[Bio] / FigKernelPackages / high_expression_ref_ab.pm Repository:
ViewVC logotype

Annotation of /FigKernelPackages/high_expression_ref_ab.pm

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.1 - (view) (download) (as text)

1 : golsen 1.1 package high_expression_ref;
2 :    
3 :     # 2009-12-29
4 :     # A composite of archaeal and bacterial high expression genes
5 :     # This version is based on top 10% (415) of Escherichia coli K-12 genes.
6 :     # The 381 genes are shared in 5 different estimates.
7 :    
8 :     use strict;
9 :     use gjoseqlib;
10 :    
11 :     my @seq;
12 :     sub ref_aa { @seq ? @seq : ( @seq = gjoseqlib::read_fasta( \*DATA ) ) }
13 :    
14 :     sub ref_he { qw(
15 :     45357588
16 :     45357613
17 :     45357625
18 :     45357639
19 :     45357643
20 :     45357645
21 :     45357655
22 :     45357656
23 :     45357661
24 :     45357690
25 :     45357696
26 :     45357699
27 :     45357714
28 :     45357719
29 :     45357722
30 :     45357726
31 :     45357727
32 :     45357775
33 :     45357786
34 :     45357808
35 :     45357811
36 :     45357812
37 :     45357815
38 :     45357821
39 :     45357823
40 :     45357824
41 :     45357853
42 :     45357860
43 :     45357861
44 :     45357866
45 :     45357880
46 :     45357888
47 :     45357909
48 :     45357935
49 :     45357949
50 :     45357951
51 :     45357977
52 :     45358003
53 :     45358006
54 :     45358007
55 :     45358020
56 :     45358072
57 :     45358074
58 :     45358103
59 :     45358135
60 :     45358137
61 :     45358138
62 :     45358140
63 :     45358169
64 :     45358187
65 :     45358188
66 :     45358190
67 :     45358202
68 :     45358203
69 :     45358204
70 :     45358217
71 :     45358230
72 :     45358232
73 :     45358255
74 :     45358383
75 :     45358417
76 :     45358479
77 :     45358515
78 :     45358594
79 :     45358605
80 :     45358606
81 :     45358609
82 :     45358616
83 :     45358617
84 :     45358710
85 :     45358711
86 :     45358712
87 :     45358769
88 :     45358770
89 :     45358776
90 :     45358785
91 :     45358809
92 :     45358811
93 :     45358812
94 :     45358852
95 :     45358882
96 :     45358883
97 :     45358884
98 :     45358886
99 :     45358887
100 :     45358888
101 :     45358910
102 :     45358924
103 :     45358925
104 :     45358928
105 :     45358929
106 :     45358930
107 :     45358931
108 :     45358933
109 :     45358934
110 :     45358945
111 :     45358948
112 :     45358963
113 :     45358964
114 :     45358966
115 :     45358967
116 :     45358968
117 :     45358971
118 :     45358972
119 :     45358973
120 :     45358974
121 :     45358975
122 :     45358976
123 :     45358977
124 :     45358978
125 :     45358979
126 :     45358980
127 :     45358981
128 :     45358982
129 :     45358983
130 :     45358984
131 :     45358996
132 :     45358999
133 :     45359037
134 :     45359063
135 :     45359067
136 :     45359090
137 :     45359100
138 :     45359101
139 :     45359106
140 :     45359107
141 :     45359108
142 :     45359109
143 :     45359110
144 :     45359121
145 :     45359123
146 :     45359125
147 :     45359127
148 :     45359128
149 :     45359142
150 :     45359145
151 :     45359149
152 :     45359172
153 :     45359200
154 :     45359206
155 :     45359210
156 :     45359221
157 :     45359229
