[Bio] / FigKernelPackages / selenoprotein_ref_seq.pm Repository:
ViewVC logotype

Annotation of /FigKernelPackages/selenoprotein_ref_seq.pm

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.5 - (view) (download) (as text)

1 : golsen 1.1 package selenoprotein_ref_seq;
2 :    
3 : golsen 1.5 # The proteins in this package are a representative subset of selenocysteine-
4 :     # containing proteins.
5 :     #
6 :     # Last update: 2010-01-05
7 :    
8 : golsen 1.1 use gjoseqlib;
9 :    
10 :     our $ref_seqs = [ gjoseqlib::read_fasta( \*DATA ) ];
11 :    
12 :     1;
13 :    
14 :     __DATA__
15 : golsen 1.5 >fig|83333.1.peg.3814 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
16 : golsen 1.3 MQVSRRQFFKICAGGMAGTTAAALGFAPSVALAETRQYKLLRTRETRNTCTYCSVGCGLL
17 :     MYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFIHSESRLKFPEYRAPGSDK
18 :     WQQISWEEAFDRIAKLMKEDRDANYIAQNAEGVTVNRWLSTGMLCASASSNETGYLTQKF
19 :     SRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANLVVVMGGNAAEAHPVG
20 :     FRWAMEAKIHNGAKLIVIDPRFTRTAAVADYYAPIRSGTDIAFLSGVLLYLLNNEKFNRE
21 :     YTEAYTNASLIVREDYGFEDGLFTGYDAEKRKYDKSSWTYELDENGFAKRDTTLQHPRCV
22 :     WNLLKQHVSRYTPDVVENICGTPKDAFLKVCEYIAETSAHDKTASFLYALGWTQHSVGAQ
23 :     NIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSQSLPGYMTLPSEKQTDLQT
24 :     YLTANTPKPLLEGQVNYWGNYPKFFVSMMKAFFGDKATAENSWGFDWLPKWDKGYDVLQY
25 :     FEMMKEGKVNGYICQGFNPVASFPNKNKVIGCLSKLKFLVTIDPLNTETSNFWQNHGELN
26 :     EVDSSKIQTEVFRLPSTCFAEENGSIVNSGRWLQWHWKGADAPGIALTDGEILSGIFLRL
27 :     RKMYAEQGGANPDQVLNMTWNYAIPHEPSSEEVAMESNGKALADITDPATGAVIVKKGQQ
28 :     LSSFAQLRDDGTTSCGCWIFAGSWTPEGNQMARRDNADPSGLGNTLGWAWAWPLNRRILY
29 :     NRASADPQGNPWDPKRQLLKWDGTKWTGWDIPDYSAAPPGSGVGPFIMQQEGMGRLFALD
30 :     KMAEGPFPEHYEPFETPLGTNPLHPNVISNPAARIFKDDAEALGKADKFPYVGTTYRLTE
31 :     HFHYWTKHALLNAILQPEQFVEIGESLANKLGIAQGDTVKVSSNRGYIKAKAVVTKRIRT
32 :     LKANGKDIDTIGIPIHWGYEGVAKKGFIANTLTPFVGDANTQTPEFKSFLVNVEKV
33 : golsen 1.5 >fig|266940.1.peg.7369 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
34 : golsen 1.1 MGIKTFLEGWPVYRQLTGDDPLGRGAATQSARSKSLTPRTATADRVAKSVCPYCAVGCGQ
35 :     RVYVKDEKVVQIEGDPDSPHSRGRLCPKGSASEQLVNGDSRATRIRYRAPYATEWSDLDL
36 :     DTAMDMITDRVIDARRRGWQDHDELGRRLNRTMGIASLGGATLDNEENYLIKKLFTAMGA
37 : golsen 1.5 IQVENQARIUHSATVPGLGASFGRGGATGDLQDLSNADVIVIQGSNMAECHPVGFQWVME
38 : golsen 1.1 AKARGAKVFHVDPRFTRTSALADTHVPIRTGTDIVLLGAIINRVLTQERDFREYVVAYTN
39 :     ASHLISEDFQDTDDLDGLFSGFDHETNSYDTKSWQYAGTEQHGDEEEETAESSDSESGHS
40 :     LGAGGAAVEHRSIQRDETLQDPRCVYQVLKRHFARYTPEMVADVCGIPTDLFEELAEAWI
41 :     SNSGREKTGALVYSVGWTQRGTGVQYIRAGAILQLLLGNMGRPGGGVMALRGHASIQGST
42 :     DIPTLYNLLPGYLQMPHVERHPDLAGYIDSIKGPAQKGFWANADAYTVSLLKAYFGDEAT
43 :     AENDYLFDELPKISGDHGTYSQVMDMIEGGKIFGYFLLGQNPAVGSANGRAQRLGMANLD
44 :     WMVVRDLVMIESATFWKDAPEVETGEIVPEQCRTEVFFLPAASHVEKEGTFTQTQRLLQW
45 :     REKAVNPPGDATSELWFFYHLGRRMREKLAGSTDPRDQLLLKLAWDYPLHGEEREPSSED
46 :     VLKEINGYGPEGLLPGYTALKADGSTSSGCWIYSGVYADDVNQAARRKPGREQSLHAPEW
47 :     GWAWPMNRRMLYNRASADPEGRPWSERKALVWWDEEAQRWVGDDIADFEATKPPSYRPPE
48 :     GATGVAAIAGDDPFIMQSDGKGWLYAPKGVVDGPLPAHYEPAESPFRNAVYTQQANPARE
49 :     VYTNHLNEVHPSPPELGSQVFPYVWITSRLTEHHTAGGMSRYLPYLAELQPALFMEVSPE
50 :     LARMRGLEHLGWAHVVTARAIVEARVLVTDRLAPLKVQNQLVHQIWLPYHWGQGGLTTGD
51 :     VVNDLMHLTLDPNVHIQEFKAGTCDVLPGRRPRGAAMLALIDEYRVRGGVTMASGAVAVT
52 :     ADLIARDGQERTDLAQGGDDHVGDGHDDDEIDRVLSVRHDVRSSPEHPQQDVEPAVLDAH
53 :     PARGLDRRAD
54 : golsen 1.5 >fig|266834.1.peg.1 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
55 : golsen 1.1 MEAVPMNVDLSRRSFLKLAGAGAAATSLGAMGFGEAEAAVVAHVRPHKLTTTTETRNTCP
56 :     YCSVACGVIIYSKGDLRKGEAADIIHIEGDADHPTNRGTLCPKGAALKDFVKSPTRLQYP
57 :     MHRKPGSDKFERISWEDAFDRIARLMKDDRDANFIAANAAGVPVNRWTTVGMLAASATTN
58 :     ETAWATFKFAKALGIVGFDNQARVUHGPTVSSLGPTFGRGAMTNSWTDIKNTDLVVVMGG
59 :     NAAEAHPCGFKWVTEAKATRGAKLIVVDPRYTRTASVSDYYAPIRQGTDIAFLNGVMKYC
60 :     IDNDKVQWDYMKAFTNASYLVKDGFGYQDGLFTGYDAEKRDYDKSTWDYVLGDDGFVVTD
61 :     PALQHPRCVWNLLKAHLAPYTPEMVERICGTPKDKFLKVAEMISECSSPTKTMTSMYALG
62 :     WTQHSSGSQNIRAMAMLQLILGNIGVRGGGMNALRGHSNIQGLTDLGLMSHLLTGYLTMP
63 :     TEKDVDFTTYMSTRQFKPLRPGQTSYWQNYRKFMVSFQKAMWGDAARIDNDWAFNYLSKL
64 :     DVPAYDVLRVFELMYAGKVNGYICQGFNPLLAFPNRDKNTKALSNLKWLVTMDPLDTETA
65 :     RFWENHGDFNPVDTASIQTEVFQLPTTCFAEEEGSLTNSGRWLQWHWAGGTPPGEAKHDT
66 :     YIVAQIFLRMKEMYRNEGGAFPDPILNLSWDYADPNEPTPEELAKEINGRALTDLMDPAN
67 :     PMKVQVAAGKQILNFSQLRDDGSTMCGCWIYSGNFNEQGNNMARRDNHDPDDTGAYLGWS
68 :     FAWPLNRRTLYNRASADLQGKPWDPSRKLLEWDGTKWAGYDVPDIAPTAKPDEIGPFIMN
69 :     QEGTARLFSRGLMRDGPFPAHMEPFESPVANVFNPKMRGNPVSRVFQTDVAQMGLSDEFP
70 :     YAATSYRLTEHFHYWTKHNRVNSALQPEFFVEISEELAEEKNIENGGWVRVWSKRGSVKA
71 :     KAVVTKRIRPLMCDGKPVHVVGIPLHWGFTGSAKKGLGPNSLAPFVGDANIETPEYKAFL
72 :     VNIEPSTAPEEATV
73 : golsen 1.5 >fig|292459.1.peg.3209 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
74 : golsen 1.1 MNLNRREFLRLSGVSAAGAALLLFAEEREALARDLKESRIARAKEVPSVCPHCSVGCGLI
75 :     GYVREGQLLQVEGNPDSPVSEGSLCPKGAATMQFAYDGVGRPNPLRQLTAKIRRPGSDRW
