDKGTLIVNEVNYKNGGGRITGIAGRKDFTT
304 :     IVIQKTYMNAEIGFGRRLLSALETYGISFEHMPSGIDTISIVIDDAQLDNKLDKLLEEIK
305 :     RQCNPDSIHVIPNMALIATVGMGMAKAVGTSEKIFSALAKSHVNIGMIDQGSSEINIIIG
306 :     VDAKDFETAIKSIYEAFE
307 :     >Ctet_Ab_|_CG-03
308 :     MNNIIVTKFGGSSLADVNQFKKVKNIVLGDQRRKYVVPSAPGKRHKEDQKITDLLYLCHA
309 :     NVEQNVEIDYIFTIIEKRFKDLAKELGVNIDIDTELENIKKNIKNGATADYTASRGEYLN
310 :     GLILSNYLGYEFVDPAEIIFFRRNGVFDSDKTQEAVSKRLCNIQKAVIPGFYGSLPNGDI
311 :     KTFSRGGSDVTGAIIARGVAADLYENWTDVSGFLMVDPNIVENPKNIEKITYRELRELAY
312 :     MGATVLHEEAVFPVRSAGIPINIKNTNRPEDKGTLIIDDLKPASYAGSITGIAGKKDFVV
313 :     IAIEKNMMNIEQGYCRKVLSVLEENYVSFEHMPSGVDAVSLVISKNQLNGKLDGILEEIE
314 :     MKCKPDSIEVYPNMALVAIVGRGMLRTVGMSAKIFDALAREKVNIRMIIQGSSEINIIVG
315 :     VENEDFEKALKSIYDEFAK
316 :     >Cace_Ab_|_CG-03
317 :     MKIVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAH
318 :     VKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNG
319 :     VILAKYLNAEFIDAAEVIFFDKSGCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVK
320 :     TFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYM
321 :     GATVLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVI
322 :     AIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKK
323 :     QCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGV
324 :     ETVDFEKAVKSIYNAFN
325 :     >Cbot_Bc_|_CG-03
326 :     MGKVIVAKFGGSSLSDSEQFRKVKSIIYDNENRRYIVPSAPGKRFKKDYKITDLLYLCHA
327 :     HRESAISFDDVFKHIEERYLNLAKELRVKVDIKNKLEEIKREIEAGASRDFAASRGEYLN
328 :     GLILADYLNYEFIDAAEIIHFKKYGSLDLRKTEKAIKEKIKNVKKAVIPGFYGALPDGTI
329 :     KTFSRGGSDVTGAIVARAVEASLYENWTDVSGFLMADPNIINDPKPIEVISYKELRELSY
330 :     MGAKVLHEESIFPVRDVKIPINIKNTNRAEDKGTLIVDDDKALNYTGSITGIAGKKGFTV
331 :     IAIHKMLMNSELGFCRKLLSILEENGVAFENIPSGIDSVSLVIEDSQLGNKLDIILEEIK
332 :     RQCNPDSLEVHVNMALIATVGNGMNRTKGISAKIFKGLLEEDVNIRMINQGSSEINIIVG
333 :     VENDDFERAIRGIYNTFIK

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3