[Bio] / FigKernelPackages / selenoprotein_ref_seq.pm Repository:
ViewVC logotype

Annotation of /FigKernelPackages/selenoprotein_ref_seq.pm

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.3 - (view) (download) (as text)

1 : golsen 1.1 package selenoprotein_ref_seq;
2 :    
3 :     use gjoseqlib;
4 :    
5 :     our $ref_seqs = [ gjoseqlib::read_fasta( \*DATA ) ];
6 :    
7 :     1;
8 :    
9 :     __DATA__
10 : golsen 1.3 >fig|83333.1.peg.3814 Formate dehydrogenase O alpha subunit (EC 1.2.1.2); selenocysteine-containing
11 :     MQVSRRQFFKICAGGMAGTTAAALGFAPSVALAETRQYKLLRTRETRNTCTYCSVGCGLL
12 :     MYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFIHSESRLKFPEYRAPGSDK
13 :     WQQISWEEAFDRIAKLMKEDRDANYIAQNAEGVTVNRWLSTGMLCASASSNETGYLTQKF
14 :     SRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANLVVVMGGNAAEAHPVG
15 :     FRWAMEAKIHNGAKLIVIDPRFTRTAAVADYYAPIRSGTDIAFLSGVLLYLLNNEKFNRE
16 :     YTEAYTNASLIVREDYGFEDGLFTGYDAEKRKYDKSSWTYELDENGFAKRDTTLQHPRCV
17 :     WNLLKQHVSRYTPDVVENICGTPKDAFLKVCEYIAETSAHDKTASFLYALGWTQHSVGAQ
18 :     NIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSQSLPGYMTLPSEKQTDLQT
19 :     YLTANTPKPLLEGQVNYWGNYPKFFVSMMKAFFGDKATAENSWGFDWLPKWDKGYDVLQY
20 :     FEMMKEGKVNGYICQGFNPVASFPNKNKVIGCLSKLKFLVTIDPLNTETSNFWQNHGELN
21 :     EVDSSKIQTEVFRLPSTCFAEENGSIVNSGRWLQWHWKGADAPGIALTDGEILSGIFLRL
22 :     RKMYAEQGGANPDQVLNMTWNYAIPHEPSSEEVAMESNGKALADITDPATGAVIVKKGQQ
23 :     LSSFAQLRDDGTTSCGCWIFAGSWTPEGNQMARRDNADPSGLGNTLGWAWAWPLNRRILY
24 :     NRASADPQGNPWDPKRQLLKWDGTKWTGWDIPDYSAAPPGSGVGPFIMQQEGMGRLFALD
25 :     KMAEGPFPEHYEPFETPLGTNPLHPNVISNPAARIFKDDAEALGKADKFPYVGTTYRLTE
26 :     HFHYWTKHALLNAILQPEQFVEIGESLANKLGIAQGDTVKVSSNRGYIKAKAVVTKRIRT
27 :     LKANGKDIDTIGIPIHWGYEGVAKKGFIANTLTPFVGDANTQTPEFKSFLVNVEKV
28 :     >fig|266940.1.peg.7369 Formate dehydrogenase O alpha subunit (EC 1.2.1.2); selenocysteine-containing
29 : golsen 1.1 MGIKTFLEGWPVYRQLTGDDPLGRGAATQSARSKSLTPRTATADRVAKSVCPYCAVGCGQ
30 :     RVYVKDEKVVQIEGDPDSPHSRGRLCPKGSASEQLVNGDSRATRIRYRAPYATEWSDLDL
31 :     DTAMDMITDRVIDARRRGWQDHDELGRRLNRTMGIASLGGATLDNEENYLIKKLFTAMGA
32 :     IQVENQARIXHSATVPGLGASFGRGGATGDLQDLSNADVIVIQGSNMAECHPVGFQWVME
33 :     AKARGAKVFHVDPRFTRTSALADTHVPIRTGTDIVLLGAIINRVLTQERDFREYVVAYTN
34 :     ASHLISEDFQDTDDLDGLFSGFDHETNSYDTKSWQYAGTEQHGDEEEETAESSDSESGHS
35 :     LGAGGAAVEHRSIQRDETLQDPRCVYQVLKRHFARYTPEMVADVCGIPTDLFEELAEAWI
36 :     SNSGREKTGALVYSVGWTQRGTGVQYIRAGAILQLLLGNMGRPGGGVMALRGHASIQGST
37 :     DIPTLYNLLPGYLQMPHVERHPDLAGYIDSIKGPAQKGFWANADAYTVSLLKAYFGDEAT
38 :     AENDYLFDELPKISGDHGTYSQVMDMIEGGKIFGYFLLGQNPAVGSANGRAQRLGMANLD
39 :     WMVVRDLVMIESATFWKDAPEVETGEIVPEQCRTEVFFLPAASHVEKEGTFTQTQRLLQW
40 :     REKAVNPPGDATSELWFFYHLGRRMREKLAGSTDPRDQLLLKLAWDYPLHGEEREPSSED
41 :     VLKEINGYGPEGLLPGYTALKADGSTSSGCWIYSGVYADDVNQAARRKPGREQSLHAPEW
42 :     GWAWPMNRRMLYNRASADPEGRPWSERKALVWWDEEAQRWVGDDIADFEATKPPSYRPPE
43 :     GATGVAAIAGDDPFIMQSDGKGWLYAPKGVVDGPLPAHYEPAESPFRNAVYTQQANPARE
44 :     VYTNHLNEVHPSPPELGSQVFPYVWITSRLTEHHTAGGMSRYLPYLAELQPALFMEVSPE
45 :     LARMRGLEHLGWAHVVTARAIVEARVLVTDRLAPLKVQNQLVHQIWLPYHWGQGGLTTGD
46 :     VVNDLMHLTLDPNVHIQEFKAGTCDVLPGRRPRGAAMLALIDEYRVRGGVTMASGAVAVT
47 :     ADLIARDGQERTDLAQGGDDHVGDGHDDDEIDRVLSVRHDVRSSPEHPQQDVEPAVLDAH
48 :     PARGLDRRAD
49 : golsen 1.3 >fig|266834.1.peg.1 Formate dehydrogenase O alpha subunit (EC 1.2.1.2); selenocysteine-containing
50 : golsen 1.1 MEAVPMNVDLSRRSFLKLAGAGAAATSLGAMGFGEAEAAVVAHVRPHKLTTTTETRNTCP
51 :     YCSVACGVIIYSKGDLRKGEAADIIHIEGDADHPTNRGTLCPKGAALKDFVKSPTRLQYP
52 :     MHRKPGSDKFERISWEDAFDRIARLMKDDRDANFIAANAAGVPVNRWTTVGMLAASATTN
53 :     ETAWATFKFAKALGIVGFDNQARVUHGPTVSSLGPTFGRGAMTNSWTDIKNTDLVVVMGG
54 :     NAAEAHPCGFKWVTEAKATRGAKLIVVDPRYTRTASVSDYYAPIRQGTDIAFLNGVMKYC
55 :     IDNDKVQWDYMKAFTNASYLVKDGFGYQDGLFTGYDAEKRDYDKSTWDYVLGDDGFVVTD
56 :     PALQHPRCVWNLLKAHLAPYTPEMVERICGTPKDKFLKVAEMISECSSPTKTMTSMYALG
57 :     WTQHSSGSQNIRAMAMLQLILGNIGVRGGGMNALRGHSNIQGLTDLGLMSHLLTGYLTMP
58 :     TEKDVDFTTYMSTRQFKPLRPGQTSYWQNYRKFMVSFQKAMWGDAARIDNDWAFNYLSKL
59 :     DVPAYDVLRVFELMYAGKVNGYICQGFNPLLAFPNRDKNTKALSNLKWLVTMDPLDTETA
60 :     RFWENHGDFNPVDTASIQTEVFQLPTTCFAEEEGSLTNSGRWLQWHWAGGTPPGEAKHDT
61 :     YIVAQIFLRMKEMYRNEGGAFPDPILNLSWDYADPNEPTPEELAKEINGRALTDLMDPAN
62 :     PMKVQVAAGKQILNFSQLRDDGSTMCGCWIYSGNFNEQGNNMARRDNHDPDDTGAYLGWS
63 :     FAWPLNRRTLYNRASADLQGKPWDPSRKLLEWDGTKWAGYDVPDIAPTAKPDEIGPFIMN
64 :     QEGTARLFSRGLMRDGPFPAHMEPFESPVANVFNPKMRGNPVSRVFQTDVAQMGLSDEFP