76 :     EEIGIEEALDRIARRIKETRDASFVERNADGLVVNRTESIAHIGSACIDNEECYLVTKLM
77 :     RALGVVYLEHHARIUHSSTVPGLGTSFGRGAMTTALWDIPNADVVVFMGSNAAENHPISF
78 :     KWFLRAKQKGATVICVDPRYNRTASKADWWIPFRSGTDTAVLGGLINYAITHNKFHREYV
79 :     VKYTNASLLVHPDFRFDDGLFSGWDPEAKKYDQSTWAFQTGPDGQPLSDPTLEHPQCVFQ
80 :     HIKRIYAEYTPEKVSEISGIPVDDFIKFAETVCATGTAGKSAVFVYAMGWTQHTKGVQNI
81 :     RTATILQMLLGNIGVAGGGIAALRGHANVQGATDLAVLYHDLPGYLGQPTEAHKSLSDFL
82 :     AKTTTKNSYWENKPKFLISLLKAWWGEHATAENDFCFDYLPKMAAGETYSHYDIFQSILD
83 :     GRVKGLIVVGQNPAVGSANARKVQAALAKLDWLVVSDLFLNETSEFWKLEGMNPAEIQTE
84 :     VILLPAAGPLEKEGSFTNTHRLIQWKHKMIEPMGESHSDGWYMVQIGKRLKQLYADSTAA
85 :     KDLPIKHLVWDYDDPDNPNEFDHLKVLKEINGYDVATGKPVSGFGALQDDGSTACGCWIY
86 :     SGIYPEEGVNKADARLRAAPNRPDGWTEAKADGSADYLHLGWGFAWPANRRVIYNRASAD
87 :     PSGKPWSKVPLVWWDEAEGKWTGVDVPDMLPVAPGQVHAVGVPGDTPFIMKAWGLGGIWG
88 :     PLPDGPLPVHYEPMESPTPNLLYRKQGTIPTMKIYDSEFDLFGDPERFPYVATTYRLTEH
89 :     LTSGVMTRTLPYLAEAFARHFCEIPRELAQREGIRNGDWVEVESARGKVRVQAMVTNRLR
90 :     PLRIGGRETFLIGLPIHWAPNSGHVQGDITNTLTPQAVDVNVQIQESKVFLANLRKVSVG
91 :     G
92 : golsen 1.5 >fig|224324.1.peg.724 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
93 : golsen 1.1 MNYMDISRRGFLKLSVGSVGAGILGGLGFDLTPAYARVRDLKITKAKVTKSICPYCSVSC
94 :     GILAYSLSDGAMNVKERIIHVEGNPDDPINRGTLCPKGATLRDFVNAPDRLTKPLYRPAG
95 :     STEWKEISWDEAIEKFARWVKDTRDRTFIHKDKAGRVVNRCDSIVWAVGSPLGNEEGWLM
96 :     VKIGIALGLSARETQATIUHAPTVASLAPTFGRGAMTNNWVDISNSDLVFVMGGNPAENH
97 :     PCGFKWAIKAREKRGAKIICIDPRFNRTAAVADIFVQIRPGTDIAFLGGLINYVLQNEKY
98 :     QKEYVRLHTTGPFIVREDFGFKDGLFTGYDPKTRSYDTTTWDYEFDPATGYPKMDPEMKH
99 :     PRCVLNILKEHYSRYTPEVVSQICGCSKEDFLRVAEEVAKCGAPNKFMTILYALGWTHHS
100 :     YGTQLIRTACMLQLLLGNIGCPGGGINALRGHSNVQGMTDLAGQNKNLPTYIKPPKPEEQ
101 :     TLAQHLKNRTPRKLHPTSLNYWANYPKFFISFLKCMWGDAATPENDFAYDYLYKPEGGYN
102 :     SWDKFIDDMYKGKIEGVVTAALNFLNNTPNAKKTVRALKNLKWMVVMDPFMIETAQFWKA
103 :     EGLDPKEVKTEILVLPTAVFLEKEGSFTNSARWVKWKYKATDPPGDAKDEFWIFGRFFMK
104 :     LKEFYEKEGGAFPEPILNLVWPYKNPYYPTAEEILTEINGYYTRDVDGHKKGERVRLFTD
105 :     LRDDGSTACGGWLYCGVFPPEGNLAKRTDLSDPLGLGTYPNYAWNWPANRRVLYNRASCD
106 :     EKGRPWDPERPLLRWDPERDMWVGDIPDYPATAPPEKGIGAFIMLPEGKGRLFAAKSYVT
107 :     FKDGPLPEHYEPYESPVTNILHPNVPHNPVAKVYKSDLDLLGTPDKFPHVATTYRLTEHY
108 :     HFWTKHLYGPSLLAPVMFIEIPEELAKEKGIQNGDLVRVSTARASIEAIALVTKRIKPLK
109 :     VAGKTVYTIGIPIHWGFEGLVKGAITNFITPNVWDPNSRTPEFKGFLANIEKVKT
110 : golsen 1.5 >fig|207559.3.peg.3778 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
111 : golsen 1.1 MNCTRRGFLKLAGAGAACISLAQLGFSLKEARAFAASLKIEGAKEVITVCPFCSVSCHII
112 :     AYVKNGKLISTEGDPDYPINEGSLCAKGAALLTMSTSHHRLLKPKYRAPFSDKWEEKDWG
113 :     WTLEQIARRVKDTRDKEIILENNKGQRVNRLESMFLLGTSHADNEECALVHQAMRGLGVV
114 :     HMDHQARIUHSATVAALGESFGRGAMTNHWIDIKNADAILIMGSNAAEHHPISFKWVLQA
115 :     KDKGAVVMHVDPKFSRTSARADFHVPLRSGTDIAFMGGMIHYILETESYFRQYVLDYTNA
116 :     SFIVGESYGFKDGLFSGYDIHTRSYDRSKWNFETDAQGTPKRDPSLKHPRCVFRLMQEHY
117 :     SRYTLDNVSSVTGVTKENLLKVYKAFAATGKPDKAGTMMYALGWTQHTVGVQNIRSAAIV
118 :     QLLLGNIGVAGGGINALRGEPNVQGSTDHCLLYHIIPGYMTMPMADWQTYADYNKANTPV
119 :     SADPQSANWWQHKPKYLTSLLKAWFGDAATAENGYCYGLLPKIEKGADHSYMFLFDRMYS
120 :     GKITGGFIIGLNPMNSVPNTNKVRKALDNLDWLVTAELHHSETTDNWRRPGVDPATVKTE
121 :     VFLLPSAHRVEKAGSVSNSGRWLVWHHKAVEPEGEARSFGDMFVPLINVVRDLYRKEGGT
122 :     MPEAVLNLDWPQQYDPEEWARRINGFFLKDTTVNGKEYKKGQLVPSFTALADDGSTSSLN
123 :     WLYSGSYTEEDGNKAQRRDPSQTPMQAAIGLYPKWSWCWPVNRRILYNRASVDAQGKPWN
124 :     PAKAVISWNGKKWEGDVPDGGWPPMATGKGRHPFIMSKHGFGQLYGTGRMDGPFSEHYEP
125 :     VETPIDAHPFSKQLSSPVYKFVSSDMDKLARPADPRFPYVLTTYNVTEHWCGGGETRNVP
126 :     NLLEAEPQLYVELSPELAEEKGIANGDGVILESARGRVEAIAMVTVRIRPFTVQGKTVHL
127 :     VGMPFCFGWTTPGTGDSTNRLTPSVGDPNTSIPEYKASCVNIRKADTLTEIDR
128 : golsen 1.5 >fig|292459.1.peg.3210 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
129 : golsen 1.1 MALTRRDLLKSSLAAGGALSLLGLGGKAEAKERDDLKIEGAKDYRTICCYCSVGCGIQLW
130 :     VKDGEVVHVNGDPDHPINEGTLCPKGASIANLRIVADKNNQYQPNPRRLTKVLYRAPGAT
131 :     DWEEKDWDWAIERIARNVKAARDATFERVDENGVTVNRTFAMAHIGSAALDNEENYVLAK
132 :     LMRGLGIVRLEHHARLUHSSTVAGLAPTFGRGAMTNHWTDYQNTDVFMVLGTNPAENHPI
133 :     SMRWIDRARETRGAKLIVVDPKFNRTAAKADLYVQIRPGTDIAFLGGLMNYAMTHGRYFH
134 :     EYVAKYTNASYLIHPDFKFEEGLFSGAQVGEDGQVKYDTATWQYQVDEDGNIKKDPTLQH
135 :     PQCVFQLMKKHYARYTPEMVAETCGMTVEEFLEVAELFTSTGRPDKAGNIMYAMGITQSS
136 :     HGSQNVRAVAMLQLLLGNIGIPGGGVNAHRGESNVQGSTDMAMLWNNLPGYMPMPSAAQH
137 :     PTLAAYQASTPKSGYWTNRPKFMVSLLKAWWGENATAENDFAYDYLPKLDHRDHSHMSIF
138 :     EAMGRGELKGLFAWGQNFAVGGPNVTKERSALANLDWLVVVDLFETETAAFWKGPGMNPA
139 :     EIQTEVFLLPAAASYEKCGTVTNSGRWIQWRDKAVEPMGDSRDDLWIADRLFKKLRELYA
140 :     TEGGAFPDPILQLHWDYDDGDHPSAEKVAFEINGYTWADRKGLTTFGNLQDDGSTACGCW
141 :     IYAGYFDNFETPKCRSRVKDEPGTTLGTHLGWAWAWPVNRRILYNRCSMDEHGQPWDPER
142 :     PLFRWDGEKFIAQDVPDFVATNPPEVSAQNPFIMMQEGVGALWSPSGMKDGPIPEHYEPV
143 :     ESPVSNRFNRRQFNPVAVISGKGEFGALTEAENPEFPYICTTYRVTEHWQSGAMTRSLPW
144 :     LGEMMPDMFVEISPTLAAKLGVQSGDRVEVTTVRGSLVAPAMVTPRMRPVRVHGREIEIV
