[Bio] / FigWebPages / ask_CG02.fasta Repository:
ViewVC logotype

Annotation of /FigWebPages/ask_CG02.fasta

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download)

1 : dsouza 1.1 >Dpsy_Aa_|_CG-02
2 :     MMVRIMKPLRIEKIGGTTMSRFGEVLDNVIFYDSEDIFNRIYVVSAYSGVTNALLEHKKT
3 :     HQPGIYQTFVQNEACDMAMERLKTTLCEINRGFADIGLDLEVANNFICKRIQDAVEVLHS
4 :     MANVLSSGYVNRSEMLLAARELLASIGEMHSAFNSANILQNRGYKASYVDLSGWQDSRDM
5 :     TIDQRILETFTKFDPSDTICIATGYAKGREGIMREFDRGYSEVTFSKIAVLLKASEAIIH
6 :     KEYHLCSGDPLIIGEDKVHPICNTNYDVADQLADVGMEAIHPKASKQIEIAGISIRIKNS
7 :     FDPSHSGTLFTKEYICPQSKTEVITGSDKVTCLEVHDTRMVGEVGFDMKIMEVLSAHQVS
8 :     YINKATNANTIGVIVYDNDCTEELLRDLRAEFELVTDMHTAIVCAIGSNIAKPGILAKAT
9 :     NALATSHINILAVSQTSRQTNMQFIINREHFKEAQRVLHAALCEEGES
10 :     >Adeh_Ab_|_CG-02
11 :     MWRTFGYHRGPSSPGPESRTATQSPGTFRMISVEKIGGTSMSRFDEVLRNIMLRDPSRVY
12 :     GRVYVVSAYAGVTNQLLEHKKTGEPGVYARFANGGDFTTAIEALTGKLKAINAGLAPLGL
13 :     DLARADGFIEKRMKELRALLDSMRHVLASGYVRRDSVLLAAREMLAAVGEAHSAFNSVEL
14 :     LRAKGVEASLMDLSGFDDDDPLTIDERIHKCFTGVDVTRQVVVVTGYTKGVEGIMREFDR
15 :     GYSEVTFSKVAVELRADEAVIHKEYHLSSADPELVGAQNTVVVGMTNYDVADQLADVGME
16 :     AIHPKAAKPMELAGIAIRLKNTFEPEHPGTLITKDYVGSQARIEVIAGSPKVSAVEIHDP
17 :     SMVGTVGFDLGVMEIFQRHGISYILKATNANSITHVVWEKSVSSAFVEELENQYQKVTVV
18 :     PSAIVCVIGSNIAFPGVLARATQALADNGINVNAFSQSLRQTNMQFVIDRKDYKQAVIAL
19 :     NRALCLNPPTQAVA
20 :     >Ppro_Ba_|_CG-02
21 :     MSYTVEKIGGTSMSAFDAILDNIMLRPKSPYNRVFVVSAYGGITDALLECKRSGKPGIYQ
22 :     YIAKRDETWLKAVADLEMRMLLVNENMFADPLNRRRADQFIKSRITDAVSCITNIIETCQ
23 :     YGQFSLRHYLPQIREFLSSLGEAHSAYNTALKLKTLGINATFVDLSGWDNKSYGSLDDVI
24 :     KRAFTNIDVTKELPIPTLLQNADFADSNFMILCPKNSSIFNDHGYITYYLSGGMEILNKL
25 :     LYKAEKRYSNSTITGCMVTFISIIGASINTNTALSKGILALTDKQISPIAAHSSMRNVNV
26 :     QFVVEDKYYKAAICALHSEFINQSENTTRKIA
27 :     >Vcho_Fa_|_CG-02
28 :     MMSYTVEKIGGTSMTAFDAVLENILLRPEQLYGRVFVVSAYSGMTDALLECKRTGAPGIY
29 :     QKIAKHDESWRDAVYALEQRMLLINENMFADAMTRLRADKFIRARLAEAIACIQNILQTC
30 :     QYGQFSLRQYLPQIREFLASLGESHSAYNTALKLNTLGVNARFVDLSGWCEAMQGNLDQV