65 :     YAATSYRLTEHFHYWTKHNRVNSALQPEFFVEISEELAEEKNIENGGWVRVWSKRGSVKA
66 :     KAVVTKRIRPLMCDGKPVHVVGIPLHWGFTGSAKKGLGPNSLAPFVGDANIETPEYKAFL
67 :     VNIEPSTAPEEATV
68 : golsen 1.3 >fig|292459.1.peg.3209 Formate dehydrogenase O alpha subunit (EC 1.2.1.2); selenocysteine-containing
69 : golsen 1.1 MNLNRREFLRLSGVSAAGAALLLFAEEREALARDLKESRIARAKEVPSVCPHCSVGCGLI
70 :     GYVREGQLLQVEGNPDSPVSEGSLCPKGAATMQFAYDGVGRPNPLRQLTAKIRRPGSDRW
71 :     EEIGIEEALDRIARRIKETRDASFVERNADGLVVNRTESIAHIGSACIDNEECYLVTKLM
72 :     RALGVVYLEHHARIUHSSTVPGLGTSFGRGAMTTALWDIPNADVVVFMGSNAAENHPISF
73 :     KWFLRAKQKGATVICVDPRYNRTASKADWWIPFRSGTDTAVLGGLINYAITHNKFHREYV
74 :     VKYTNASLLVHPDFRFDDGLFSGWDPEAKKYDQSTWAFQTGPDGQPLSDPTLEHPQCVFQ
75 :     HIKRIYAEYTPEKVSEISGIPVDDFIKFAETVCATGTAGKSAVFVYAMGWTQHTKGVQNI
76 :     RTATILQMLLGNIGVAGGGIAALRGHANVQGATDLAVLYHDLPGYLGQPTEAHKSLSDFL
77 :     AKTTTKNSYWENKPKFLISLLKAWWGEHATAENDFCFDYLPKMAAGETYSHYDIFQSILD
78 :     GRVKGLIVVGQNPAVGSANARKVQAALAKLDWLVVSDLFLNETSEFWKLEGMNPAEIQTE
79 :     VILLPAAGPLEKEGSFTNTHRLIQWKHKMIEPMGESHSDGWYMVQIGKRLKQLYADSTAA
80 :     KDLPIKHLVWDYDDPDNPNEFDHLKVLKEINGYDVATGKPVSGFGALQDDGSTACGCWIY
81 :     SGIYPEEGVNKADARLRAAPNRPDGWTEAKADGSADYLHLGWGFAWPANRRVIYNRASAD
82 :     PSGKPWSKVPLVWWDEAEGKWTGVDVPDMLPVAPGQVHAVGVPGDTPFIMKAWGLGGIWG
83 :     PLPDGPLPVHYEPMESPTPNLLYRKQGTIPTMKIYDSEFDLFGDPERFPYVATTYRLTEH
84 :     LTSGVMTRTLPYLAEAFARHFCEIPRELAQREGIRNGDWVEVESARGKVRVQAMVTNRLR
85 :     PLRIGGRETFLIGLPIHWAPNSGHVQGDITNTLTPQAVDVNVQIQESKVFLANLRKVSVG
86 :     G
87 : golsen 1.3 >fig|224324.1.peg.724 Formate dehydrogenase O alpha subunit (EC 1.2.1.2); selenocysteine-containing
88 : golsen 1.1 MNYMDISRRGFLKLSVGSVGAGILGGLGFDLTPAYARVRDLKITKAKVTKSICPYCSVSC
89 :     GILAYSLSDGAMNVKERIIHVEGNPDDPINRGTLCPKGATLRDFVNAPDRLTKPLYRPAG
90 :     STEWKEISWDEAIEKFARWVKDTRDRTFIHKDKAGRVVNRCDSIVWAVGSPLGNEEGWLM
91 :     VKIGIALGLSARETQATIUHAPTVASLAPTFGRGAMTNNWVDISNSDLVFVMGGNPAENH
92 :     PCGFKWAIKAREKRGAKIICIDPRFNRTAAVADIFVQIRPGTDIAFLGGLINYVLQNEKY
93 :     QKEYVRLHTTGPFIVREDFGFKDGLFTGYDPKTRSYDTTTWDYEFDPATGYPKMDPEMKH
94 :     PRCVLNILKEHYSRYTPEVVSQICGCSKEDFLRVAEEVAKCGAPNKFMTILYALGWTHHS
95 :     YGTQLIRTACMLQLLLGNIGCPGGGINALRGHSNVQGMTDLAGQNKNLPTYIKPPKPEEQ
96 :     TLAQHLKNRTPRKLHPTSLNYWANYPKFFISFLKCMWGDAATPENDFAYDYLYKPEGGYN
97 :     SWDKFIDDMYKGKIEGVVTAALNFLNNTPNAKKTVRALKNLKWMVVMDPFMIETAQFWKA
98 :     EGLDPKEVKTEILVLPTAVFLEKEGSFTNSARWVKWKYKATDPPGDAKDEFWIFGRFFMK
99 :     LKEFYEKEGGAFPEPILNLVWPYKNPYYPTAEEILTEINGYYTRDVDGHKKGERVRLFTD
100 :     LRDDGSTACGGWLYCGVFPPEGNLAKRTDLSDPLGLGTYPNYAWNWPANRRVLYNRASCD
101 :     EKGRPWDPERPLLRWDPERDMWVGDIPDYPATAPPEKGIGAFIMLPEGKGRLFAAKSYVT
102 :     FKDGPLPEHYEPYESPVTNILHPNVPHNPVAKVYKSDLDLLGTPDKFPHVATTYRLTEHY
103 :     HFWTKHLYGPSLLAPVMFIEIPEELAKEKGIQNGDLVRVSTARASIEAIALVTKRIKPLK
104 :     VAGKTVYTIGIPIHWGFEGLVKGAITNFITPNVWDPNSRTPEFKGFLANIEKVKT
105 : golsen 1.3 >fig|207559.3.peg.3778 Formate dehydrogenase O alpha subunit (EC 1.2.1.2); selenocysteine-containing
106 : golsen 1.1 MNCTRRGFLKLAGAGAACISLAQLGFSLKEARAFAASLKIEGAKEVITVCPFCSVSCHII
107 :     AYVKNGKLISTEGDPDYPINEGSLCAKGAALLTMSTSHHRLLKPKYRAPFSDKWEEKDWG
108 :     WTLEQIARRVKDTRDKEIILENNKGQRVNRLESMFLLGTSHADNEECALVHQAMRGLGVV
109 :     HMDHQARIUHSATVAALGESFGRGAMTNHWIDIKNADAILIMGSNAAEHHPISFKWVLQA
110 :     KDKGAVVMHVDPKFSRTSARADFHVPLRSGTDIAFMGGMIHYILETESYFRQYVLDYTNA
111 :     SFIVGESYGFKDGLFSGYDIHTRSYDRSKWNFETDAQGTPKRDPSLKHPRCVFRLMQEHY
112 :     SRYTLDNVSSVTGVTKENLLKVYKAFAATGKPDKAGTMMYALGWTQHTVGVQNIRSAAIV
113 :     QLLLGNIGVAGGGINALRGEPNVQGSTDHCLLYHIIPGYMTMPMADWQTYADYNKANTPV
114 :     SADPQSANWWQHKPKYLTSLLKAWFGDAATAENGYCYGLLPKIEKGADHSYMFLFDRMYS
115 :     GKITGGFIIGLNPMNSVPNTNKVRKALDNLDWLVTAELHHSETTDNWRRPGVDPATVKTE
116 :     VFLLPSAHRVEKAGSVSNSGRWLVWHHKAVEPEGEARSFGDMFVPLINVVRDLYRKEGGT
117 :     MPEAVLNLDWPQQYDPEEWARRINGFFLKDTTVNGKEYKKGQLVPSFTALADDGSTSSLN
118 :     WLYSGSYTEEDGNKAQRRDPSQTPMQAAIGLYPKWSWCWPVNRRILYNRASVDAQGKPWN
119 :     PAKAVISWNGKKWEGDVPDGGWPPMATGKGRHPFIMSKHGFGQLYGTGRMDGPFSEHYEP
120 :     VETPIDAHPFSKQLSSPVYKFVSSDMDKLARPADPRFPYVLTTYNVTEHWCGGGETRNVP
121 :     NLLEAEPQLYVELSPELAEEKGIANGDGVILESARGRVEAIAMVTVRIRPFTVQGKTVHL
122 :     VGMPFCFGWTTPGTGDSTNRLTPSVGDPNTSIPEYKASCVNIRKADTLTEIDR
123 : golsen 1.3 >fig|292459.1.peg.3210 Formate dehydrogenase O alpha subunit (EC 1.2.1.2); selenocysteine-containing
124 : golsen 1.1 MALTRRDLLKSSLAAGGALSLLGLGGKAEAKERDDLKIEGAKDYRTICCYCSVGCGIQLW
125 :     VKDGEVVHVNGDPDHPINEGTLCPKGASIANLRIVADKNNQYQPNPRRLTKVLYRAPGAT