145 :     GMPWHWGFMGKFTGASANVLTPHVGDANTQIPEYKAFLCNVKKAGGSGPVRG
146 : golsen 1.5 >fig|477974.3.peg.2160 Formate dehydrogenase O alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
147 :     MKKLSRRAFLKSVGLGAAGLTALDIIGGGKSAEAATLLLKSRTDMPEFKLQYAEETYTIC
148 :     GWCSGGCGAIIYTKDGKVIDSIGDPDHPINEGAMCPKGRALSDLRHVVGQSERRHSMWPN
149 :     PRIDNPRRLTKPLYRAPYSTEWQEISWDTAIAEIVKRVKATRDATFETTDANGVTVNRTQ
150 :     AIAQFGSATINNEENYLMQKWARALGLINICFHARLUHSVTVAGLANTYGRGVMTNHWTD
151 :     YQFADAWLVIGGNPAENHPIAFKWITKARESRGAKLIVVDPRVSKTASLADIYAPLRPGT
152 :     DIAFFNGFIKYILDNNLYHEEYVVNYTNASYIINPDFKLEDGVFSGFDGGKYDKATWQYT
153 :     EEKDPTLEHPNCVFQLLKKHVSRYDLKTVSRICGTPENKLVEVWKAFAETGKPGKAGSIL
154 :     YAMGMTQHTHGAQNVRALAILQLLLGNMGMPGGGVNAQRGEANVQGATDQGMLFHITTGY
155 :     NPMPSAAAHPTWADYVEKTTPKAGYWTNRPKFVAAMLKAWYGDKATAENDYCFDWLPKLA
156 :     TGDHSHMAIFRDIALGKIKGLFAWGQNLVVCGPSQVQARAGMANLEWLVCMDLFETETAA
157 :     FWKAPDLDAARIGTEVFLLPAAGPYEKEGTVTNSGRWIQWRYKAVDPPGEAKSDLWIVDR
158 :     LFKTLRAEYKAKGGAFPDAIINMVWDYGDPPDPNKVAMEMNGFSLETGELLPNFTAIANS
159 :     DLGAVSSGCWIYSGFYNNVNDPACKRRNREDKSGLAMYHNWSWAWPLNRRIVYNRCSCDP
160 :     QGRPWDPKRAPVEWDGAQWVLRDVPDFNAKVPPEETATKPFIMLAEGQALLFSIPMADGP
161 :     FPEHYEPVESPVKNIMSKQQINPCTRFYGPHFEKFAAVGSEEFPYVCTTLRLVEHYQSGG
162 :     LTRNLPFLVELQPEMFVMISKSLGEKLGIKTYDWVKVSTARGAIECKVGVTPLVKPLEVD
163 :     GKPVEIVYMPWHWGFMGLSAGAIANDLTPAAGDPNTMIPEYKAFLCNIEKVKAGAPPAPR
164 :     TRARAIYDL
165 :     >fig|360106.3.peg.1723 Formate dehydrogenase-O, major subunit (EC 1.2.1.2) @ selenocysteine-containing
166 : golsen 1.1 MSEAHIGRRSFLKLAALGAGSTMAFGKENETLRTATNEEIKNPFPGSKKVRTICTICSAG
167 :     CGIEAEVKDGVWIRQDMAIDHPISQGSHCCKGIDQIDLTKSKQRVKYPMKKVNGKWERIS
168 : golsen 1.5 WETAINEIGDKLLEIRKEDGPDCVEFLGSAKFSNEQAFYFRKFAAFWGTNNIDHVARIUH
169 : golsen 1.1 SATVAGVANTWGYGAMTNHFGDVTANSKAILLIGANSAVANPIGFKHMLQAKDRNNCKLI
170 :     VVDPVYTKSAAKADYFVRLRPGTDIAFAYGMLHLIFKNGWEDKEFIKTRSYAVDEIRKEA
171 :     EHWTPQETENVTGIPAEQLIEITRVFATTKPATLAWALGVTQHSVGSSNTRIYALLQLIL
172 :     GNVGKAGGGCNIIRGHDNVQGATDMNNLADSLPGYYGLGDAAWKHFCKGWGQDYDKFIKR
173 :     FATSVKEPREKLGDDVEGTKFKEYFYHDPKTPEDRNWRNEKGYSLSKWWQGVLKEENTFS
174 :     SGNLRVLWVQGTGITSMAHLTKIKEAIDKLDMLVVVEPFVNEVAILSDRKDGVYILPAAT
175 :     QFESSGYVSATNRSAQWRSQVIPPIYESKEDQEVMMLFAKKFGFYDEYVKGMMMDVVDGE
176 :     LKKVKDSFVWPDDATNEIARTTQSIGNNGRTADRLKKHQENWINFDPDTLMGKPGSPVAG
177 :     EYYGLPWPCWNKNHPGSPVLYDVTKPVWKGGMGFRNRFGLEHNGVSQLADDSITIPGSKV
178 :     KGGYPQITKDNIEKVLGITLSEEEKAKMGSGWNMDYSGIIAKKCEEAGVSPCGNAKARAI
179 :     VWEFIDQYPKHREPIHSPRKDLVEKYPTFGDQAKNFRVSTKFESEQKAQDWSKDFPTIIS
180 :     SMRLVNLSGAGMIERTSKYLAHITPEMFAHVNPELALKYGIQDGEMMWIHSPQGTKIKVK
181 :     CIHSHSVTPDRICLPYNFAGVMQGVDLSARYPEGTKPYTIGESSNTITNYGFDIVTQISE
182 :     FNAGLCRLERASDQSTFKTAFFDEK
183 : golsen 1.5 >fig|192222.1.peg.1426 Formate dehydrogenase-O, major subunit (EC 1.2.1.2) @ selenocysteine-containing
184 :     MSSVGENIKLTRRSFLKMAALSSLATPLLARSETLREASADELKEAYEGSKKVKTVCTAC
185 :     SVGCGIIAEVQNGVWVRQEIAQDHPVSSGGHCCKGSDMIDMVRSHVRLKYPMKKENGEWK
186 :     RISYEQALSEIGEKLAAYRKENPESVMFLGSAKLNNEQAYYIRKFAAFFGTNNVDHQARI
187 :     UHSATVAGVANTFGYGAMTNHLGDIQRSKCIIIIGANPAVNHPVGFRHFLKAKEKGAKLI
188 :     VVDPRFTKSAAKADIYARIRPGTDIAFMYGMLKIIFDEGLEDTKYLDERVFGIDKIREEA
189 :     AKWTVEEVENVTGISKELLVQITHEVAKNKPTTLIWAMGLTQHTVGTSNTRLAPIVQMVL
190 :     GNIGKFGGGVNILRGHDNVQGASDMACLSENLPGYYPLNEATWRYYAKIWGVDYEWLLGN
191 :     FVSKDWMHKTGLSLARWWAAALNGKDGNDAIDNAGTPLKALVVMGNGITSTAQQVKVKEG
192 :     LEALELLVLADPFVNEAGIIAERKDGIYLLPAATQFETSGSVTATNRSGQWRFKVVDPLY
193 :     ESMEDQEILFELAKKLGFYEDFTKTLRDEKGEIVWPENATREIAKAVRSIGLNGWSPERL
194 :     KKHTLYWDKFDEVTLEGKDEVAGEYYGLPWPCWSDKHPGSPVLYNTDIEVAKGGMGFRNN
195 :     FGLEYEGESLLAKNAPLNSPIDTGYPQITKDNIEKVLGITLSAQEKEKMGSTWSYDDSNI
196 :     IATKCIEKGIVPYGNAKARAVVWTFKDKIPLHREPLHSPRNDLVQKYPSFEDQKALYRVD
197 :     TKFVSVQQAKDYSKEFPLNLVTARLVNLNGAGMENRASMYLTRLTPEMFCEINPELAKEQ
198 :     DIKAGDMIWVHSPEGTKIHVRVKVNPGVAKDMIFLPFHFTGVMQGVDLTHNFPEGTKPYA
199 :     SGESANTVTNYGYDIMCQIPETKGGLCRISKDGK
200 :     >fig|292459.1.peg.3216 Formate dehydrogenase-O, major subunit (EC 1.2.1.2) @ selenocysteine-containing
201 : golsen 1.3 MAELSRRDFLKLGGVAAGALAVGLPQRPARAAQADVRKVPTLCEMCTSRCGVFAVVENGR
202 :     VTRIEGNPAHPVNLGRPCARGNAGASALYDPDRLKEPMKRGEDGKLYPITWEQAVEEIGA
203 :     KLNEIRKRHGPEALVFAEYNNLNSTLTKRWTEAFGSPNHVGHAANCFANRNVGYSAVFGA
204 :     LPSVDYENVKFYLSPGRNLLGGIKVSEVAALAKAKANGARIVVLDPRHSELAGWGEWIPI
205 :     KSAGDLAFLLAVANVLITEGIYNKAWVEAHCNGFEQLAEGIREYTPEWQEQHTDIPAEKV
206 :     RQLAREMAAAAPATVVDPGWHGGNGMYWNGYEAARAGAIVNALLGNLGAKGGLKLSPKVA
207 : golsen 1.5 LGTIDNPPEGAVLEAAGGGUAATGTSAGAEVWTPYPKPTAVRFDGMGTKYPLSLGSIQAI
208 : golsen 1.3 PLVVESGKPYPLKAAIFFRVNPVKSSGDQRRWIEALKRLDLVVAIDTQMSETAMLAHYVL
209 :     PEHHYLERMDAISVVGDTVSIRQPVVEPMYNTRSCLEILQGLAKVVGIEQYFNFTMEQWN
210 :     NALLGPTGWTVKHLKEKGVIKVSATPPDYSKLPTSSGKAELVHKGFALSGGHEVVTWVPP
211 :     KTQPEGDRLRLLHGHMAVHTNGYTQNVPALYARMPENDLWIHPTAAAARGIQDGDLVEVA
212 :     NEYGVQRIRARVTEGIRPDCVWMCHGFGTMAPEQRLAYGKGAADGWFYPILVTPVSAALG