158 :     45359230
159 :     45359234
160 :     45359257
161 :     45359259
162 :     45359271
163 :     45359272
164 :    
165 :     16129670
166 :     16129500
167 :     16130806
168 :     16131431
169 :     16131147
170 :     16130341
171 :     16129632
172 :     16130491
173 :     16131536
174 :     90111132
175 :     16131061
176 :     16128165
177 :     16131068
178 :     16131194
179 :     16131483
180 :     16130513
181 :     16128635
182 :     90111705
183 :     16131769
184 :     16128159
185 :     16129094
186 :     16131190
187 :     16131009
188 :     16128656
189 :     16128704
190 :     16128779
191 :     16130343
192 :     49176267
193 :     16131076
194 :     16128089
195 :     16131780
196 :     16128788
197 :     16129235
198 :     16128715
199 :     16129166
200 :     16130451
201 :     16131979
202 :     49176235
203 :     16128650
204 :     90111166
205 :     16130439
206 :     16129560
207 :     16131103
208 :     16128187
209 :     90111439
210 :     16128416
211 :     16131197
212 :     16130325
213 :     90111419
214 :     16131507
215 :     16131280
216 :     90111711
217 :     16128423
218 :     16128455
219 :     16131121
220 :     16132193
221 :     16131602
222 :     16131999
223 :     16131372
224 :     16128780
225 :     16131595
226 :     16131075
227 :     16128149
228 :     90111442
229 :     16130088
230 :     90111702
231 :     16131119
232 :     16131680
233 :     49176137
234 :     16128396
235 :     16131389
236 :     16129993
237 :     16129697
238 :     16131571
239 :     16131174
240 :     16130454
241 :     16130232
242 :     90111450
243 :     16130272
244 :     16131754
245 :     16131144
246 :     16130432
247 :     16129592
248 :     16128644
249 :     16131605
250 :     16128664
251 :     90111134
252 :     16130330
253 :     16130401
254 :     16128163
255 :     16130843
256 :     16128702
257 :     16131490
258 :     16130963
259 :     16128154
260 :     145698292
261 :     16131191
262 :     16129960
263 :     67005950
264 :     16131183
265 :     16131996
266 :     16128171
267 :     16131815
268 :     16128787
269 :     16131195
270 :     16130365
271 :     16129614
272 :     90111391
273 :     16128765
274 :     16130217
275 :     16131632
276 :     16128831
277 :     16131810
278 :     16131198
279 :     16131470
280 :     16130897
281 :     16128895
282 :     90111491
283 :     16128224
284 :     16128392
285 :     49176403
286 :     16131967
287 :     16128716
288 :     16130170
289 :     90111399
290 :     90111554
291 :     16131414
292 :     49176370
293 :     49176119
294 :     16129341
295 :     16131218
296 :     16128770
297 :     16129055
298 :     49176434
299 :     16128598
300 :     16131066
301 :     16131639
302 :     16128491
303 :     16130838
304 :     16131774
305 :     16128657
306 :     16129828
307 :     16131063
308 :     49176404
309 :     16131244
310 :     16131059
311 :     16131596
312 :     16131978
313 :     16128178
314 :     16128393
315 :     16130687
316 :     90111433
317 :     16131862
318 :     16129226
319 :     16132017
320 :     16131416
321 :     16131606
322 :     16128047
323 :     16128223
324 :     16131187
325 :     16130258
326 :     16130443
327 :     16128162
328 :     16128457
329 :     16130504
330 :     16130709
331 :     16129099
332 :     16131290
333 :     16128415
334 :     16131143