126 :     DWEEKDWDWAIERIARNVKAARDATFERVDENGVTVNRTFAMAHIGSAALDNEENYVLAK
127 :     LMRGLGIVRLEHHARLUHSSTVAGLAPTFGRGAMTNHWTDYQNTDVFMVLGTNPAENHPI
128 :     SMRWIDRARETRGAKLIVVDPKFNRTAAKADLYVQIRPGTDIAFLGGLMNYAMTHGRYFH
129 :     EYVAKYTNASYLIHPDFKFEEGLFSGAQVGEDGQVKYDTATWQYQVDEDGNIKKDPTLQH
130 :     PQCVFQLMKKHYARYTPEMVAETCGMTVEEFLEVAELFTSTGRPDKAGNIMYAMGITQSS
131 :     HGSQNVRAVAMLQLLLGNIGIPGGGVNAHRGESNVQGSTDMAMLWNNLPGYMPMPSAAQH
132 :     PTLAAYQASTPKSGYWTNRPKFMVSLLKAWWGENATAENDFAYDYLPKLDHRDHSHMSIF
133 :     EAMGRGELKGLFAWGQNFAVGGPNVTKERSALANLDWLVVVDLFETETAAFWKGPGMNPA
134 :     EIQTEVFLLPAAASYEKCGTVTNSGRWIQWRDKAVEPMGDSRDDLWIADRLFKKLRELYA
135 :     TEGGAFPDPILQLHWDYDDGDHPSAEKVAFEINGYTWADRKGLTTFGNLQDDGSTACGCW
136 :     IYAGYFDNFETPKCRSRVKDEPGTTLGTHLGWAWAWPVNRRILYNRCSMDEHGQPWDPER
137 :     PLFRWDGEKFIAQDVPDFVATNPPEVSAQNPFIMMQEGVGALWSPSGMKDGPIPEHYEPV
138 :     ESPVSNRFNRRQFNPVAVISGKGEFGALTEAENPEFPYICTTYRVTEHWQSGAMTRSLPW
139 :     LGEMMPDMFVEISPTLAAKLGVQSGDRVEVTTVRGSLVAPAMVTPRMRPVRVHGREIEIV
140 :     GMPWHWGFMGKFTGASANVLTPHVGDANTQIPEYKAFLCNVKKAGGSGPVRG
141 : golsen 1.3 >fig|360106.3.peg.1723 Formate dehydrogenase-O, major subunit (EC 1.2.1.2); selenocysteine-containing
142 : golsen 1.1 MSEAHIGRRSFLKLAALGAGSTMAFGKENETLRTATNEEIKNPFPGSKKVRTICTICSAG
143 :     CGIEAEVKDGVWIRQDMAIDHPISQGSHCCKGIDQIDLTKSKQRVKYPMKKVNGKWERIS
144 :     WETAINEIGDKLLEIRKEDGPDCVEFLGSAKFSNEQAFYFRKFAAFWGTNNIDHVARIXH
145 :     SATVAGVANTWGYGAMTNHFGDVTANSKAILLIGANSAVANPIGFKHMLQAKDRNNCKLI
146 :     VVDPVYTKSAAKADYFVRLRPGTDIAFAYGMLHLIFKNGWEDKEFIKTRSYAVDEIRKEA
147 :     EHWTPQETENVTGIPAEQLIEITRVFATTKPATLAWALGVTQHSVGSSNTRIYALLQLIL
148 :     GNVGKAGGGCNIIRGHDNVQGATDMNNLADSLPGYYGLGDAAWKHFCKGWGQDYDKFIKR
149 :     FATSVKEPREKLGDDVEGTKFKEYFYHDPKTPEDRNWRNEKGYSLSKWWQGVLKEENTFS
150 :     SGNLRVLWVQGTGITSMAHLTKIKEAIDKLDMLVVVEPFVNEVAILSDRKDGVYILPAAT
151 :     QFESSGYVSATNRSAQWRSQVIPPIYESKEDQEVMMLFAKKFGFYDEYVKGMMMDVVDGE
152 :     LKKVKDSFVWPDDATNEIARTTQSIGNNGRTADRLKKHQENWINFDPDTLMGKPGSPVAG
153 :     EYYGLPWPCWNKNHPGSPVLYDVTKPVWKGGMGFRNRFGLEHNGVSQLADDSITIPGSKV
154 :     KGGYPQITKDNIEKVLGITLSEEEKAKMGSGWNMDYSGIIAKKCEEAGVSPCGNAKARAI
155 :     VWEFIDQYPKHREPIHSPRKDLVEKYPTFGDQAKNFRVSTKFESEQKAQDWSKDFPTIIS
156 :     SMRLVNLSGAGMIERTSKYLAHITPEMFAHVNPELALKYGIQDGEMMWIHSPQGTKIKVK
157 :     CIHSHSVTPDRICLPYNFAGVMQGVDLSARYPEGTKPYTIGESSNTITNYGFDIVTQISE
158 :     FNAGLCRLERASDQSTFKTAFFDEK
159 : golsen 1.3 >fig|292459.1.peg.3216 Formate dehydrogenase-O, major subunit (EC 1.2.1.2); selenocysteine-containing
160 :     MAELSRRDFLKLGGVAAGALAVGLPQRPARAAQADVRKVPTLCEMCTSRCGVFAVVENGR
161 :     VTRIEGNPAHPVNLGRPCARGNAGASALYDPDRLKEPMKRGEDGKLYPITWEQAVEEIGA
162 :     KLNEIRKRHGPEALVFAEYNNLNSTLTKRWTEAFGSPNHVGHAANCFANRNVGYSAVFGA
163 :     LPSVDYENVKFYLSPGRNLLGGIKVSEVAALAKAKANGARIVVLDPRHSELAGWGEWIPI
164 :     KSAGDLAFLLAVANVLITEGIYNKAWVEAHCNGFEQLAEGIREYTPEWQEQHTDIPAEKV
165 :     RQLAREMAAAAPATVVDPGWHGGNGMYWNGYEAARAGAIVNALLGNLGAKGGLKLSPKVA
166 :     LGTIDNPPEGAVLEAAGGGXAATGTSAGAEVWTPYPKPTAVRFDGMGTKYPLSLGSIQAI
167 :     PLVVESGKPYPLKAAIFFRVNPVKSSGDQRRWIEALKRLDLVVAIDTQMSETAMLAHYVL
168 :     PEHHYLERMDAISVVGDTVSIRQPVVEPMYNTRSCLEILQGLAKVVGIEQYFNFTMEQWN
169 :     NALLGPTGWTVKHLKEKGVIKVSATPPDYSKLPTSSGKAELVHKGFALSGGHEVVTWVPP
170 :     KTQPEGDRLRLLHGHMAVHTNGYTQNVPALYARMPENDLWIHPTAAAARGIQDGDLVEVA
171 :     NEYGVQRIRARVTEGIRPDCVWMCHGFGTMAPEQRLAYGKGAADGWFYPILVTPVSAALG
172 :     QGDATVTVRKVGEKV
173 :     >fig|83333.1.peg.1460 Formate dehydrogenase N alpha subunit (EC 1.2.1.2); selenocysteine-containing
174 :     MDVSRRQFFKICAGGMAGTTVAALGFAPKQALAQARNYKLLRAKEIRNTCTYCSVGCGLL
175 :     MYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYVNSENRLRYPEYRAPGSDK
176 :     WQRISWEEAFSRIAKLMKADRDANFIEKNEQGVTVNRWLSTGMLCASGASNETGMLTQKF
177 :     ARSLGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANVVMVMGGNAAEAHPVG
178 :     FRWAMEAKNNNDATLIVVDPRFTRTASVADIYAPIRSGTDITFLSGVLRYLIENNKINAE
179 :     YVKHYTNASLLVRDDFAFEDGLFSGYDAEKRQYDKSSWNYQLDENGYAKRDETLTHPRCV
180 :     WNLLKEHVSRYTPDVVENICGTPKADFLKVCEVLASTSAPDRTTTFLYALGWTQHTVGAQ
181 :     NIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSTSLPGYLTLPSEKQVDLQS
182 :     YLEANTPKATLADQVNYWSNYPKFFVSLMKSFYGDAAQKENNWGYDWLPKWDQTYDVIKY
183 :     FNMMDEGKVTGYFCQGFNPVASFPDKNKVVSCLSKLKYMVVIDPLVTETSTFWQNHGESN
184 :     DVDPASIQTEVFRLPSTCFAEEDGSIANSGRWLQWHWKGQDAPGEARNDGEILAGIYHHL
185 :     RELYQSEGGKGVEPLMKMSWNYKQPHEPQSDEVAKENNGYALEDLYDANGVLIAKKGQLL