213 :     QGDATVTVRKVGEKV
214 : golsen 1.5 >fig|83333.1.peg.1460 Formate dehydrogenase N alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
215 : golsen 1.3 MDVSRRQFFKICAGGMAGTTVAALGFAPKQALAQARNYKLLRAKEIRNTCTYCSVGCGLL
216 :     MYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYVNSENRLRYPEYRAPGSDK
217 :     WQRISWEEAFSRIAKLMKADRDANFIEKNEQGVTVNRWLSTGMLCASGASNETGMLTQKF
218 :     ARSLGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANVVMVMGGNAAEAHPVG
219 :     FRWAMEAKNNNDATLIVVDPRFTRTASVADIYAPIRSGTDITFLSGVLRYLIENNKINAE
220 :     YVKHYTNASLLVRDDFAFEDGLFSGYDAEKRQYDKSSWNYQLDENGYAKRDETLTHPRCV
221 :     WNLLKEHVSRYTPDVVENICGTPKADFLKVCEVLASTSAPDRTTTFLYALGWTQHTVGAQ
222 :     NIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSTSLPGYLTLPSEKQVDLQS
223 :     YLEANTPKATLADQVNYWSNYPKFFVSLMKSFYGDAAQKENNWGYDWLPKWDQTYDVIKY
224 :     FNMMDEGKVTGYFCQGFNPVASFPDKNKVVSCLSKLKYMVVIDPLVTETSTFWQNHGESN
225 :     DVDPASIQTEVFRLPSTCFAEEDGSIANSGRWLQWHWKGQDAPGEARNDGEILAGIYHHL
226 :     RELYQSEGGKGVEPLMKMSWNYKQPHEPQSDEVAKENNGYALEDLYDANGVLIAKKGQLL
227 :     SSFAHLRDDGTTASSCWIYTGSWTEQGNQMANRDNSDPSGLGNTLGWAWAWPLNRRVLYN
228 :     RASADINGKPWDPKRMLIQWNGSKWTGNDIPDFGNAAPGTPTGPFIMQPEGMGRLFAINK
229 :     MAEGPFPEHYEPIETPLGTNPLHPNVVSNPVVRLYEQDALRMGKKEQFPYVGTTYRLTEH
230 :     FHTWTKHALLNAIAQPEQFVEISETLAAAKGINNGDRVTVSSKRGFIRAVAVVTRRLKPL
231 :     NVNGQQVETVGIPIHWGFEGVARKGYIANTLTPNVGDANSQTPEYKAFLVNIEKA
232 : golsen 1.5 >fig|138119.3.peg.4655 Formate dehydrogenase N alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
233 : golsen 1.3 MEVTRRGFLKLSGASLFALASGLGFDPQIAQAQGFSLRIEGTTKIPSICHFCSGGCGLLL
234 :     HIKDEKLVYLDGDPDNPVNSGALCPKGASLGHVANAKDRVTKPRYRAPGSSDWQDISWDE
235 :     AINKIASKIKEVRDTTWMATEEIGGTAYNVNRADGIAVLGSAEVDNEESYLIKKLSELIG
236 :     TPYNEHQARIUHAPTVASLSPSFGRGAMTNSWTDMQNTKCFLIAGSNCAENHPIAMRWIN
237 :     KAKENGAKVIVVDPRFTRTASQADIFAQVRPGADIAYLNAIINYILENKLYDQDYVLNHT
238 :     NGLYKISKDFKFADGLFSGFDPETKKYNFDSWAYQLDAENKPVKAESLDDPDCVFGKLKE
239 :     HFSRYTLEVGADISGIPAEKIKEIADTFCNTRPGSILYALGMTQHTTGVQGIRSYAIIQL
240 :     LLGNVGKAGSGIQALRGEPNVQGSTDMANLFNNLPGYLPAPVHTDKDLRSYLVRSGSAFE
241 :     RHIVSQLKAWFGENATKENDYCFNYLPKYNSGKNYSMVKLWEAANNGQFKMLLNFGSNSM
242 :     VSIPNRQIVREGLAKLDMLVIADVYEVETAQFWREKDPTTGELLVDPAKINTEVILLPAA
243 :     FVYEKGGTLSNSGRWIQWKDAALKPPGEAKPDLDILDHIYHKLKELYAGSTDPKDEPILK
244 :     ARWDYGHEPDPLKVLQEISGYDETTGKVLPTLADYLKAPIGSASSGCWIYAGVTGNGNLA
245 :     ARRDNSDPSGLGLYRNWSFSWPGNIRILYNRGSCDMNGQPLDENRKLIWWDAAKNSWEGN
246 :     DGADVPDKTKGPDTPEGKQVFRMNPEGVGRLFTAKYFSGIPATPAADGLPHIGVRPAGQC
247 :     NDGPLPEFYEPVESPTVNSLHPDVSSNPTVPIPNFLPGVTNHGSKEDFPYVLTTYALVEH
248 :     FCAGGITRNIPMLNELMPQPFAEISKNLAQKIGVKEGDMVEVSSARGKVQVVALVTDRIQ
249 :     TLKINGQDSETIGMPWSWGFASLSPGPTTNNLTISAIDPTAGTPEYKCCLVNIRRA
250 : golsen 1.5 >fig|246194.3.peg.767 NAD-dependent formate dehydrogenase alpha subunit @ selenocysteine-containing
251 : golsen 1.1 MADVTLKINGIEVTVPEGTTILEAAQIAGFKIPTLCYDPELSKPGACRICVVEVKGARNL
252 :     VASCVTPVAPGMEVLTHSEPVINARREILDLLLSNHPEDCLTCDKMGECALADYAYEYGV
253 :     RRGSYQGEKNVYPIEDNNPFIVRDMNKCILCGKCVRVCDEIVGYSVIDFINRGFKTKVAP
254 :     PYDGTLAESNCVFCGSCVTVCPTGALTVKDTRGKFRPWEVKRVKTTCPYCGVGCNFDLLV
255 :     KDDKVVGVAPNPTSEVNGRFMCVKGRFGYKFIHSDDRLTKPLIKKNGELTEASWDEALTL
256 :     VAEKLGEIKAKYGSDSIGVLASAKCTNEENYLLSKFTRAVLGTNNIDHCARLUHSPSVAG
257 :     LAAAFGSGAMTNSFEDIMETELIMLIGSNTTESHPVAGYKIKQAVKKGAKLIVIDPRNIE
258 :     LASYADLHLQLKPGTNLPLLNAMAHVIIEEGLYNEQFIRERTEGFDSYKDTVKDYSPEAV
259 :     AEICGVPAEKIREAARMYAKAGKAMILYTMGVTQFSFGTYGVLAVANLAMLTGHVGKDGA
260 :     GVNPLRGQNNVQGACDMGGLPNVFTGYQRVDDPAANEKFSKAWGVKLPEKPGLTLGEMFD
261 :     GALKGNIKAMYIMGENPVLSDPDARHIEEALKKLDFLVVQDIFLTETAKFADVVLPAATF
262 :     AEKDGTFTNTERRVQRVRKAIPCVGEAKPDWEIIALVATKMGYPMSYSSAEEIFDEMRTL
263 :     TPSYAGITYERLEKKSLQWPCPAPDHPGTKFLHSDKFVRGKGLFHPIPFKEPEEKPDSEY
264 :     PFTLITGRRLYHYHTGTMSRRSMMGEHVPEDHLEMNPADAKKLNIKDGDRVRVTTRRGSV
265 :     EIKVALTDKVPEGTVFASFHFFESPVNQVTNPARDPMAKTPELKYSAAKIEKL
266 : golsen 1.5 >fig|177439.1.peg.682 NAD-dependent formate dehydrogenase alpha subunit @ selenocysteine-containing
267 : golsen 1.1 MKKVTLTINGRSVTAPEGSYVLQAALQKGIYIPHLCYHNDLEPVGACRLCTVRVNGRWDA
268 :     LSCKTPVEEGMVIETETETIAKTRKIAIELLIADHDMDCLACARNTTCKLQQAADYIGVN
269 :     KKHLARLKKPEVLLPIDDSNPFFDFDPNRCVLCGICIRTCDELQNINAIDFAYRGLTTKV
270 :     AGFGDKARILSNCESCGECVARCPVGALTEKDYVKPSHWVKTVCAYCGCGCGLDLGVRDN
271 :     KIVSARGEHGNPANRGRLCVKGRFGFNYVNSKERLTTPMVRRPEGFVPVSWDEALDLIAD
272 :     NFAKNKGDSFAAVSSAKCTNEENYLLQKFTRTVMKTNNIDHCARLUHAPTVAGLATAFGS
273 :     GAMTNSIAEIGDAQVILAIGTNTTAAHPIIALQIKDAVRRGAKLIVINPKRIDLCKHAHI
274 :     FLQNTPGSDIPLLMTMMRIIVEEDLIDKEFIEERCENYPAFLASLQQFELEDVAELTGIP
275 :     AETIREAALCYATESPATILYCMGITQHVHGTDNVLATSNLALLTGNVGKESTGVNPLRG
276 :     QNNVQGSCDMGALPDVYPGYQKVVNNTAAFEEKWQTSLSAVPGKTHTEIFDGLYDGSIKS
277 :     VYLIGENPVLSEANASHAIEAMNRAKFLVVQDIFFSETAELADVILPASSFAEKDGTFTN
278 :     TERRVQRVRQAIEPVGDSRPDWWIIKEIATRMGAKGFDHEGPEQIMEEISATIPNYAGIN