335 :     16128004
336 :     16129736
337 :     16131487
338 :     16132198
339 :     16128777
340 :     16128611
341 :     16130774
342 :     16131582
343 :     16127995
344 :     16131573
345 :     90111643
346 :     16128107
347 :     16128152
348 :     16131370
349 :     16131710
350 :     16128109
351 :     16131182
352 :     16131619
353 :     16132200
354 :     16128660
355 :     49176129
356 :     16128036
357 :     16130894
358 :     16129609
359 :     16131367
360 :     16129057
361 :     16131262
362 :     221800783
363 :     16128855
364 :     16129249
365 :     16128097
366 :     16132048
367 :     16131599
368 :     90111586
369 :     16129807
370 :     16130858
371 :     16129052
372 :     16130814
373 :     16131701
374 :     16129672
375 :     16131968
376 :     16130909
377 :     16128803
378 :     16129178
379 :     16132218
380 :     16132199
381 :     16131196
382 :     16130827
383 :     16128091
384 :     16128017
385 :     16131764
386 :     16130377
387 :     16129452
388 :     16129772
389 :     16132142
390 :     16130388
391 :     90111668
392 :     16130686
393 :     16128615
394 :     16129285
395 :     16128921
396 :     16131221
397 :     16130855
398 :     49176350
399 :     16131508
400 :     49176442
401 :     16131949
402 :     16129187
403 :     16128394
404 :     90111088
405 :     16130450
406 :     16130703
407 :     16132024
408 :     16128108
409 :     16128703
410 :     16128341
411 :     16131200
412 :     16131604
413 :     16128695
414 :     16129633
415 :     145698283
416 :     226524735
417 :     16128588
418 :     16128510
419 :     16131236
420 :     16131333
421 :     16131592
422 :     16130021
423 :     16128208
424 :     16128190
425 :     16130212
426 :     90111421
427 :     16131997
428 :     16128870
429 :     90111448
430 :     16130433
431 :     16129817
432 :     16131471
433 :     16131480
434 :     16132018
435 :     90111370
436 :     16131192
437 :     16128625
438 :     16131304
439 :     16130216
440 :     16131851
441 :     16129064
442 :     16131934
443 :     16128851
444 :     16130442
445 :     16131860
446 :     16128496
447 :     16129373
448 :     16129170
449 :     16130961
450 :     90111561
451 :     16131242
452 :     16128127
453 :     16131371
454 :     16132208
455 :     16130458
456 :     16129595
457 :     16130219
458 :     16128509
459 :     16128638
460 :     16131185
461 :     16131188
462 :     16128147
463 :     16131181
464 :     16128002
465 :     16129562
466 :     16128897
467 :     16129803
468 :     16131985
469 :     145698316
470 :     16130166
471 :     16129612
472 :     16131520
473 :     16130123
474 :     16129851
475 :     16130533
476 :     16131972
477 :     16131593
478 :     162135892
479 :     16128386
480 :     16131813
481 :     16132031
482 :     16129819
483 :     16130604
484 :     16131597
485 :     16132054
486 :     16128709
487 :     16130620
488 :     16131073
489 :     16130319
490 :     49176154
491 :     16131515
492 :     16131555
493 :     16130792
494 :     16130530
495 :     16129768
496 :     16131060
497 :     16130231
498 :     16131609
499 :     16128033
500 :     16131120
501 :     16128400
502 :     16132201
503 :     16130826
504 :     16128009
505 :     145698230
506 :     16131189
507 :     16131598
508 :     16130839
509 :     16131812
510 :     90111152