186 :     SSFAHLRDDGTTASSCWIYTGSWTEQGNQMANRDNSDPSGLGNTLGWAWAWPLNRRVLYN
187 :     RASADINGKPWDPKRMLIQWNGSKWTGNDIPDFGNAAPGTPTGPFIMQPEGMGRLFAINK
188 :     MAEGPFPEHYEPIETPLGTNPLHPNVVSNPVVRLYEQDALRMGKKEQFPYVGTTYRLTEH
189 :     FHTWTKHALLNAIAQPEQFVEISETLAAAKGINNGDRVTVSSKRGFIRAVAVVTRRLKPL
190 :     NVNGQQVETVGIPIHWGFEGVARKGYIANTLTPNVGDANSQTPEYKAFLVNIEKA
191 :     >fig|138119.3.peg.4655 Formate dehydrogenase N alpha subunit (EC 1.2.1.2); selenocysteine-containing
192 :     MEVTRRGFLKLSGASLFALASGLGFDPQIAQAQGFSLRIEGTTKIPSICHFCSGGCGLLL
193 :     HIKDEKLVYLDGDPDNPVNSGALCPKGASLGHVANAKDRVTKPRYRAPGSSDWQDISWDE
194 :     AINKIASKIKEVRDTTWMATEEIGGTAYNVNRADGIAVLGSAEVDNEESYLIKKLSELIG
195 :     TPYNEHQARIUHAPTVASLSPSFGRGAMTNSWTDMQNTKCFLIAGSNCAENHPIAMRWIN
196 :     KAKENGAKVIVVDPRFTRTASQADIFAQVRPGADIAYLNAIINYILENKLYDQDYVLNHT
197 :     NGLYKISKDFKFADGLFSGFDPETKKYNFDSWAYQLDAENKPVKAESLDDPDCVFGKLKE
198 :     HFSRYTLEVGADISGIPAEKIKEIADTFCNTRPGSILYALGMTQHTTGVQGIRSYAIIQL
199 :     LLGNVGKAGSGIQALRGEPNVQGSTDMANLFNNLPGYLPAPVHTDKDLRSYLVRSGSAFE
200 :     RHIVSQLKAWFGENATKENDYCFNYLPKYNSGKNYSMVKLWEAANNGQFKMLLNFGSNSM
201 :     VSIPNRQIVREGLAKLDMLVIADVYEVETAQFWREKDPTTGELLVDPAKINTEVILLPAA
202 :     FVYEKGGTLSNSGRWIQWKDAALKPPGEAKPDLDILDHIYHKLKELYAGSTDPKDEPILK
203 :     ARWDYGHEPDPLKVLQEISGYDETTGKVLPTLADYLKAPIGSASSGCWIYAGVTGNGNLA
204 :     ARRDNSDPSGLGLYRNWSFSWPGNIRILYNRGSCDMNGQPLDENRKLIWWDAAKNSWEGN
205 :     DGADVPDKTKGPDTPEGKQVFRMNPEGVGRLFTAKYFSGIPATPAADGLPHIGVRPAGQC
206 :     NDGPLPEFYEPVESPTVNSLHPDVSSNPTVPIPNFLPGVTNHGSKEDFPYVLTTYALVEH
207 :     FCAGGITRNIPMLNELMPQPFAEISKNLAQKIGVKEGDMVEVSSARGKVQVVALVTDRIQ
208 :     TLKINGQDSETIGMPWSWGFASLSPGPTTNNLTISAIDPTAGTPEYKCCLVNIRRA
209 :     >fig|246194.3.peg.767 NAD-dependent formate dehydrogenase alpha subunit; selenocysteine-containing
210 : golsen 1.1 MADVTLKINGIEVTVPEGTTILEAAQIAGFKIPTLCYDPELSKPGACRICVVEVKGARNL
211 :     VASCVTPVAPGMEVLTHSEPVINARREILDLLLSNHPEDCLTCDKMGECALADYAYEYGV
212 :     RRGSYQGEKNVYPIEDNNPFIVRDMNKCILCGKCVRVCDEIVGYSVIDFINRGFKTKVAP
213 :     PYDGTLAESNCVFCGSCVTVCPTGALTVKDTRGKFRPWEVKRVKTTCPYCGVGCNFDLLV
214 :     KDDKVVGVAPNPTSEVNGRFMCVKGRFGYKFIHSDDRLTKPLIKKNGELTEASWDEALTL
215 :     VAEKLGEIKAKYGSDSIGVLASAKCTNEENYLLSKFTRAVLGTNNIDHCARLUHSPSVAG
216 :     LAAAFGSGAMTNSFEDIMETELIMLIGSNTTESHPVAGYKIKQAVKKGAKLIVIDPRNIE
217 :     LASYADLHLQLKPGTNLPLLNAMAHVIIEEGLYNEQFIRERTEGFDSYKDTVKDYSPEAV
218 :     AEICGVPAEKIREAARMYAKAGKAMILYTMGVTQFSFGTYGVLAVANLAMLTGHVGKDGA
219 :     GVNPLRGQNNVQGACDMGGLPNVFTGYQRVDDPAANEKFSKAWGVKLPEKPGLTLGEMFD
220 :     GALKGNIKAMYIMGENPVLSDPDARHIEEALKKLDFLVVQDIFLTETAKFADVVLPAATF
221 :     AEKDGTFTNTERRVQRVRKAIPCVGEAKPDWEIIALVATKMGYPMSYSSAEEIFDEMRTL
222 :     TPSYAGITYERLEKKSLQWPCPAPDHPGTKFLHSDKFVRGKGLFHPIPFKEPEEKPDSEY
223 :     PFTLITGRRLYHYHTGTMSRRSMMGEHVPEDHLEMNPADAKKLNIKDGDRVRVTTRRGSV
224 :     EIKVALTDKVPEGTVFASFHFFESPVNQVTNPARDPMAKTPELKYSAAKIEKL
225 : golsen 1.3 >fig|177439.1.peg.682 NAD-dependent formate dehydrogenase alpha subunit; selenocysteine-containing
226 : golsen 1.1 MKKVTLTINGRSVTAPEGSYVLQAALQKGIYIPHLCYHNDLEPVGACRLCTVRVNGRWDA
227 :     LSCKTPVEEGMVIETETETIAKTRKIAIELLIADHDMDCLACARNTTCKLQQAADYIGVN
228 :     KKHLARLKKPEVLLPIDDSNPFFDFDPNRCVLCGICIRTCDELQNINAIDFAYRGLTTKV
229 :     AGFGDKARILSNCESCGECVARCPVGALTEKDYVKPSHWVKTVCAYCGCGCGLDLGVRDN
230 :     KIVSARGEHGNPANRGRLCVKGRFGFNYVNSKERLTTPMVRRPEGFVPVSWDEALDLIAD
231 :     NFAKNKGDSFAAVSSAKCTNEENYLLQKFTRTVMKTNNIDHCARLUHAPTVAGLATAFGS
232 :     GAMTNSIAEIGDAQVILAIGTNTTAAHPIIALQIKDAVRRGAKLIVINPKRIDLCKHAHI
233 :     FLQNTPGSDIPLLMTMMRIIVEEDLIDKEFIEERCENYPAFLASLQQFELEDVAELTGIP
234 :     AETIREAALCYATESPATILYCMGITQHVHGTDNVLATSNLALLTGNVGKESTGVNPLRG
235 :     QNNVQGSCDMGALPDVYPGYQKVVNNTAAFEEKWQTSLSAVPGKTHTEIFDGLYDGSIKS
236 :     VYLIGENPVLSEANASHAIEAMNRAKFLVVQDIFFSETAELADVILPASSFAEKDGTFTN
237 :     TERRVQRVRQAIEPVGDSRPDWWIIKEIATRMGAKGFDHEGPEQIMEEISATIPNYAGIN
238 :     YDRLQHGTLQWPCPSTDHPGTKFLHAERFATANGRARFMPLKTRKTTEQVDKKYPLLLNT
239 :     DRSLFHFHGTMTRRVFGLNVLDRGENLIIHPEDAEKFSLTDGEIVEVRSRRGAVKVAVEI
240 :     NDSCRPGSVSMSFHFSETPTNMLTSGALDPVAKTPGTKICAVQINKL
241 : golsen 1.3 >fig|714.2.peg.2081 Formate dehydrogenase H (EC 1.2.1.2); selenocysteine-containing
242 : golsen 1.1 MALDNNNNLSISCCSSNKDITMAIKKVITVCPYCASGCKINLLVENNKIVGAEGANGKTN
243 :     EGELCLKGYYGWDFVHDTKILTPRLTQPMIRYKRGEPFTPVSWEEAISYSANRLKEICEK
244 :     YGNESIMVTGSSRGPGNEVNFVMQKFARAVLGNNNVDCCARVUHGPSVTGLLKSVGNGAM
245 :     SNSIVEIEDTKCVFIFGYNASTSHPIVARRINHAKEKGAKIIVCDPPKIETARIADIYAP