279 :     YDRLQHGTLQWPCPSTDHPGTKFLHAERFATANGRARFMPLKTRKTTEQVDKKYPLLLNT
280 :     DRSLFHFHGTMTRRVFGLNVLDRGENLIIHPEDAEKFSLTDGEIVEVRSRRGAVKVAVEI
281 :     NDSCRPGSVSMSFHFSETPTNMLTSGALDPVAKTPGTKICAVQINKL
282 : golsen 1.5 >fig|714.2.peg.2081 Formate dehydrogenase H (EC 1.2.1.2) @ selenocysteine-containing
283 : golsen 1.1 MALDNNNNLSISCCSSNKDITMAIKKVITVCPYCASGCKINLLVENNKIVGAEGANGKTN
284 :     EGELCLKGYYGWDFVHDTKILTPRLTQPMIRYKRGEPFTPVSWEEAISYSANRLKEICEK
285 :     YGNESIMVTGSSRGPGNEVNFVMQKFARAVLGNNNVDCCARVUHGPSVTGLLKSVGNGAM
286 :     SNSIVEIEDTKCVFIFGYNASTSHPIVARRINHAKEKGAKIIVCDPPKIETARIADIYAP
287 :     LANGSNVAFLNAMMNVILEEGLQDQKFIDEHTENFDAFYETVKAYTPESTQHITGIDPEM
288 :     LREIARTYAKAETATILWGMGVCQFRQGVETVRALASLAMLTGNLGKPNVGVNPVRGQNN
289 :     VQGACDMGALFNTLPGYQSFADPETNAKFAKAWGVPSIPTKPGVPLSEVPHAVKEGKLKA
290 :     FYIMGEDTLQTEPDINAMKQTFKDLEFIIVQDIFMTQTAAEADVILPATSCAEHEGVYSA
291 :     ADRGFQRFYKAVEPVGNVKDDWEIISLIAQALGYPMHYNNTKEIWDELRELCPIYKGATY
292 :     EKMEGLGYIQWPCTDEGPEDQGTQYLYEGQIFDRKGGKAEFFACDWEPPMEDLSEEFPLV
293 :     LSTVREVGHYSCRSMTGNCRALAALADEPGFVQMNDQDAKALGIKNNDLVWIASSRGKVI
294 :     SHADVSTRTNKGACYMTYQWWIGKCNELTAEHLNPGSRTPEYKYSAVRIDKIEDQAWAEH
295 :     YVVAEYTKLKNRLKQTALVA
296 : golsen 1.5 >fig|190192.1.peg.319 Formate dehydrogenase alpha subunit (EC 1.2.1.2) @ selenocysteine-containing
297 : golsen 1.1 MARMRFVPQVCPFCGCGCGILVGTDGEEIKLLEPWRRHPVNEGRQCVKLWELPEAVQKDR
298 :     LERPVRMTESGEPRELSWNRALEEVAEVLSTHEPEEVYFVTSAKATNEDNYVAQKLARTL
299 :     GTNNVDHCARLUHAPTVVALSELLGSGAMTNSIPDLVEADCYLVAGSNTAEQHPIVYRRI
300 :     LQGLEENDADLIVLDPRRTQIAELADIHLQVRPRTDLIVFLYMAKVIVEEGLHDGTFIEE
301 :     RTTGFESFEEYVREAVSEGDVRRIAGVDPEDVRKAAVRYAEAERGCILYCMGLTHHDIAT
302 :     RTVRALCALALLTGNVGRPGTGVNPLRGQNNVQGACDVGALATHFPGYRPINTETANEMS
303 :     KIWSFEVPDEPGLKLTEAFDADEITVMYVVGENPAVSEPNTRHAVEKLESLEFLVVQDLY
304 :     LTETGELADLVLPAAGWAERTGTFTATDRRVQLAEKAVEPPGEARPDWWILEAVARRLGL
305 :     KGFGHRSPREVFEEIRRVVPQYRGITYERLRRRPGGIHWPCPSEDHPGTPILHTEEFATE
306 :     DGKARFPKPEDVEYREPERDVDEEYPLILTTGRVYAHYHTRTITRRSRLLSEEVPESFVE
307 :     IHPKDAERYGVRDGELVVVETPYGEWRCRARVTDRVREGTIFTPFHFGENVLTPHDVRDP
308 :     ESGIPEYKYVPARVRPDSRGSASRG
309 : golsen 1.5 >fig|6239.3.peg.13805 Thioredoxin reductase (EC 1.8.1.9), metazoan type @ selenocysteine-containing
310 : golsen 1.1 MKSLTELFGCFKRQPRQQEASSPANPHVSDTLSMGVAASGMPPPKRPAPAESPTLPGETL
311 :     VDAPGIPLKEALKEAANSKIVIFYNSSDEEKQLVEFETYLNSLKEPADAEKPLEIPEIKK
312 :     LQVSRASQKVIQYLTLHTSWPLMYIKGNAVGGLKELKALKQDYLKEWLRDHTYDLIVIGG
313 :     GSGGLAAAKEASRLGKKVACLDFVKPSPQGTSWGLGGTCVNVGCIPKKLMHQASLLGHSI
314 :     HDAKKYGWKLPEGKVEHQWNHLRDSVQDHIASLNWGYRVQLREKTVTYINSYGEFTGPFE
315 :     ISATNKKKKVEKLTADRFLISTGLRPKYPEIPGVKEYTITSDDLFQLPYSPGKTLCVGAS
316 :     YVSLECAGFLHGFGFDVTVMVRSILLRGFDQDMAERIRKHMIAYGMKFEAGVPTRIEQID
317 :     EKTDEKAGKYRVFWPKKNEETGEMQEVSEEYNTILMAIGREAVTDDVGLTTIGVERAKSK
318 :     KVLGRREQSTTIPWVYAIGDVLEGTPELTPVAIQAGRVLMRRIFDGANELTEYDQIPTTV
319 :     FTPLEYGCCGLSEEDAMMKYGKDNIIIYHNVFNPLEYTISERMDKDHCYLKMICLRNEEE
320 :     KVVGFHILTPNAGEVTQGFGIALKLAAKKADFDRLIGIHPTVAENFTTLTLEKKEGDEEL
321 :     QASGCUG
322 : golsen 1.5 >fig|99883.3.peg.26915 Thioredoxin reductase (EC 1.8.1.9), metazoan type @ selenocysteine-containing
323 : golsen 1.1 MPPIDNESGKNDLKSRIQQLIDSNQVMVFSKSYCPFCVQVKDLFRELQVECNVVELDLME
324 :     DGTNYQEMLLEMTGQKSVPNVFINKTHVGGCDKTMQAHKDGSLQQLLNGQNEAYDYDLIV
325 :     IGGGSGGLACSKEAALLGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQTALLR
326 :     TAIQDARKFGWEFDEAVTHNWETMKTAINDYIGSLNWGYRVSLRDKNVNYVNAYAEFVDP
327 :     HKIKATNKRGKETFYTAARFVLATGERPRYLGVPGDKEYCITSDDLFSLPYCPGKTLVIG
328 :     ASYVALECGGFLAGLGLDVTVMVRSILLRGFDQDMANRAGQYMEEHGVKFLRKYVPVQVG
329 :     GPRKRAGVGARLVLHVQKSSSLTSVWQIEELEAGTPGRLKVTAKSTESDEIIEEEYNTVL
330 :     IAVGRNACTDKIGLDKVGVKVNPKNGKIPVNDEEQTSVPHIYAIGDILEEKWELTPVAIQ
331 :     AGRLLARRLYGGSKVKCDYVNVPTTVFTPMEYGACGLSEERAVGLYGQENIEVFHTQFWP
332 :     LEFTVPGRDNNKCYAKIICNKLDSGRVVGFHYLGPNAGEVTQGFSAAMKCGATKEQLDGT
333 :     IGIHPTCAEIFTTLEVTKSSGKSIIQTGC
334 : golsen 1.5 >fig|177439.1.peg.3237 CoB--CoM-reducing hydrogenase (Sec) alpha subunit @ selenocysteine-containing
335 : golsen 1.1 MGKVLTIAPVTRIEGHAKIAIHLDDTGNVENAFLHIQSLRGFEKFIEGRPAEEVPRLVNR
336 :     ICGICPWMHHIASNKAVDRCFDVTPTATGYKLRELCQVLAHVNDKILHFFFLAAPDFVLG
337 :     PDADHSVRNVMGVVKAAPELASKVVKMRQLGQMMLEKFAGKAIHPIAGVVGGFSKPMVEE
338 :     ERKELLEGARTLLDFSTYALDFAINNVFSKYMDVIGELGVIKTGFLGTVDRQDGSLRLFD
339 :     GNLRMMKADGSFEEFQNRDYADHIGEHTVPWGYSKMPYAKFWNEGFDMSLGAPKGIYRSN
340 :     TLARINVCDKISTPKAQAALEAFRELFGRPAQQTLLYHYARLIEMVYACERTIELLEWDG
341 :     ITDPHVRAEVTPRAGRGVGVVEAPRGTLIHDYTTDDDGCVTSANLIVGTTHNIAPMNMSV
342 :     RQAASSLIKDGKYDEGILNRVEMAVRAYDPUMSCATHRLDGGLPVTVSIMDKEGVEIDRI
343 :     VK
344 : golsen 1.5 >fig|267377.1.peg.1724 CoB--CoM-reducing hydrogenase (Sec) alpha subunit @ selenocysteine-containing
345 : golsen 1.1 MGKVTIEPLSRLEGHGKVSITLDDAGKPTDVKLHITALRGFEQFVVGRPAEEVPRIVPRI
346 :     CGICQTPHHLASVKAVDAAWGAEVPSAAEKLRELMHLGNMMHSHALHFYYLAAPDFVLGP