31 :     IEEAFRDIDVTSELPIVTGYASCQEGLMRTYDRGYSEMTFSRIAVVTGAQQAIIHKEYHL
32 :     SSADPRLVGAEKVRPIGLTNFDVADQLANLGMEAIHPNAAAGLRQSNIDLRIKNTFEPDH
33 :     SGTLITASHQPQQDRVEIIAGRDKVFALHLFDQSMVGMMDKVSHELIEWIHAAKVQLIGK
34 :     EMNANSVTYYLSGSSEPLNHIRYQAEKRYPQAKVSGRMVALISAIGAHMETNKVLAQGLQ
35 :     ALLEHQLQPMAAHSSMRNVNVQFVVDDADYANGVCVLHQALMPFAQPSSARKVA
36 :     >Vfis_Ac_|_CG-02
37 :     MTYTVEKIGGTSMTAFDAVLDNIFLRPKDPYNRVFVVSAYGGITDSLLECKKTSKPGVYQ
38 :     LIAKRDDKWEEALEYVEKRMLLTNEHIFIDPMNRIRADKFICSRIKQAKNCIANILETCQ
39 :     YGQFSLRRYLPQVREFLSSIGEAHSAFNTALKLKTMGINAKFVDLSGWDNQPPRSLDDTI
40 :     INVFKDIDVTKELPIVTGYAYCQEGLMGTYDRGYSEMTFSRIASLTQADLAIIHKEYHLS
41 :     SADPRVVGTDKVFPIGRTNYDVADQLANLGMEAIHPNAAAGLRESNIEIQIKNTFEPKHK
42 :     GTLISSDYQPETDKVEIIAGKEKVFALHLFDQTMVGQVDNVSYELMEIISDAHVNLIGKE
43 :     MNANSITYYLGGNTESLNKVLYKTEKRYPNASIKGRMVALIAVIGSQIDTNKALAKGVLS
44 :     LMNSDVTPVALHSSMRNVNVQFVVSDKDYQNAIKALHHEFCEEVPAKQVKTSQVA
45 :     >Vpar_Ac_|_CG-02
46 :     MTFTVEKIGGTSMTAFDAVLDNIILRPKTPYNRIFVVSAYSGMTDALLECKKTSKAGVYQ
47 :     LIAKRDDQWQDALAYVESRMLLTNENIFADPMNRIRADKFIRSRIAEAKNCIANILETCQ
48 :     YGQFSLRHYLPQIREFLSSIGEAHSAYNTALKLKNMGINARFVDLSGWDNQEPRSLDDSI
49 :     RDAFADIDVTKELPIVTGYAYCKEGLMHTYDRGYSEMTFSRIAAITKADLAIIHKEYHLS
50 :     SADPRVVGPEKVLPIGSTNYDVADQLANLGMEAIHPNAAAGLRESGIELQIKNTFEPEHE
51 :     GTLISSGYRPEEDKVEIIAGKEKVFALHLFDQAMVGKVDNVSYELMEIISDARVSLIGKE
52 :     MNANSITYYLGGSSDSLNKVLYKAEKRYPNASIKGRMVALISAIGSHIDTNKTLAKGVLS
53 :     LMNSGVTPVALHSSLRNVNVQFVVSDKEYQRAICALHDEFFTPVEGSNAMEHVA
54 :     >SILI-1b_|_CG-02
55 :     MTHTVEKIGGTSMSRVNELVGTLFTGGRKPDDLYGRVFVVSAFGGITNLLLEHKKTGEPG
56 :     VYARFADAESDHGWHEALSRVGDEMRKAHEAVLENAGDVAQADAFVSERIEGARNCLIDL
57 :     QRLCSYGHFRLAEHMLQIRELLSGLGEAHSAYVTALLLQRAGVNARFVDLSGWRDEGDVT
58 :     LEERISSALNDVDPATEMPIVTGYAQCAEGLMREFDRGYSEVTFSCLAALTGASEAIIHK
59 :     EFHLSSADPKLVGEGVAQKLGHTNYDVADQMSNMGMEAIHPKAAKTLRQADVPLRVTNAF
60 :     EPEDPGTLIDDKPADQPAVEMITGLDIIALELFEQDMVGVKGYDAAILEVLTRHDVRIVS
61 :     KTSNANTITHYLDTSLTVLKRVEKDLAKIYPNADISARLLSMASAIGRDLKGLSVLTRGL
