[Bio] / FigKernelPackages / selenoprotein_ref_seq.pm Repository:
ViewVC logotype

Diff of /FigKernelPackages/selenoprotein_ref_seq.pm

Parent Directory Parent Directory | Revision Log Revision Log | View Patch Patch

revision 1.3, Thu Dec 6 01:41:57 2007 UTC revision 1.4, Sat Mar 29 05:19:01 2008 UTC
# Line 252  Line 252 
252  LSTVREVGHYSCRSMTGNCRALAALADEPGFVQMNDQDAKALGIKNNDLVWIASSRGKVI  LSTVREVGHYSCRSMTGNCRALAALADEPGFVQMNDQDAKALGIKNNDLVWIASSRGKVI
253  SHADVSTRTNKGACYMTYQWWIGKCNELTAEHLNPGSRTPEYKYSAVRIDKIEDQAWAEH  SHADVSTRTNKGACYMTYQWWIGKCNELTAEHLNPGSRTPEYKYSAVRIDKIEDQAWAEH
254  YVVAEYTKLKNRLKQTALVA  YVVAEYTKLKNRLKQTALVA
255    >fig|391774.5.peg.2843 Uptake hydrogenase large subunit (EC 1.12.99.6); selenocysteine-containing
256    MSGCTPKAAPAGATGRTTIAIDPVTRIEGHLKAEVVVENGKVVDARLSGGMYRGFETILR
257    GRDPRDASQIVQRICGVCPTAHSTASVLALDEAFGAKVPNNGRITRNLIFGANYLQSHIL
258    HFYHLSAQDFVQGPDTAPFVPRFPKSDLRLSKELNKAGVDQYIEALEVRRICHEMVALFG
259    GRMPHVQGQVVGGATEIPTKEKLVEYAARFKKVRDFVEQKYVPVVYTIGSKYKDMFKVGQ
260    GFKAALCVGAFPLDNSGKKHLFMPGVYAKGKDMPFDPSKIKEYVKYSWFAEETTGLNYKE
261    GKTIPAPDKAGAYSFVKAPRYDGLSLEVGPLARMWVNNPELSPVGKKLLKDLFGISAKKF
262    RDLGEEAAFSLMGRHVARAEETYYMLGAIEGWLKEIKAGEDTVVMPAVPASAEGTGFTEA
263    PRGSLLHYVKVKDSKIDNYQIVSASLWNCNPRDDMGQRGAVEEALIGIPVDDIQNPVNVA
264    RLIRAFDPULGCAVHVLHAESGKVAVIEVK
265  >fig|190192.1.peg.319 Formate dehydrogenase alpha subunit (EC 1.2.1.2); selenocysteine-containing  >fig|190192.1.peg.319 Formate dehydrogenase alpha subunit (EC 1.2.1.2); selenocysteine-containing
266  MARMRFVPQVCPFCGCGCGILVGTDGEEIKLLEPWRRHPVNEGRQCVKLWELPEAVQKDR  MARMRFVPQVCPFCGCGCGILVGTDGEEIKLLEPWRRHPVNEGRQCVKLWELPEAVQKDR
267  LERPVRMTESGEPRELSWNRALEEVAEVLSTHEPEEVYFVTSAKATNEDNYVAQKLARTL  LERPVRMTESGEPRELSWNRALEEVAEVLSTHEPEEVYFVTSAKATNEDNYVAQKLARTL

Legend:
Removed from v.1.3  
changed lines
  Added in v.1.4

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3