246 :     LANGSNVAFLNAMMNVILEEGLQDQKFIDEHTENFDAFYETVKAYTPESTQHITGIDPEM
247 :     LREIARTYAKAETATILWGMGVCQFRQGVETVRALASLAMLTGNLGKPNVGVNPVRGQNN
248 :     VQGACDMGALFNTLPGYQSFADPETNAKFAKAWGVPSIPTKPGVPLSEVPHAVKEGKLKA
249 :     FYIMGEDTLQTEPDINAMKQTFKDLEFIIVQDIFMTQTAAEADVILPATSCAEHEGVYSA
250 :     ADRGFQRFYKAVEPVGNVKDDWEIISLIAQALGYPMHYNNTKEIWDELRELCPIYKGATY
251 :     EKMEGLGYIQWPCTDEGPEDQGTQYLYEGQIFDRKGGKAEFFACDWEPPMEDLSEEFPLV
252 :     LSTVREVGHYSCRSMTGNCRALAALADEPGFVQMNDQDAKALGIKNNDLVWIASSRGKVI
253 :     SHADVSTRTNKGACYMTYQWWIGKCNELTAEHLNPGSRTPEYKYSAVRIDKIEDQAWAEH
254 :     YVVAEYTKLKNRLKQTALVA
255 : golsen 1.3 >fig|190192.1.peg.319 Formate dehydrogenase alpha subunit (EC 1.2.1.2); selenocysteine-containing
256 : golsen 1.1 MARMRFVPQVCPFCGCGCGILVGTDGEEIKLLEPWRRHPVNEGRQCVKLWELPEAVQKDR
257 :     LERPVRMTESGEPRELSWNRALEEVAEVLSTHEPEEVYFVTSAKATNEDNYVAQKLARTL
258 :     GTNNVDHCARLUHAPTVVALSELLGSGAMTNSIPDLVEADCYLVAGSNTAEQHPIVYRRI
259 :     LQGLEENDADLIVLDPRRTQIAELADIHLQVRPRTDLIVFLYMAKVIVEEGLHDGTFIEE
260 :     RTTGFESFEEYVREAVSEGDVRRIAGVDPEDVRKAAVRYAEAERGCILYCMGLTHHDIAT
261 :     RTVRALCALALLTGNVGRPGTGVNPLRGQNNVQGACDVGALATHFPGYRPINTETANEMS
262 :     KIWSFEVPDEPGLKLTEAFDADEITVMYVVGENPAVSEPNTRHAVEKLESLEFLVVQDLY
263 :     LTETGELADLVLPAAGWAERTGTFTATDRRVQLAEKAVEPPGEARPDWWILEAVARRLGL
264 :     KGFGHRSPREVFEEIRRVVPQYRGITYERLRRRPGGIHWPCPSEDHPGTPILHTEEFATE
265 :     DGKARFPKPEDVEYREPERDVDEEYPLILTTGRVYAHYHTRTITRRSRLLSEEVPESFVE
266 :     IHPKDAERYGVRDGELVVVETPYGEWRCRARVTDRVREGTIFTPFHFGENVLTPHDVRDP
267 :     ESGIPEYKYVPARVRPDSRGSASRG
268 : golsen 1.3 >fig|6239.3.peg.13805 Thioredoxin reductase (EC 1.8.1.9), metazoan type; selenocysteine-containing
269 : golsen 1.1 MKSLTELFGCFKRQPRQQEASSPANPHVSDTLSMGVAASGMPPPKRPAPAESPTLPGETL
270 :     VDAPGIPLKEALKEAANSKIVIFYNSSDEEKQLVEFETYLNSLKEPADAEKPLEIPEIKK
271 :     LQVSRASQKVIQYLTLHTSWPLMYIKGNAVGGLKELKALKQDYLKEWLRDHTYDLIVIGG
272 :     GSGGLAAAKEASRLGKKVACLDFVKPSPQGTSWGLGGTCVNVGCIPKKLMHQASLLGHSI
273 :     HDAKKYGWKLPEGKVEHQWNHLRDSVQDHIASLNWGYRVQLREKTVTYINSYGEFTGPFE
274 :     ISATNKKKKVEKLTADRFLISTGLRPKYPEIPGVKEYTITSDDLFQLPYSPGKTLCVGAS
275 :     YVSLECAGFLHGFGFDVTVMVRSILLRGFDQDMAERIRKHMIAYGMKFEAGVPTRIEQID
276 :     EKTDEKAGKYRVFWPKKNEETGEMQEVSEEYNTILMAIGREAVTDDVGLTTIGVERAKSK
277 :     KVLGRREQSTTIPWVYAIGDVLEGTPELTPVAIQAGRVLMRRIFDGANELTEYDQIPTTV
278 :     FTPLEYGCCGLSEEDAMMKYGKDNIIIYHNVFNPLEYTISERMDKDHCYLKMICLRNEEE
279 :     KVVGFHILTPNAGEVTQGFGIALKLAAKKADFDRLIGIHPTVAENFTTLTLEKKEGDEEL
280 :     QASGCUG
281 : golsen 1.3 >fig|99883.3.peg.26915 Thioredoxin reductase (EC 1.8.1.9), metazoan type; selenocysteine-containing
282 : golsen 1.1 MPPIDNESGKNDLKSRIQQLIDSNQVMVFSKSYCPFCVQVKDLFRELQVECNVVELDLME
283 :     DGTNYQEMLLEMTGQKSVPNVFINKTHVGGCDKTMQAHKDGSLQQLLNGQNEAYDYDLIV
284 :     IGGGSGGLACSKEAALLGKKVMVLDYVVPTPKGTSWGLGGTCVNVGCIPKKLMHQTALLR
285 :     TAIQDARKFGWEFDEAVTHNWETMKTAINDYIGSLNWGYRVSLRDKNVNYVNAYAEFVDP
286 :     HKIKATNKRGKETFYTAARFVLATGERPRYLGVPGDKEYCITSDDLFSLPYCPGKTLVIG
287 :     ASYVALECGGFLAGLGLDVTVMVRSILLRGFDQDMANRAGQYMEEHGVKFLRKYVPVQVG
288 :     GPRKRAGVGARLVLHVQKSSSLTSVWQIEELEAGTPGRLKVTAKSTESDEIIEEEYNTVL
289 :     IAVGRNACTDKIGLDKVGVKVNPKNGKIPVNDEEQTSVPHIYAIGDILEEKWELTPVAIQ
290 :     AGRLLARRLYGGSKVKCDYVNVPTTVFTPMEYGACGLSEERAVGLYGQENIEVFHTQFWP
291 :     LEFTVPGRDNNKCYAKIICNKLDSGRVVGFHYLGPNAGEVTQGFSAAMKCGATKEQLDGT
292 :     IGIHPTCAEIFTTLEVTKSSGKSIIQTGC
293 : golsen 1.3 >fig|177439.1.peg.3237 CoB--CoM-reducing hydrogenase (Sec) alpha subunit; selenocysteine-containing
294 : golsen 1.1 MGKVLTIAPVTRIEGHAKIAIHLDDTGNVENAFLHIQSLRGFEKFIEGRPAEEVPRLVNR
295 :     ICGICPWMHHIASNKAVDRCFDVTPTATGYKLRELCQVLAHVNDKILHFFFLAAPDFVLG
296 :     PDADHSVRNVMGVVKAAPELASKVVKMRQLGQMMLEKFAGKAIHPIAGVVGGFSKPMVEE
297 :     ERKELLEGARTLLDFSTYALDFAINNVFSKYMDVIGELGVIKTGFLGTVDRQDGSLRLFD
298 :     GNLRMMKADGSFEEFQNRDYADHIGEHTVPWGYSKMPYAKFWNEGFDMSLGAPKGIYRSN
299 :     TLARINVCDKISTPKAQAALEAFRELFGRPAQQTLLYHYARLIEMVYACERTIELLEWDG
300 :     ITDPHVRAEVTPRAGRGVGVVEAPRGTLIHDYTTDDDGCVTSANLIVGTTHNIAPMNMSV
301 :     RQAASSLIKDGKYDEGILNRVEMAVRAYDPUMSCATHRLDGGLPVTVSIMDKEGVEIDRI
302 :     VK
303 : golsen 1.3 >fig|267377.1.peg.1724 CoB--CoM-reducing hydrogenase (Sec) alpha subunit; selenocysteine-containing
304 : golsen 1.1 MGKVTIEPLSRLEGHGKVSITLDDAGKPTDVKLHITALRGFEQFVVGRPAEEVPRIVPRI
305 :     CGICQTPHHLASVKAVDAAWGAEVPSAAEKLRELMHLGNMMHSHALHFYYLAAPDFVLGP
306 :     DSDPAARNIIGVIGAAPEVAKKAIAMRRVGQSIVETIGGRAIHPVTGVPGGVSKALSEEK