62 :     QAIADVGLASLGASQGPRNVDVQFIVEREDLKPVISALHKVLVEGRPAKQEKPIKAAA
63 :     >Acry_Ab_|_CG-02
64 :     MSMAPSVEKIGGTSIAATDAVVGNVLIAGRAGRDLYRRIFVVSAYGGITDLLLEPKKKTD
65 :     AAKPPGLYASFAADGEKGDWRDALDAVAAAMRARNEEVFGTSPERAVADDFVAARIGETR
66 :     ACLDDLDRLRGHGHFRLDEPLATLRELLAGLGEAHSAHNTALLLRARGVNAAFVDLTGWQ
67 :     DGRNLDLDERIRTGLDGIDSATTLPIVTGYVKCSDGMVRKYDRGYTEMTFARLAVLTGAR
68 :     EAIIHKEFHLSSADPKVVGVGKARKIGRTNYDVADQLANLGVEVIHPGAARGLRQAGIPL
69 :     RVRNTFDRHDEGTLICADYVSAAPRIEIVTGIRELRALQFFEQDMVGKKGYDAAILDTLT
70 :     KHRARIVSKSSNANAITHYLAAGGPTVRRVIADLEARFPNAEVSAPRLAMVALIGSDLSA
71 :     EGCVGRALDALGAAGIGVKAMQHQMRNVDIQFILDTDRFDDAIRALHAALVECRATQDGK
72 :     GGTLRTAA
73 :     >Sala_Ab_|_CG-02
74 :     MSGQHSVEKIGGTSMAATATLFDNVLIAGRSGADLYNRIFVVSAYAGMTDLLLENKKTGA
75 :     PGVYGHFVDDDDADAWRRAMAAVRAAMHARNADMFARGDSRAEADRFVDARIDAVTACLD
76 :     DLARLRSHGRFGLKDQLATVRELLAGIGEAHSAHSTALLLRDRDVNALFVDLTLWDQDDL
77 :     RSLDERIGEAFAAIDLRDTLPIVTGYAGCEGGMVRRYARGYTEMTFSRLAVLTGAREAII
78 :     HKEFHLSSADPKLVGEDKARKIGRTNYDVADQLANLGMEAIHPGAGRGLRQSGIPLRVRN
79 :     TFDREDEGTLVTGDYVSDVPRVEIVTGLRQVQALQFFEQDMVGVKGYDAAILDALARHKL
80 :     WIVSKSSNANTITHYLSASAAAVNKAIADLQGHYPDAAISAQPVAMVSVIGSDISRPGLV
81 :     PDALRALDAAGVTMIAMQHQIRNVDVQFLVDPRDFEAAVRALHKALVERDARTEEKRRAA
82 :     >Hnep_Aa_|_CG-02
83 :     MKRTVEKIGGTSISNTQVVLENVLIGGRKGADLYNRIFVVSAYSGMTNRLLEHKKSGEPG
84 :     VFSLFAGAGNKWAWTEALASVAEAMEAKNAEMFSGEPEQAVADNFVRERIEDVRNCLIDL
85 :     HRLCSYGQFRLDENLTTVKEVLSSLGEAHSAFNTALLLQKHGVNARAVDLTAWRDERDLT
86 :     MEERMEDALGGIDLSSELPIVTGYASSRDGLVRQFGRGYTEVTFSRLAAFVQADEAIIHK
87 :     EFHLSSADPNLVGQDRVRKIGLTNFDVADQLSNMGMEAVHPKAAKILRQAGIPLRVKNTF
88 :     DPKDGGTVISADYAPENPRAEIVTGLKGVFALEVFDQDMVGEKGYDSTILDALTRHSIRI
89 :     VSKCSNANTITHYIEGSRKALKRATADIETKLPGAEVSTSRVAIVSVIGADINVPGITAK
90 :     ALTALHEAEVPIIGLHQVSRKTDIQAVIQEDDFDKAICALHEALVEQVSVATPRAEALRP
91 :     AA
92 :     >Tcru_Ab_|_CG-02
93 :     MSNTQKTTLSVEKIGGTSMSDYQAVRDNIILYPENFYNRIFVVSAYGGITDDLLEHKKTD
94 :     QPGVYGLFANDDVDDDWRIALDQLSLKLNKINANLFSDDELRLKANDFIDERIAETKQLL