347 :     DSDPAARNIIGVIGAAPEVAKKAIAMRRVGQSIVETIGGRAIHPVTGVPGGVSKALSEEK
348 :     RDELLNEIDEMIAYGQDGIALIKSLNEKYMDLAKTLGVIDTWYLGMVKDGKHNFYGDTLR
349 :     FMSPDGKQTTDFKPSEYLDNIGEHVVGHNYVKYPYNKKVGYPDGLYRVGPLAMLNVCDSM
350 :     PTPLAEEARKDFADTFGKPANQSLAYNHARLIELLASCERVKELLEDSEITSTDIKAEVE
351 : golsen 1.5 PKAGNGVGAIYAPRGTLFHNYETDDKGIVVKANMIVASTHNVPTMEKAIQQAAEVVFKUA
352 : golsen 1.1 TVVKMVDEAKLNLIEIVLRAYDPUYSCAAHMIVKDEQGKVLLEVKKEE
353 : golsen 1.5 >fig|243275.1.peg.78 Betaine reductase component B beta subunit (EC 1.21.4.4) @ selenocysteine-containing
354 : golsen 1.1 MIYKAIHYINQFYAGIGGESSADSGFVVLRDKKGPAIGLEGLWHGKMIVTKVICCGDNYI
355 :     NLDRNFEEVCRQLKKIVEEEKPDVLIAGPAFNAGRYGMACAKICDYVRSNLNLPSVTAMW
356 :     HENPAVKIYVRNNYIISSTETAAGMHKTLQDLADLALKLAKKEKIGPARIEGYLPTGHRY
357 :     NEYHKKTGAERVVDMLLDKLNGRPYQTEVPLRGFERVPPAPPIHKMNKTTIALFTTGGLV
358 :     PIGNPDKLKQAFAEDFKVYDISNRDTLPQGVYESIHGGYDTTAASAEPNRLIPLDALRQC
359 :     EAEGIIGGIYPYFGTTCGVGTNVAVSESMGKAWARKIKEEGVGAVILTSTUGTCTRCGAT
360 :     ICKELDRVGIPNVHINAFTSISESVGANRIVFGGGFTAPVGNPMLPLERETAYRRKIVDK
361 :     ALEALQTEVLSPTVFTVDHDKEG
362 : golsen 1.5 >fig|891.1.peg.7228 Betaine reductase component B beta subunit (EC 1.21.4.4) @ selenocysteine-containing
363 : golsen 1.1 MKKAVLYINQFFAGVGGETEADFEPEIREGLVGPALELDKQLKNAEVTHTVICGDNFIGS
364 :     NQEEAVKRILEGLEGIEFDIFFAGPAFQAGRYGSACGFICRAVKEKFGVETVSSMHVENP
365 :     GVLMFKKELYIAEGGHIAAKMRKDIKKMANIGDKLLAGETMLRAAAEEFFPRGIRHQFWP
366 :     EEARPAAIRAVEMLQKKLSGENYQTELPIPKSDRVEIAKPVTDLSKARIALMNTGGIVPV
367 :     DNPDKIQSASATRWGKYDISGMDRLESGVFKTIHAGFDPAAADADPNVIMPVDVMRAFEK
368 :     EGKIGELYKDFYSTVGTGTTEAEARRMAQEIVVHMKEAQVDAVLMVSTUGTCTRCGATMV
369 :     KEVEKAGFPVVILCNLIPVAKSVGANKIVPTISIPYPLGDPATSQEEQLKLRRHRVEVAL
370 :     DALAQDIEEQTVFKVKI
371 : golsen 1.5 >fig|1496.1.peg.3938 Glycine reductase component B gamma subunit (EC 1.21.4.2) @ selenocysteine-containing
372 : golsen 1.1 MGKLKAVHYINQFFAGIGGEEKADTKPHVAETLPPISLQLDKLLGEDIEIVGTVVCGDSY
373 :     FNENIDSASEEVLSMVKGFEPQLFIAGPAFNAGRYGVAAGTITKVVKDALNIPALTGMYV
374 :     ENPGADMFKKDVYVVETSDSAAGMRKALPKIAKLAVKLANGEEIGTPKDEGYIARGIRVN
375 :     YFHEDRGSKRAVDMLVKKIKGEPFETEYPMPNFDRVDPSKAVKDLSKCKIALVTSGGIVP
376 :     KGNPDRIESSSASKYGTYSIAGVMDLTEETYETAHGGYDPVYANLDADRVLPVDVLRDLE
377 :     KEGVIGKLHETFYTTVGNGTSVANSKKYASEIGAALVADGVDAVILTSTUGTCTRCGATM
378 :     VKEIEKTGLPVVHMCTVVPISLTVGANRIVPTIAIPHPLGNPALDPTEEKALRRGLVEKA
379 :     LNALTTEVDGQTVFEK
380 : golsen 1.5 >fig|243232.1.peg.1226 Formylmethanofuran dehydrogenase (tungsten) subunit B (EC 1.2.99.5) @ selenocysteine-containing
381 : golsen 1.1 MVKVVRNVVCPFCGTLCDDLEILVEDNHIVGTRHACRIGNAKFMHFEGAVRYTEPLMREN
382 :     KKDDFKKVDYETAIEETARLLTEATLPLIYGWSATECHAHMYGVELAELVGAVIDNTASV
383 :     UHGPSLLAVQDVGYPVCTLGEVKNRADVIIFWGSNPMHAHPRHMSRYSVFARGFFRERGR
384 :     EDRTLIVVDPRETDTAKLADIHLQVEPHKDYELVSAMRAVLKGFELQVDKVAGVPADLIY
385 :     EAVEVCKNAQFGELFFAMGVTMTRGKHRNIDNAIQLVIDLNAYTKFGLMPMRGHYNVNGF
386 :     NQVLTWVTGYPFGVDFSRGYPRYNPGETTANDLLQRGETDMMLNIASDPGAHFPQKAVQH
387 :     MAKIPLVCIDPHETPTTQLANIIIPPAIAGVEVEGTAYRMDGVPIQLRKVIDPPEGVLPD
388 :     REILKILIKKVKEML
389 : golsen 1.5 >fig|190192.1.peg.927 Coenzyme F420 hydrogenase alpha subunit (FruA) (EC 1.12.98.1) @ selenocysteine-containing
390 : golsen 1.1 MAEGAVEIQPTTRHEGHAKLVLYVDDEGYVERAFYLNTSAVRGFEALAKGRPAEFVQVAV
391 :     MRICGICQATHGTASAEAFERAMGIEPPKDGKLLRELCALGNRIQSHVLHQLLVLDDFVE
392 :     DESEKVEAVKRIQQIRRIGQYVVDVVGGEGIHPPNIRIGGMAENISEAARRKLYRRLREA
393 :     RELMMEQHEFMVNIVERFGDENDLDIDEFGRHDQPFLATHPTYGDPDRLDMDRVVELLPI
394 :     EYYGEEHKEVAYQHRGQIPLYDGVPVEVGPRARYILFDGVDPRGVLYIHVLRSQETLAAI
395 :     DRAMTILDELNTSGKTLAEWEPKAGVGIGVHEAPRGTNVHIAKVNEKGIVEDYRIIAAST
396 :     WNFPVVEKAIEGENEEYAEVIMRCYDIUASCAAHVVKEVRDADSREKIRESVVKLA
397 : golsen 1.5 >fig|9913.1.peg.588 Selenoprotein P precursor @ selenocysteine-containing
398 : golsen 1.1 MWRGLGLALALCLLLTGGTESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUY
399 :     LCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQ
400 :     PDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLSRP
401 :     QDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLS
402 :     ESPKPDTPDTPENPPTSGLHHHHHRHKGPQRQGHSDNCDTPLGSESLQPSLPQKKLURKR
403 :     CINQLLUQFPKYSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVI
404 :     ESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN
405 : golsen 1.5 >fig|221988.1.peg.2243 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
406 : golsen 1.1 MQNDANEVRPALSEAEQIRLTQYSHGAGUGCKISPKVLGTILHSQLEQFVDPHLLVGNDT
407 :     NDDAAVYDIGNGTCIISTTDFFMPIVDDPFDFGRIAATNAISDIFAMGGKPIMAIAILGF
408 :     PINVLPAEVAQKIVDGGRFACREAGIALAGGHSIDAPEPIFGLAVTGIVPTEKVKRNASA
409 :     EAGSKLYLTKPLGIGILTTAEKRGKLKPEHKGLATEVMCQMNLIGSQFSQLESVTAMTDV
410 :     TGFGLLGHLAEICEGSNLVADVHFNKIKMLDGVPYYIEQGCLAGGVTRNYESYGIKIGAI
411 :     TEFQKAVLCDPQTSGGLLVAVKPEGETQLLELAAQAGIELIEVGELRRRVDNSDPVIIRI
412 :     LD
413 : golsen 1.5 >fig|1491.1.peg.3667 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