307 :     RDELLNEIDEMIAYGQDGIALIKSLNEKYMDLAKTLGVIDTWYLGMVKDGKHNFYGDTLR
308 :     FMSPDGKQTTDFKPSEYLDNIGEHVVGHNYVKYPYNKKVGYPDGLYRVGPLAMLNVCDSM
309 :     PTPLAEEARKDFADTFGKPANQSLAYNHARLIELLASCERVKELLEDSEITSTDIKAEVE
310 :     PKAGNGVGAIYAPRGTLFHNYETDDKGIVVKANMIVASTHNVPTMEKAIQQAAEVVFKXA
311 :     TVVKMVDEAKLNLIEIVLRAYDPUYSCAAHMIVKDEQGKVLLEVKKEE
312 : golsen 1.3 >fig|243275.1.peg.78 Betaine reductase component B beta subunit (EC 1.21.4.4); selenocysteine-containing
313 : golsen 1.1 MIYKAIHYINQFYAGIGGESSADSGFVVLRDKKGPAIGLEGLWHGKMIVTKVICCGDNYI
314 :     NLDRNFEEVCRQLKKIVEEEKPDVLIAGPAFNAGRYGMACAKICDYVRSNLNLPSVTAMW
315 :     HENPAVKIYVRNNYIISSTETAAGMHKTLQDLADLALKLAKKEKIGPARIEGYLPTGHRY
316 :     NEYHKKTGAERVVDMLLDKLNGRPYQTEVPLRGFERVPPAPPIHKMNKTTIALFTTGGLV
317 :     PIGNPDKLKQAFAEDFKVYDISNRDTLPQGVYESIHGGYDTTAASAEPNRLIPLDALRQC
318 :     EAEGIIGGIYPYFGTTCGVGTNVAVSESMGKAWARKIKEEGVGAVILTSTUGTCTRCGAT
319 :     ICKELDRVGIPNVHINAFTSISESVGANRIVFGGGFTAPVGNPMLPLERETAYRRKIVDK
320 :     ALEALQTEVLSPTVFTVDHDKEG
321 : golsen 1.3 >fig|891.1.peg.7228 Betaine reductase component B beta subunit (EC 1.21.4.4); selenocysteine-containing
322 : golsen 1.1 MKKAVLYINQFFAGVGGETEADFEPEIREGLVGPALELDKQLKNAEVTHTVICGDNFIGS
323 :     NQEEAVKRILEGLEGIEFDIFFAGPAFQAGRYGSACGFICRAVKEKFGVETVSSMHVENP
324 :     GVLMFKKELYIAEGGHIAAKMRKDIKKMANIGDKLLAGETMLRAAAEEFFPRGIRHQFWP
325 :     EEARPAAIRAVEMLQKKLSGENYQTELPIPKSDRVEIAKPVTDLSKARIALMNTGGIVPV
326 :     DNPDKIQSASATRWGKYDISGMDRLESGVFKTIHAGFDPAAADADPNVIMPVDVMRAFEK
327 :     EGKIGELYKDFYSTVGTGTTEAEARRMAQEIVVHMKEAQVDAVLMVSTUGTCTRCGATMV
328 :     KEVEKAGFPVVILCNLIPVAKSVGANKIVPTISIPYPLGDPATSQEEQLKLRRHRVEVAL
329 :     DALAQDIEEQTVFKVKI
330 : golsen 1.3 >fig|1496.1.peg.3938 Glycine reductase component B gamma subunit (EC 1.21.4.2); selenocysteine-containing
331 : golsen 1.1 MGKLKAVHYINQFFAGIGGEEKADTKPHVAETLPPISLQLDKLLGEDIEIVGTVVCGDSY
332 :     FNENIDSASEEVLSMVKGFEPQLFIAGPAFNAGRYGVAAGTITKVVKDALNIPALTGMYV
333 :     ENPGADMFKKDVYVVETSDSAAGMRKALPKIAKLAVKLANGEEIGTPKDEGYIARGIRVN
334 :     YFHEDRGSKRAVDMLVKKIKGEPFETEYPMPNFDRVDPSKAVKDLSKCKIALVTSGGIVP
335 :     KGNPDRIESSSASKYGTYSIAGVMDLTEETYETAHGGYDPVYANLDADRVLPVDVLRDLE
336 :     KEGVIGKLHETFYTTVGNGTSVANSKKYASEIGAALVADGVDAVILTSTUGTCTRCGATM
337 :     VKEIEKTGLPVVHMCTVVPISLTVGANRIVPTIAIPHPLGNPALDPTEEKALRRGLVEKA
338 :     LNALTTEVDGQTVFEK
339 : golsen 1.3 >fig|243232.1.peg.1226 Formylmethanofuran dehydrogenase (tungsten) subunit B (EC 1.2.99.5); selenocysteine-containing
340 : golsen 1.1 MVKVVRNVVCPFCGTLCDDLEILVEDNHIVGTRHACRIGNAKFMHFEGAVRYTEPLMREN
341 :     KKDDFKKVDYETAIEETARLLTEATLPLIYGWSATECHAHMYGVELAELVGAVIDNTASV
342 :     UHGPSLLAVQDVGYPVCTLGEVKNRADVIIFWGSNPMHAHPRHMSRYSVFARGFFRERGR
343 :     EDRTLIVVDPRETDTAKLADIHLQVEPHKDYELVSAMRAVLKGFELQVDKVAGVPADLIY
344 :     EAVEVCKNAQFGELFFAMGVTMTRGKHRNIDNAIQLVIDLNAYTKFGLMPMRGHYNVNGF
345 :     NQVLTWVTGYPFGVDFSRGYPRYNPGETTANDLLQRGETDMMLNIASDPGAHFPQKAVQH
346 :     MAKIPLVCIDPHETPTTQLANIIIPPAIAGVEVEGTAYRMDGVPIQLRKVIDPPEGVLPD
347 :     REILKILIKKVKEML
348 : golsen 1.3 >fig|190192.1.peg.927 Coenzyme F420 hydrogenase alpha subunit (FruA) (EC 1.12.98.1); selenocysteine-containing
349 : golsen 1.1 MAEGAVEIQPTTRHEGHAKLVLYVDDEGYVERAFYLNTSAVRGFEALAKGRPAEFVQVAV
350 :     MRICGICQATHGTASAEAFERAMGIEPPKDGKLLRELCALGNRIQSHVLHQLLVLDDFVE
351 :     DESEKVEAVKRIQQIRRIGQYVVDVVGGEGIHPPNIRIGGMAENISEAARRKLYRRLREA
352 :     RELMMEQHEFMVNIVERFGDENDLDIDEFGRHDQPFLATHPTYGDPDRLDMDRVVELLPI
353 :     EYYGEEHKEVAYQHRGQIPLYDGVPVEVGPRARYILFDGVDPRGVLYIHVLRSQETLAAI
354 :     DRAMTILDELNTSGKTLAEWEPKAGVGIGVHEAPRGTNVHIAKVNEKGIVEDYRIIAAST
355 :     WNFPVVEKAIEGENEEYAEVIMRCYDIUASCAAHVVKEVRDADSREKIRESVVKLA
356 : golsen 1.3 >fig|9913.1.peg.588 Selenoprotein P precursor; selenocysteine-containing
357 : golsen 1.1 MWRGLGLALALCLLLTGGTESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUY
358 :     LCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQ
359 :     PDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLSRP
360 :     QDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLS
361 :     ESPKPDTPDTPENPPTSGLHHHHHRHKGPQRQGHSDNCDTPLGSESLQPSLPQKKLURKR
362 :     CINQLLUQFPKYSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVI
363 :     ESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN
364 : golsen 1.3 >fig|221988.1.peg.2243 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
365 : golsen 1.1 MQNDANEVRPALSEAEQIRLTQYSHGAGUGCKISPKVLGTILHSQLEQFVDPHLLVGNDT