95 :     NHLQDLCRHGHFSLESHLLTVRELLASLGEAHSAWNLAHLLQTEGVNARFVDLTGWQADE
96 :     ALPLDAMIETHLGDIDFTKELPIVTGYTHCRENLMYTFDRGYSEMTFSRIAVLCQATEAV
97 :     IHKEYHLSSADPRLVGEDNVVPIGKTNYDIADQLANLGMEAVHPRAAQGLRQAQIPLRIK
98 :     NTFDPGHHGTIFTEDYVSEYPQVEIIAGMQHLIALEVFDQEMMGQQGSYEKVIIDATNRL
99 :     KCQVITKDFNANTITIYLKASLKKVKRLAEQLKQGLPTATINTSKVALASAMGSDMRIKG
100 :     LLAKAVQTLFDQGINVEAIHQNTRQVEMQFFVNETDYEKAVKALHTNLIEVHNHGKAICE
101 :     >Pstu_Ab_|_CG-02
102 :     MHTVEKIGGTSMSRFEEVLDNIFIGRREGAALYQRIFVVSAYSGMTNLLLEHKKTGEPGV
103 :     YQRFADAQSEGAWREALEGVRQRMLAKNAELFSSEYELHAANQFINSRIDDASECMHSLQ
104 :     KLCAYGHFQLSEHLMKVREMLASLGEAHSAFNSVLALKQRGVNARLADLTGWQQEAPLPF
105 :     EEMISSHFAGFDFSRELVVATGYTHCAEGLMNTFDRGYSEITFAQIAAATGAREAIIHKE
106 :     FHLSSADPNLVGADKVVTIGRTNYDVADQLSNLGMEAIHPRAAKTLRRAGVELRIKNAFE
107 :     PEHGGTLISQDYKSEKPCVEIIAGRKDVFGIEVFDQDMLGDIGYDMEISKLLKQLKLYVV
108 :     NKDSDANSITYYASGSRKLINRAARLIEEQYPAAEVTVHNLAIVSAIGSDLKVKGILAKT
109 :     VAALAEAGISIQAIHQSIRQVEMQCVVNEEDYDAAIAALHRALIEPENHGDVIAAA
110 :     >Sdeg_Ab_|_CG-02
111 :     MLTVEKIGGTSMSDYLTVRDNVVLGPNGENPTTGRILVVSAYGGMTDQLLEHKKSGKAGV
112 :     FAYFSSDEDAGSWREALNNVRQNMFQKNAELFNSADAISKANVFIGERLDTAERCLEDLQ
113 :     RLCGHGHFSLEAHLSTVREMLASLGEAHSARNMAELLKEEGVNARFVDLTGWNADKSLGM
114 :     DEHILEQFKDVDLGNELPVVTGYAHCESGIMSTFDRGYSEMTFSRIAVLVQADEALIHKE
115 :     YHLSSADPKVVGVDAAVPIGRTNYDVADQLANLGMEAIHPKAAKGLRQSNIPLRVKNTFE
116 :     PDHNGTLITTDYVSEKPCVEIIAGKQAVYAVECFNQDMVGDLLNFEQKIMQICQRFRCTH
117 :     VTKDVNANTVTHYLSSNMKKIKRVQRELEEMFPESEINVKKVSIVSAIGSDMQVPGILAK
118 :     TVGALADAGISVLAVHQSMRQVDMQFIVEEAAYEAAVRALHKCLVEVHDHGIAICAA
119 :     >MARI_Ab_|_CG-02
120 :     MMGQHTVEKIGGTSMSDYRSVRDNIIFKPTLVNNMYQRVFVVSAYAGMTDKLLEHKKTGD
121 :     AGVFALFAQERKQNNWFPALQDVRAAMLEINHSLFEAGELRHKADAFLNSRLQEAQECLE
122 :     DLHRLCQHGHFSISEHLATVREMLASLGEAHSAWNTAHLLQRDGVNAVFVDLTGWNSPSH
123 :     MSLDERILDAFKDVDLSKELPIATGYAHSETGLMSTFDRGYSEMTFSRIAVLTQAHEAVI
124 :     HKEFHLSSADPRLVGESKAVPIGRTNYDVADQLANLGMEAIHPKAAKGLRQSGISLRVKN
125 :     TFEPEHTGTLITGDYVSDAPCVEIIAGCRGVFAVELFDQDMAGDIDKFDVDILKVLRQFH