414 : golsen 1.1 MSNNINIKEGEACSIEKKEVRLTELSRTSGUAAKIAPGVLSKILSKLPKMESENLIVGIE
415 :     TADDAAVYKINDDTAMIQTLDFFTPIVDDPYMFGQIAAANSLSDVYAMGGKPVVALNIVC
416 :     FPSCLPIEVLGEILKGGADKVMESGAVVIGGHTVDDNEPKYGLSVTGIVHPDKVLKNYGC
417 :     KEGEVLITTKPLGIGIINTAIKGDMASKEAKDAAVKSMSTLNKYAGEIITKYNISACTDI
418 :     TGFGFLGHAYEMASASNVTLKFNYKRISYIKEAEEYAEFGLVPAGAYANRDHIEGNFEFK
419 :     NVPVFMQDILFDPQTSGGLLISCSKEESEKIMKELNKLELKSSIVGEVIRKQDKYIIVE
420 : golsen 1.5 >fig|882.1.peg.1326 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
421 : golsen 1.1 MTVDRLTSRSRAAGUAAKIAPGDLERILATLPRDPREGERVVVGTRDNEDAAIVRVPGGK
422 :     AIVQTLDFFTPIVDDPYLFGQIAAANALSDVYAMGGEPWCALNIVCFPVKELPEDILADI
423 :     LRGGADKVREAGAVLVGGHSIEDESIKYGLSVTGIIDPDCYATNTGLRPGDVLLLTKPLG
424 :     SGVLATAVKAGWDGFEAHEQELGRWGAMLNRAGGRVIRELGLAAATDVTGFGLGGHLLEM
425 :     ANASNMSVHVDVSTLPLMPAVLDLVATGLLPAGSHANRHFCSGNVSVHPEVDSLLVDIVF
426 :     DAQTSGGLILAVPPHLVDDACSILRAEDAPFWRIGHVEEMGEGVPRLVLQP
427 : golsen 1.5 >fig|243232.1.peg.1637 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
428 : golsen 1.1 MERGNEKIKLTELVKLHGUACKLPSTELEFLVKGIVTDDDLLDKNILVGLGDDASIIKRN
429 :     GLVIAKTVDVFTPIVDDPYIQGKIAACNSTSDIYAMGLLDIVGVLAIVGIPEKLPIHVVR
430 :     EMLKGFQDFCRENKTTIVGGHTILNPWPLIGGAVTGVGREEEVLTKAGVKVGDVLILTKP
431 :     LGTQTAMALSRIPEEFKDLISITEEERDYIINKAIEIMTTSNRYALKALRKAEERVGDKI
432 :     ANALTDITGFGILGHSNEMAKNSNVLIEINLLPCIKRTPELSRLFGHALLDGYGAETAGG
433 :     LLISAKEEYKDNLIDELEKAKCYAFEVGRVVKKGEGKAVLSKDVKVIEI
434 : golsen 1.5 >fig|335283.3.peg.2205 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
435 : golsen 1.1 MHPEKIALTQTVQKGGCAAKVAATTLHRILQQVRFPAAHSALMVDGRYFDDAAIYKINEQ
436 :     TALVQTLDFFTPIVDTPRLFGEIAAANAISDVYAMGGRPVTAMGILAFPLATLSEHIIVD
437 :     VLQGASDKIAEAGANFVGGHSIDDDTLKFGLSVTGLVNPQQVWTNANAQSGDHLVLTKAL
438 :     GTGTLTAGIKRQQLQEKDIMDALESMAAINNVIDYLSPDLLAAIHAATDITGFGFSGHAM
439 :     QLANASNVTLSIATGNLPRFDKAFYCLKNSFLTKAHRTNAEYTTPHIDDAKLDALYKLLI
440 :     HDPQTSGGLLLSVVPEASQLVLQALRTYFKPAAIVGTVHPRQDKAVQFE
441 : golsen 1.5 >fig|235279.1.peg.1876 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
442 : golsen 1.1 MADYQLTKHIQCAGUAAKVGLSDLAQISSQLTQKPNSLLIAGFESNEDCGAMLYAPNDEY
443 :     AMLSSVDFITPVVDDPYLYGQIAAANALSDIFAMGGEVKSALNLLMWDNTHFDSAVANAI
444 :     LKGGLNKITESNALLLGGHTIKDKEQKYGLAVNGIAHKNRLWRNHTGYIGDMLVLTKPLG
445 :     SGILTTAIKAQMFSQTTEVTQSMAMLNLYAARIAQNYEIHACTDITGFGLIGHAFEMCGG
446 :     IKNQNEKSILFYTKQIPLFDKTESFSQMGIVPGGSYENKKALQSQVQIQCTLEDDIFYYD
447 :     AQTSGGLLFALPFNQAKLFVDELHKAGIIHANVIGEIIPKTETSIVLG
448 : golsen 1.5 >fig|326298.3.peg.2098 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
449 : golsen 1.1 MNNESKLTKFVQAAGUAAKMGPGDLKHTICSLISDDKNVLVGFENSDDAAVYQINENEAL
450 :     VQTVDFITPVVDDPYIYGKIAAANSLSDIFAMGADVKTALNIVGFDKTNHTYEVLSEILR
451 :     GGNEKIKECGGVLVGGHTIESPEMYYGLSVTGMIHPKKVLRNNTPKIGHVIVLTKPIGMG
452 :     ILTTAIKRDLLSKETTLEAINVMQSLNYLPSKLLREYEVSACTDITGFGLLGHALESTNE
453 :     RVSISIDAKNVPVMADAFDLADKNIVPGGTKRNMKYLEDKVIFAGDASKYALMFSDAQTS
454 :     GGLLISMSEKDALEYVKKVQDLTYGYACVIGSIIPRGDRAIIVY
455 : golsen 1.5 >fig|306263.1.peg.1683 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
456 : golsen 1.1 MIYKDQKLTQYVKAAGUAAKLDSVGLDKILGILKPHENILSGIGNNEDASVYKLNEDLAL
457 :     VQTLDFITPVVDSAYHFGAIAAANALSDVFAMGAEVINALNIVGFDTCHFNNEILLEVLE
458 :     GARVKVEEAGAVLVGGHTIENDEFIFGLSVTGVVHPKKFIANNSAKDGDVILLTKPIGSG
459 :     IISTAIKASLLEKEKILKAVEQMSFLNLYASRILREFKSLSALSDVTGFGLLGHLKEMLN
460 :     KEIMIEVYKNEIPLMDGVLSMANMGIIPAGAYKNKDSLKIWVENLNEKDEDIMYFDPQTS
461 :     GGLLASMSENEAVEALKILKDHNIEAKIIARCVRNTHNYLLLC
462 : golsen 1.5 >fig|217.1.peg.1890 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
463 :     MNEEIKLTHFVQCAGUAGKSSPADLSQIFSSLPSQSDPKLIAGFEHHEDCGIYALENGDF
464 : golsen 1.1 LLQSIDFITPIVDDPYFYGKIAAANALSDVFAKGAEVCTALNVLMWDREHVSKSCLQEIL
465 :     RGGMEKIKECGALLLGGHTINDREQKYGLSVSGITRSFWPNRGAKIGDVLLLCKPIGSGI
466 :     ITTALKRENLALSAAKECVESMALLNVYAMRIALDFPIHASTDITGFGLIGHLLEMCAEE
467 :     QSFALEVDKIPLFEPVKELLAQNISLGSKNNRAYFSHAVRDTRERGEDGFLYDAQTSGGI
468 :     VFALPKNKAWALLDALKKSQYERASIIGEVIPRAQGAILLG
469 : golsen 1.5 >fig|224324.1.peg.1561 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
470 : golsen 1.1 MVELLKLVRSSGUAAKVGPGDLQEILKGFNIYTDESTLVSIGDDAGVYEHNGIIWVYTVD
471 :     IITPVVNDPYLWGAISTANALSDVYAMGGIPVNALAISCFNNCELDIEIFREVIRGALDK
472 :     LREAKTVLLGGHTIDDKEPKFGLSVAGICPEGKYITQSGAQVGQLLILTKPIGTGILIKG
473 :     LKEGILKEEDINEAIENMLALNDKARNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGA
474 :     RIFFEKVPYYQLSENLVKKKIYPKGAIENLNFVKNYLKSNLDNWKLILLSDPVTSGGLLF
475 :     TINKEKLEKIDETAKELEVNYWIIGETIAENVLEVL
476 : golsen 1.5 >fig|190192.1.peg.1365 Selenide,water dikinase (EC 2.7.9.3) @ selenocysteine-containing
477 : golsen 1.1 MSRKKSLVEMADLHGUACKLPQGDLEDLLKGVELPEEGGRVEVGVGDDAAVIRVDGGYVI
478 :     QSVDFFTPIHPDPYTQGRIAANNSINDVFAMGATEVLSVLVVSGFPRELPEEDAREMLQG
479 :     FADQCREVDALIVGGHTIMNPWPILGGCVTGFAERYVTVGGAEPGDVLYLTKPLGTQPAM
480 :     AALRLPEDVRKQFLTDSELEEAVDLAVEVMTEPLKDAAEAALEVGVHAMTDVTGFGLKGH