366 :     NDDAAVYDIGNGTCIISTTDFFMPIVDDPFDFGRIAATNAISDIFAMGGKPIMAIAILGF
367 :     PINVLPAEVAQKIVDGGRFACREAGIALAGGHSIDAPEPIFGLAVTGIVPTEKVKRNASA
368 :     EAGSKLYLTKPLGIGILTTAEKRGKLKPEHKGLATEVMCQMNLIGSQFSQLESVTAMTDV
369 :     TGFGLLGHLAEICEGSNLVADVHFNKIKMLDGVPYYIEQGCLAGGVTRNYESYGIKIGAI
370 :     TEFQKAVLCDPQTSGGLLVAVKPEGETQLLELAAQAGIELIEVGELRRRVDNSDPVIIRI
371 :     LD
372 : golsen 1.3 >fig|1491.1.peg.3667 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
373 : golsen 1.1 MSNNINIKEGEACSIEKKEVRLTELSRTSGUAAKIAPGVLSKILSKLPKMESENLIVGIE
374 :     TADDAAVYKINDDTAMIQTLDFFTPIVDDPYMFGQIAAANSLSDVYAMGGKPVVALNIVC
375 :     FPSCLPIEVLGEILKGGADKVMESGAVVIGGHTVDDNEPKYGLSVTGIVHPDKVLKNYGC
376 :     KEGEVLITTKPLGIGIINTAIKGDMASKEAKDAAVKSMSTLNKYAGEIITKYNISACTDI
377 :     TGFGFLGHAYEMASASNVTLKFNYKRISYIKEAEEYAEFGLVPAGAYANRDHIEGNFEFK
378 :     NVPVFMQDILFDPQTSGGLLISCSKEESEKIMKELNKLELKSSIVGEVIRKQDKYIIVE
379 : golsen 1.3 >fig|882.1.peg.1326 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
380 : golsen 1.1 MTVDRLTSRSRAAGUAAKIAPGDLERILATLPRDPREGERVVVGTRDNEDAAIVRVPGGK
381 :     AIVQTLDFFTPIVDDPYLFGQIAAANALSDVYAMGGEPWCALNIVCFPVKELPEDILADI
382 :     LRGGADKVREAGAVLVGGHSIEDESIKYGLSVTGIIDPDCYATNTGLRPGDVLLLTKPLG
383 :     SGVLATAVKAGWDGFEAHEQELGRWGAMLNRAGGRVIRELGLAAATDVTGFGLGGHLLEM
384 :     ANASNMSVHVDVSTLPLMPAVLDLVATGLLPAGSHANRHFCSGNVSVHPEVDSLLVDIVF
385 :     DAQTSGGLILAVPPHLVDDACSILRAEDAPFWRIGHVEEMGEGVPRLVLQP
386 : golsen 1.3 >fig|243232.1.peg.1637 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
387 : golsen 1.1 MERGNEKIKLTELVKLHGUACKLPSTELEFLVKGIVTDDDLLDKNILVGLGDDASIIKRN
388 :     GLVIAKTVDVFTPIVDDPYIQGKIAACNSTSDIYAMGLLDIVGVLAIVGIPEKLPIHVVR
389 :     EMLKGFQDFCRENKTTIVGGHTILNPWPLIGGAVTGVGREEEVLTKAGVKVGDVLILTKP
390 :     LGTQTAMALSRIPEEFKDLISITEEERDYIINKAIEIMTTSNRYALKALRKAEERVGDKI
391 :     ANALTDITGFGILGHSNEMAKNSNVLIEINLLPCIKRTPELSRLFGHALLDGYGAETAGG
392 :     LLISAKEEYKDNLIDELEKAKCYAFEVGRVVKKGEGKAVLSKDVKVIEI
393 : golsen 1.3 >fig|335283.3.peg.2205 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
394 : golsen 1.1 MHPEKIALTQTVQKGGCAAKVAATTLHRILQQVRFPAAHSALMVDGRYFDDAAIYKINEQ
395 :     TALVQTLDFFTPIVDTPRLFGEIAAANAISDVYAMGGRPVTAMGILAFPLATLSEHIIVD
396 :     VLQGASDKIAEAGANFVGGHSIDDDTLKFGLSVTGLVNPQQVWTNANAQSGDHLVLTKAL
397 :     GTGTLTAGIKRQQLQEKDIMDALESMAAINNVIDYLSPDLLAAIHAATDITGFGFSGHAM
398 :     QLANASNVTLSIATGNLPRFDKAFYCLKNSFLTKAHRTNAEYTTPHIDDAKLDALYKLLI
399 :     HDPQTSGGLLLSVVPEASQLVLQALRTYFKPAAIVGTVHPRQDKAVQFE
400 : golsen 1.3 >fig|235279.1.peg.1876 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
401 : golsen 1.1 MADYQLTKHIQCAGUAAKVGLSDLAQISSQLTQKPNSLLIAGFESNEDCGAMLYAPNDEY
402 :     AMLSSVDFITPVVDDPYLYGQIAAANALSDIFAMGGEVKSALNLLMWDNTHFDSAVANAI
403 :     LKGGLNKITESNALLLGGHTIKDKEQKYGLAVNGIAHKNRLWRNHTGYIGDMLVLTKPLG
404 :     SGILTTAIKAQMFSQTTEVTQSMAMLNLYAARIAQNYEIHACTDITGFGLIGHAFEMCGG
405 :     IKNQNEKSILFYTKQIPLFDKTESFSQMGIVPGGSYENKKALQSQVQIQCTLEDDIFYYD
406 :     AQTSGGLLFALPFNQAKLFVDELHKAGIIHANVIGEIIPKTETSIVLG
407 : golsen 1.3 >fig|326298.3.peg.2098 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
408 : golsen 1.1 MNNESKLTKFVQAAGUAAKMGPGDLKHTICSLISDDKNVLVGFENSDDAAVYQINENEAL
409 :     VQTVDFITPVVDDPYIYGKIAAANSLSDIFAMGADVKTALNIVGFDKTNHTYEVLSEILR
410 :     GGNEKIKECGGVLVGGHTIESPEMYYGLSVTGMIHPKKVLRNNTPKIGHVIVLTKPIGMG
411 :     ILTTAIKRDLLSKETTLEAINVMQSLNYLPSKLLREYEVSACTDITGFGLLGHALESTNE
412 :     RVSISIDAKNVPVMADAFDLADKNIVPGGTKRNMKYLEDKVIFAGDASKYALMFSDAQTS
413 :     GGLLISMSEKDALEYVKKVQDLTYGYACVIGSIIPRGDRAIIVY
414 : golsen 1.3 >fig|306263.1.peg.1683 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
415 : golsen 1.1 MIYKDQKLTQYVKAAGUAAKLDSVGLDKILGILKPHENILSGIGNNEDASVYKLNEDLAL
416 :     VQTLDFITPVVDSAYHFGAIAAANALSDVFAMGAEVINALNIVGFDTCHFNNEILLEVLE
417 :     GARVKVEEAGAVLVGGHTIENDEFIFGLSVTGVVHPKKFIANNSAKDGDVILLTKPIGSG
418 :     IISTAIKASLLEKEKILKAVEQMSFLNLYASRILREFKSLSALSDVTGFGLLGHLKEMLN
419 :     KEIMIEVYKNEIPLMDGVLSMANMGIIPAGAYKNKDSLKIWVENLNEKDEDIMYFDPQTS
420 :     GGLLASMSENEAVEALKILKDHNIEAKIIARCVRNTHNYLLLC
421 : golsen 1.3 >fig|217.1.peg.1890 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
422 : golsen 1.1 MNEEIKLTHFVQCAGXAGKSSPADLSQIFSSLPSQSDPKLIAGFEHHEDCGIYALENGDF
423 :     LLQSIDFITPIVDDPYFYGKIAAANALSDVFAKGAEVCTALNVLMWDREHVSKSCLQEIL
424 :     RGGMEKIKECGALLLGGHTINDREQKYGLSVSGITRSFWPNRGAKIGDVLLLCKPIGSGI
425 :     ITTALKRENLALSAAKECVESMALLNVYAMRIALDFPIHASTDITGFGLIGHLLEMCAEE
426 :     QSFALEVDKIPLFEPVKELLAQNISLGSKNNRAYFSHAVRDTRERGEDGFLYDAQTSGGI