126 :     AHIIAKDINANTITHYLAINLKTLKRVMRVLHERFADAEITQRKVAIVSAIGSDMKTTGM
127 :     LAKAVKAIAEQEVNVLAMHQSMRQVDMQFVVDEEDYEKAICSLHKELVEVHNHGRAICLA
128 :     >Dole_Ab_|_CG-02
129 :     MGNHTVEKIGGTAMSQFDKVLDNIIVGDRKEKDLYNRIIVVSAYGGITNELLEHKKTSDS
130 :     GVYSLFSKDDDSWAWGEAITRVGQRMCTINKGFEHLGLDVQLADRFVKERIEGVRSCLID
131 :     LTRLCSFGHFKLDEHLMTVREMLSAIGEAHSAHNSYLILKSMGINARLMDLSGWMDTDQL
132 :     SLDETIKKAFESVDVAEELPIVTGYTQCKEGIMGSYDRGYTEITFSRIAVLTGAREGIIH
133 :     KEYHLSSGDPKIIGEDRVETIGSTNYDVADQLSDLGMEAIHPGAARGLRKTDIPLRVKNV
134 :     FEPDHPGTLITNDYRSTDARVEIIAGRKGVTGIEVWDQDMVGRWDHDLEMLKHLAAAKIR
135 :     YLAKDTNANTLTHYIAAPLAKIKRLTDNIKQDFPSADILVKKVALVSAIGTNMADTWVLP
136 :     TAVHSLTNAGVEILGLHKCMRQVDIQFVVDEKDFQNAICALHRDLVETGR
137 :     >Mhyd_Ab_|_CG-02
138 :     MTTAQHTVEKIGGTSMSNYEAVRDNIIIGKRKKSDLYQRIFVVSAYGGVTNELLEHKKTG
139 :     EPGVYALFADAESDWAWGDDLTKLIQLLTDINGELFADPMLKQQADQFITDRIEGVRGCL
140 :     IDLQRLCSYGQFQLEEHLLTVREMLAGIGEAHSAFNTALKLQQEGINARFVDLTGWRDSE
141 :     LLPLDEKLKQAFDAIDLSRELPIVTGYAQCKEGLMRTFDRGYSEMTFSRTAVITNAREAI
142 :     IHKEYHLSSADPNIVGEDKVVPLGRTNYDVADQLANLGMEAIHPRAGKGLRQNEIPLRVM
143 :     NTFEPEHTGTLITGDYVSEKPQVEIVAGAKGVFAIEVFDQDMQGEPGSDRRILDVLSRFK
144 :     VRFMSKDTNANTITHYVDTTLKHVKRVVKALEEEFPNAEISTRKVALVSAIGSDMKVPGI
145 :     LARSVKSLADNDISVLAIHQCMRQVDIQFVVDEDKYDQAIVALHGALIEPHNHEYAIVAA
146 :     STTAG
147 :     >Noce_Ab_|_CG-02
148 :     MNGHTVEKIGGTSMSRTQEVLDNILMGKRKEQELYNRIFVVSAYGGITDMLLEHKKSGAS
149 :     GVYALYAGAESDWAWGDLLNKVGERMCEINMEIFEDDLSCQKADQFVRERIEGVRSCLID
150 :     LHRLCSYGHFQLDEHLITVREMLAAIGEAHSAFNTALLLQQHGVNAHFIDLTGWRELDNL
151 :     TLEERIQQAFNSLDLARELPIVTGYPRCKEGTMMIYDRGYSEITFSKIAVLTEAREAIIH
152 :     KEYHLSSADPKVVDKDRVEPIGRTNYDVADQLSNLGMEAIHPKAAKGLRQCHIPLRVKNA
153 :     FDPDHAGTLIDGDYKSDTPCVEIIAGRKGVFAIEFFEQDMVGSSGYDTQLLALLERFKLK
154 :     IVAKDTNANTITHFVASSLKAIKRVTHAMEDAFPSAAVAVRKVALVSAIGSNMQVPGLLS
155 :     NAVSALAKADINILALHQSMRQVDMQFVVDEKDYEEAIIHLHEHLIESYSLPAPRSVGAA

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3