[Bio] / FigTutorial / test_should.pl Repository:
ViewVC logotype

View of /FigTutorial/test_should.pl

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (download) (as text) (annotate)
Fri May 1 20:32:38 2009 UTC (10 years, 6 months ago) by disz
Branch: MAIN
CVS Tags: rast_rel_2009_05_18, rast_rel_2014_0912, rast_rel_2010_0928, rast_rel_2009_0925, rast_rel_2010_0827, rast_rel_2014_0729, rast_rel_2009_07_09, myrast_33, rast_rel_2011_0928, rast_rel_2010_0526, rast_rel_2010_1206, rast_rel_2010_0118, rast_rel_2011_0119, HEAD
test scripts for the streaming figfam server

#!/usr/bin/perl -w 
use strict;
use LWP::UserAgent;
use HTTP::Request::Common;
use Getopt::Long;
use File::Basename;
use Data::Dumper;



my $ua = new LWP::UserAgent;
$HTTP::Request::Common::DYNAMIC_FILE_UPLOAD=1;
#my $url = "http://bio-macpro-1.mcs.anl.gov/~disz/FIG/test_server.cgi";
my $url = "http://bio-macpro-1.mcs.anl.gov/~disz/FIG/figfam_server_1.cgi";

#SHOULD-BE-MEMBER takes as input a list of 2-tuples
#
#             [FIGfam-ID,protein sequence]
#
#       It returns a list of boolean values indicating whether or not
#       the indicated protein sequence can be placed in the designated
#       family.
#
my @form = (id_seq=>"FIG000001,MALDVAAIRAHVPALKSGTARFDAPGGTQTPQPVIDAIAAALTAPLANRGRNTEGERNADRIVDEARSALADLLGTTPGTVVFGRSATQLAYDLSRTLAKGWGPGDEVVVTRLDHDSNIRPWVQAAEAAGADVRWADFDPATGELRPEHLAAVLGPRTRLVAVTAASNLIGTMPDLPALASLVHANGAHFHVDAVHYASHAVVDLAATGADTLVCSPYKFLGPHLGVLTGRAELLESLRPDKLLPSADTVPERFELGTLPYELLAGTSAAVDFLAGLEAEAEGSRRDRLVASFAALEAHEEALRERLERGLAELGGITVYSRAARRTPTLLFTVAGLRPADVYRQLAERAVDAPAGSFYAVEAARRLGLGDEGGVRVGLAPYSSAEDVDRLLTALGALER", 
	id_seq=>"FIG000001,DPATGELRPEHLAAVLGPRTRLVAVTAASNLIGTMPDLPALASLVHANGAHFHVDAVHYASHAVVDLAATGADTLVCSPYKFLGPHLGVLTGRAELLESLRPDKLLPSADTVPERFELGTLPYELLAGTSAAVDFLAGLEAEAEGSRRDRLVASFAALEAHEEALRERLERGLAELGGITVYSRAARRTPTLLFTVAGLRPADVYRQLAERAVDAPAGSFYAVEAARRLGLGDEGGVRVGLAPYSSAEDVDRL",
	id_seq=>"FIG000002,MALDVAAIRAHVPALKSGTARFDAPGGTQTPQPVIDAIAAALTAPLANRGRNTEGERNADRIVDEARSALADLLGTTPGTVVFGRSATQLAYDLSRTLAKGWGPGDEVVVTRLDHDSNIRPWVQAAEAAGADVRWADFDPATGELRPEHLAAVLGPRTRLVAVTAASNLIGTMPDLPALASLVHANGAHFHVDAVHYASHAVVDLAATGADTLVCSPYKFLGPHLGVLTGRAELLESLRPDKLLPSADTVPERFELGTLPYELLAGTSAAVDFLAGLEAEAEGSRRDRLVASFAALEAHEEALRERLERGLAELGGITVYSRAARRTPTLLFTVAGLRPADVYRQLAERAVDAPAGSFYAVEAARRLGLGDEGGVRVGLAPYSSAEDVDRL");

#print "\nSHOULD-BE-MEMBER\n"; 
#print "INPUT\n", &Dumper(@form), "\nOUTPUT\n";

my $res = $ua->post($url."?function=should_be_member", \@form);

if ($res->is_success) {
	print $res->content;
} else {
	print "Error ", $res->content;
};


MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3