427 :     VFALPKNKAWALLDALKKSQYERASIIGEVIPRAQGAILLG
428 : golsen 1.3 >fig|224324.1.peg.1561 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
429 : golsen 1.1 MVELLKLVRSSGUAAKVGPGDLQEILKGFNIYTDESTLVSIGDDAGVYEHNGIIWVYTVD
430 :     IITPVVNDPYLWGAISTANALSDVYAMGGIPVNALAISCFNNCELDIEIFREVIRGALDK
431 :     LREAKTVLLGGHTIDDKEPKFGLSVAGICPEGKYITQSGAQVGQLLILTKPIGTGILIKG
432 :     LKEGILKEEDINEAIENMLALNDKARNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGA
433 :     RIFFEKVPYYQLSENLVKKKIYPKGAIENLNFVKNYLKSNLDNWKLILLSDPVTSGGLLF
434 :     TINKEKLEKIDETAKELEVNYWIIGETIAENVLEVL
435 : golsen 1.3 >fig|190192.1.peg.1365 Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing
436 : golsen 1.1 MSRKKSLVEMADLHGUACKLPQGDLEDLLKGVELPEEGGRVEVGVGDDAAVIRVDGGYVI
437 :     QSVDFFTPIHPDPYTQGRIAANNSINDVFAMGATEVLSVLVVSGFPRELPEEDAREMLQG
438 :     FADQCREVDALIVGGHTIMNPWPILGGCVTGFAERYVTVGGAEPGDVLYLTKPLGTQPAM
439 :     AALRLPEDVRKQFLTDSELEEAVDLAVEVMTEPLKDAAEAALEVGVHAMTDVTGFGLKGH
440 :     AGEMAEASGVRVVIERLPVIPGTTELSRALGYGLERGESAETAGGLLVAVPEEHAEDLED
441 :     AFERRDVWYRRIGRVEEGSGVEVRGDVEEVEDYP
442 : golsen 1.3 >fig|316057.3.peg.1843 D-proline reductase, 26 kDa subunit; selenocysteine-containing
443 : golsen 1.1 MAETRAPTGFASEDDVPIPYMARTRAYYQAIGYDVPYRWAHDVAAPFRPLTKPLAQARVA
444 :     LITTAAPFDPAKGDQGPGAAYNGGAKFYQVYDGDTSQDHDLRISHIAYDRTHTTATDSGS
445 :     WFPLPQLRRLAREGAIGDVAPRFFGAPTNRSHRVTTDTDAPEILARCRADNVDAAVLVPN
446 :     CPVCHQTVSLVARHLEAHGVSTVVMGCAKDIVEHAAVPRFLFSDFPLGNSAGKPHDDASQ
447 :     AFTLELALRVLERAPGPQTTVQSPLRWRTDAAWKRDYNNVAAMSADELERRRCDFEAQKD
448 :     RARAIRDSVA
449 : golsen 1.3 >fig|1491.1.peg.3665 D-proline reductase, 26 kDa subunit; selenocysteine-containing
450 : golsen 1.1 MSLTITKGLQSEIFVPITPEPVWTPVTKELKDMTVAIATAAGVHLKKDKRFNLAGDFTYR
451 :     LIPGDAKTSDMMVSHGGYDNSDVNKDINAMFPIDRLRELVDVGFIKAVAPTHIGFMGGGG
452 :     NQQKFREETGPEVAKILKEEGVDAVLMTAGUGTCHRSAVLVQRAIEKAGIPTIIIAALPP
453 :     VVRQTGTPRAVAPRVPMGANAGEPNNVEMQTAIVKDTLEQLIKIPSAGKIVPLPYEYIAK
454 :     V
455 : golsen 1.3 >fig|99883.3.peg.21500 Selenoprotein P precursor; selenocysteine-containing
456 : golsen 1.1 MDSLRQKLENQGLRDVVYMVVNHQGAQARGLHAMLAQRLSEHISLHRQDEALADVWQTLG
457 :     GNKDDFFIYDRCGRLTHRISLPYAVIGHGHVEKAVKDTYCSSLCGECTHETAETQQECTP
458 :     KTDTQPQEDTRHECHHRHHQGHQHHGDGHDHGHGHHGGQGHHQGHDQAGGVAQRPADADT
459 :     DAGCSAASLSRRREPDPRVPTEDESRCKLALIVPVTPVAKSSLYQQVLL
460 : golsen 1.3 >fig|9913.1.peg.211 Glutathione peroxidase (EC 1.11.1.9); selenocysteine-containing
461 : golsen 1.1 MARLFRASCLLSLLLAGFIPPSQGQEKSKTDCHAGVGGTIYEYGALTIDGEEYIPFKQYA
462 :     GKYILFVNVASYUGLTGQYVELNALQEELEPFGLVILGFPCNQFGKQEPGENSEILATLK
463 :     YVRPGGGFTPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPDRLFWEPMKVHDIR
464 :     WNFEKFLVGPDGIPIMRWYHRTTVNSVKMDILTYMRRRAVWEAKGK
465 : golsen 1.3 >fig|10279.1.peg.66 Glutathione peroxidase (EC 1.11.1.9); selenocysteine-containing
466 : golsen 1.1 MADGSGARFPRFSELCAKYAAQLAAAETRSVYAFSARPITGGEPVSLGFLRGRVLLIENV
467 :     ASLUGSTVREYTQMNELQRRLGARGLVVLGFPCNQFGHQENAQNAEILPSLKHVRPGNGF
468 :     EPNFMLFEKCEVNGARAHPLFAFLREALPAPSDDMSTLVSDPQLIAWSPVCRNDVAWNFE
469 :     KFLVGADGTPVRRYSHRCQTLAVEPDIEALLPPPARGYYA
470 : golsen 1.3 >fig|351605.3.peg.3641 D-proline reductase, 26 kDa subunit; selenocysteine-containing
471 : golsen 1.1 MPFARLKNRLLARIFTSFPSLAARWGRQLDANISDIPWTEPQKPLNEAILALVTTGGVHL
472 :     KTQEPFNMADPNGDPTFREIPADTPADLLTITHDYYDHRDAERDLNLVLPLQRLREMVEV
473 :     GALKALHPIAYGFMGHIDGPHLHTLQEETAPAIARKLADAGVDYALLVPA
474 : golsen 1.3 >fig|298386.1.peg.5793 Glycine/sarcosine/betaine reductase protein A; selenocysteine-containing
475 : golsen 1.1 MLKDKKVIILGDRDGIPGQAIEACIKSAGAHVLFSTTECFVUTSAGAMDLENQKRIKGFA
476 :     EEFGAENILIVLGGAEAEASGLACETVTNGDPTFAGPLAGVQLGLSCYHVVEPEIKNNVD
477 :     ADVYDEQIGMMEMVLDVDAIIAEIKGYREQFGKYVLAEAEV
478 : golsen 1.3 >fig|243275.1.peg.1716 Glutathione peroxidase (EC 1.11.1.9); selenocysteine-containing
479 : golsen 1.1 MGIYNYTVKDSLGNDFSFNDYKDYVILIVNTACEUGLTPHFQGLEALYKEYRDKKFLVAA
480 :     FPCNQFGGQDPGTNEEIRNFAQSKYGVSFPIMAKIEVNGENTEPIFSFLKKASNGEDIKW
481 :     NFAKFLVDKTGERVTAYAPTVAPEDLKKDIEKLLN
482 : golsen 1.3 >fig|243232.1.peg.1222 CoB--CoM-reducing hydrogenase (Sec) delta subunit; selenocysteine-containing
483 : golsen 1.1 MDPVIIAFCCYQXGYGAADLAGTSRMQYPATVRIVRLPCTGKFDITYALRAFQKGADAVM
484 :     VVGXKKGECAYETGNLKAEERVRFAKQLLDELGIGGDRIDMFFMSAAEADKFVSAVNEMT
485 :     ARVEKLGPNPLKAQ

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3