481 :     AGEMAEASGVRVVIERLPVIPGTTELSRALGYGLERGESAETAGGLLVAVPEEHAEDLED
482 :     AFERRDVWYRRIGRVEEGSGVEVRGDVEEVEDYP
483 : golsen 1.5 >fig|316057.3.peg.1843 D-proline reductase, 26 kDa subunit @ selenocysteine-containing
484 : golsen 1.1 MAETRAPTGFASEDDVPIPYMARTRAYYQAIGYDVPYRWAHDVAAPFRPLTKPLAQARVA
485 :     LITTAAPFDPAKGDQGPGAAYNGGAKFYQVYDGDTSQDHDLRISHIAYDRTHTTATDSGS
486 :     WFPLPQLRRLAREGAIGDVAPRFFGAPTNRSHRVTTDTDAPEILARCRADNVDAAVLVPN
487 :     CPVCHQTVSLVARHLEAHGVSTVVMGCAKDIVEHAAVPRFLFSDFPLGNSAGKPHDDASQ
488 :     AFTLELALRVLERAPGPQTTVQSPLRWRTDAAWKRDYNNVAAMSADELERRRCDFEAQKD
489 :     RARAIRDSVA
490 : golsen 1.5 >fig|1491.1.peg.3665 D-proline reductase, 26 kDa subunit @ selenocysteine-containing
491 : golsen 1.1 MSLTITKGLQSEIFVPITPEPVWTPVTKELKDMTVAIATAAGVHLKKDKRFNLAGDFTYR
492 :     LIPGDAKTSDMMVSHGGYDNSDVNKDINAMFPIDRLRELVDVGFIKAVAPTHIGFMGGGG
493 :     NQQKFREETGPEVAKILKEEGVDAVLMTAGUGTCHRSAVLVQRAIEKAGIPTIIIAALPP
494 :     VVRQTGTPRAVAPRVPMGANAGEPNNVEMQTAIVKDTLEQLIKIPSAGKIVPLPYEYIAK
495 :     V
496 : golsen 1.5 >fig|99883.3.peg.21500 Selenoprotein P precursor @ selenocysteine-containing
497 : golsen 1.1 MDSLRQKLENQGLRDVVYMVVNHQGAQARGLHAMLAQRLSEHISLHRQDEALADVWQTLG
498 :     GNKDDFFIYDRCGRLTHRISLPYAVIGHGHVEKAVKDTYCSSLCGECTHETAETQQECTP
499 :     KTDTQPQEDTRHECHHRHHQGHQHHGDGHDHGHGHHGGQGHHQGHDQAGGVAQRPADADT
500 :     DAGCSAASLSRRREPDPRVPTEDESRCKLALIVPVTPVAKSSLYQQVLL
501 : golsen 1.5 >fig|9913.1.peg.211 Glutathione peroxidase (EC 1.11.1.9) @ selenocysteine-containing
502 : golsen 1.1 MARLFRASCLLSLLLAGFIPPSQGQEKSKTDCHAGVGGTIYEYGALTIDGEEYIPFKQYA
503 :     GKYILFVNVASYUGLTGQYVELNALQEELEPFGLVILGFPCNQFGKQEPGENSEILATLK
504 :     YVRPGGGFTPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPDRLFWEPMKVHDIR
505 :     WNFEKFLVGPDGIPIMRWYHRTTVNSVKMDILTYMRRRAVWEAKGK
506 : golsen 1.5 >fig|10279.1.peg.66 Glutathione peroxidase (EC 1.11.1.9) @ selenocysteine-containing
507 : golsen 1.1 MADGSGARFPRFSELCAKYAAQLAAAETRSVYAFSARPITGGEPVSLGFLRGRVLLIENV
508 :     ASLUGSTVREYTQMNELQRRLGARGLVVLGFPCNQFGHQENAQNAEILPSLKHVRPGNGF
509 :     EPNFMLFEKCEVNGARAHPLFAFLREALPAPSDDMSTLVSDPQLIAWSPVCRNDVAWNFE
510 :     KFLVGADGTPVRRYSHRCQTLAVEPDIEALLPPPARGYYA
511 : golsen 1.5 >fig|351605.3.peg.3641 D-proline reductase, 26 kDa subunit @ selenocysteine-containing
512 : golsen 1.1 MPFARLKNRLLARIFTSFPSLAARWGRQLDANISDIPWTEPQKPLNEAILALVTTGGVHL
513 :     KTQEPFNMADPNGDPTFREIPADTPADLLTITHDYYDHRDAERDLNLVLPLQRLREMVEV
514 :     GALKALHPIAYGFMGHIDGPHLHTLQEETAPAIARKLADAGVDYALLVPA
515 : golsen 1.5 >fig|298386.1.peg.5793 Glycine/sarcosine/betaine reductase protein A @ selenocysteine-containing
516 : golsen 1.1 MLKDKKVIILGDRDGIPGQAIEACIKSAGAHVLFSTTECFVUTSAGAMDLENQKRIKGFA
517 :     EEFGAENILIVLGGAEAEASGLACETVTNGDPTFAGPLAGVQLGLSCYHVVEPEIKNNVD
518 :     ADVYDEQIGMMEMVLDVDAIIAEIKGYREQFGKYVLAEAEV
519 : golsen 1.5 >fig|243275.1.peg.1716 Glutathione peroxidase (EC 1.11.1.9) @ selenocysteine-containing
520 : golsen 1.1 MGIYNYTVKDSLGNDFSFNDYKDYVILIVNTACEUGLTPHFQGLEALYKEYRDKKFLVAA
521 :     FPCNQFGGQDPGTNEEIRNFAQSKYGVSFPIMAKIEVNGENTEPIFSFLKKASNGEDIKW
522 :     NFAKFLVDKTGERVTAYAPTVAPEDLKKDIEKLLN
523 : golsen 1.5 >fig|243232.1.peg.1222 CoB--CoM-reducing hydrogenase (Sec) delta subunit @ selenocysteine-containing
524 :     MDPVIIAFCCYQUGYGAADLAGTSRMQYPATVRIVRLPCTGKFDITYALRAFQKGADAVM
525 :     VVGUKKGECAYETGNLKAEERVRFAKQLLDELGIGGDRIDMFFMSAAEADKFVSAVNEMT
526 : golsen 1.1 ARVEKLGPNPLKAQ
527 : golsen 1.5 >fig|882.1.peg.2275 Carbon monoxide-induced hydrogenase proton translocating subunit CooK @ selenocysteine-containing
528 :     MQDILVALFHMIVFPGGAFALTLGLLLKGLDRKVEARLQRRVGPPIVQPFIDLVKLTTKE
529 :     TLIPATANRTFFLAAPLIGFTGMAVCAAFIPVPGVYDGMPGMGDMLVLFYLLPLPAIALM
530 :     VGGSASSSPFGAIGFSREMTMMLAYEIPLLAVLLAVALKVGHATGVGAELSLASVVAYQA
531 :     STGMLGLDPVMLPALLAYLLFLPGTAGVPPFDIPEAETEIIEGPLLEYSGPALGFFHLGA
532 :     ALKTVVVLGLGVAMFFPGTVPGGIVPNVLWFAAKUAGLMLLSLTLVKAATGRFRIDQAFT
533 :     FYLKLPTPLAMASLALAWLGF
534 :     >fig|882.1.peg.2458 DsrK-like protein @ selenocysteine-containing
535 :     MSDDTLKPHQEPGRTFKDRVMEVLPDGGNLNLCLTCGACSAGCPATGLEDMDPRKFLRMA
536 :     ALGMDEEVTTTPWVWMCTMCMRCMYVCPMQINIPQLVYHARASWPREKRPRGIVNSCDAA
537 :     LKTESNSAMGASPDDFAYVVEDVLEEVRSTQPGQEKLTAPVDKHGAMYFLNQNSREPVTE
538 :     PDEMVPLWKILDMAGADWTYGSVGWAAENYCMFAADDEAWETIVRNKVKAVEDLGCKVWL
539 :     NTEUGHELYAIRSGLQKFNIKPKFEIESIIRLYARWIREGKLPVSSEWNRERKVKFTVQD
540 :     PCQLVRKSFGDPVADDLRFVAKAVCGEENVIEMWPNRSNNYCCGGGGGFLQSGYPEARRY
541 :     YGRLKNEQIVATGAPYVIAPCHNCHSQISDLSDHYGAGYRVVHLWTLIALSLGILGENER
542 :     EYLGQDLCDCGL
543 :     >fig|243231.1.peg.66 AhpC/Tsa family protein @ selenocysteine-containing
544 :     MAIDEQKPVYELQKELDALREDYLAGMSPEHAATLQRTATELVLSGIVGHAATIGDRAQD
545 :     FTLPNAVGRQIRLSEVTAQSTAVVTFYRGAWUPYCSLQLRAYQAVLPRLRELGGELLAIS
546 :     PQTPDKSQATLLKNFLQYEVLSDVGNLVARSFGLVYPLGEEMRRIYLGFGVNLADYNGDE
547 :     SWELPLPGTFVIDGTMTIRYSFVDADYTRRLEPATILDVLERIREERGRDDNQAS

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3