511 :     16130925
512 :     16129058
513 :     16132143
514 :     16131601
515 :     16129086
516 :     16128614
517 :     16131693
518 :     90111564
519 :     16128655
520 :     16128561
521 :     16131841
522 :     16131569
523 :     90111521
524 :     90111575
525 :     16130704
526 :     16131430
527 :     16128606
528 :     16128022
529 :     16130844
530 :     16130606
531 :     16128164
532 :     16128860
533 :     16131282
534 :     16131228
535 :     16131126
536 :     16130476
537 :     16128143
538 :     16129777
539 :     16131177
540 :     16129669
541 :     16131830
542 :     16130251
543 :     16128194
544 :     16131885
545 :     16130773
546 :     ) }
547 :    
548 :     1
549 :    
550 :     __DATA__
551 :     >45357564 hypothetical protein MMP0001 [Methanococcus maripaludis S2]
552 :     MTLDRNGKLIEIGSYVRYINTGTHGTVKAIEPKNDEEWVLLENDIYYRPELLELVERRKI
553 :     EKKESEEELIERITNEDIDLEAAENGCGCSGAG
554 :     >45357565 L-seryl-tRNA selenium transferase [Methanococcus maripaludis S2]
555 :     MDSLLELNRVNTAREIIRKKIQNTGRNSIYDLTGLCGGFEICEENLKLIETYVGPAIFSE
556 :     KLNNAGLSHLSGNSKIHNAVCFNRTSSAILSTIMTLSKSFEKLVHYVPEKPAHPSIPRSC
557 :     KIFGMEYFESDSLEEILSKIDENSFTAITGATMDHKVVSEEIACKIIDYAKSKNSPVFFD
558 :     DASGARLRKLYKESPALEMGADLVVTSMDKLMDGPRAGLLAGDKNLVDKIYSEGLKFGLE
559 :     AQAPIMAAVVTALERFDLNNLKDAFERAEKVDLSVFEAEKIEYKKTPTGFIIKNSSEEKL
560 :     IETALKLLENYGIVTITAAGMPGASKNIRIDFCSKDAERISDEYVINAVLNSLK
561 :     >45357566 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [Methanococcus maripaludis S2]
562 :     MTKVNFMQGNMACVEGAIKAGCKFFGGYPITPSTEIAEGMAKRLPKIGGFYSQMEDEIAS
563 :     IASIIGASWAGTKSMTATSGPGMSLMLENIGYAYMTETPCVLVNVQRGGPSTGQPTAAAQ
564 :     GDMMQVRWGSHGDYEPIALCPSSVQEMYDFTILAFNYAEKYRIPVFVMADEILGHMREKV
565 :     VLHDDIEIFNREKPEEKPCTKPYPFDKEVPPMPTFGEGYNVHVTGLTHGENGYPDVSAET
566 :     HDKLVRRICNKILENKDDIVLYEGKYLESETMFICYGTPSRTVKHTVESLREQGQDVGYI
567 :     RLKTVFPFPDKLIAGLKASKIIVPEMNLGQISGEVMKYAKCEVVGCGKIGGELHRPEDLK
568 :     ELI
569 :     >45357567 hypothetical protein MMP0004 [Methanococcus maripaludis S2]
570 :     MEDNDWKLLKIIEISMKNHEWVPIQDLRRKTGFHEKEIVFRLGRLNKFKFTNKSNYGYRL
571 :     SHWGYDALAMNAFIKKELIAGIGGKVGVGKEGDVYHVLLTNHREAVLKFHQLGRTCFSMG
572 :     KRYREYLANKRHISWLYASRLTAAREFEVLNMLFPVVKVPEPIEQNRHAIIMGKLHGEEL
573 :     KRVNLLEINVDPEEFFWKLMVEVKKTYKLGIIHGDLSEFNILIDSEGDFVIIDWPQAIEV
574 :     GKKGKLDKLPFEEVEYDEEFYLKRDIENVVRYFKKYGIDKDIDKLYNYVIGDITSENI
575 :     >45357568 hypothetical protein MMP0005 [Methanococcus maripaludis S2]
576 :     MLSKICKNCAYVMDYFLSKEWFQVLIIAAISAVLAYYSLFYFAWGTGFDENLRYILSTLP
577 :     QTQGAIVGIVASISIVAIQMVSQQYSTRITHLLLNKTFWGFIIAYIVSMSYEVLILGFMP
578 :     TARIPVFIGGYEISYHILIGILFFFVYFDFLILLPYMKNTINGLKPENVIDALINSISKD
579 :     EIKNYRSLDSENKDYKSARKIPKNTLRTVYYIIGKSLKSDHYMTARNGIILLGANYSVLA
580 :     KKGKFKNKKFFESYIDNLKNLGLTAYGTSFSISREAIISLEKISKFELNRNYDLSLRALR
581 :     GIKKIGLLYAQEYELKIDKSDEKELIHIVFEKLGNIIKFILSKPKHNEKITSKQVTFKIM
582 :     MFSEILKIFELILDKLNSREILKNEAAGTLILDALNNFSKPAIEFIKTNENSEFLSEITI
583 :     QTSETLKNFVKLISKTNEENESLNEYLTEILKIYGIILDLICEKTTEKTIDTILSDISEI
584 :     WKISNGKFEQIFGIGDIVENIDNSEKIKCADSLREQLLEKISKQDNN
585 :     >45357569 3-dehydroquinate synthase [Methanococcus maripaludis S2]
586 :     MKFGWIKTTGNDLEERMESVKDALESSIPGIIAEKEEISSVRELGNIKIVSDNLDADVVL
587 :     INKGEDLEILKSAKLSGKETGVYVVINTKEDEVYATDVSKLDFVDYVVLEGSDWTIIPLE
588 :     NIIADLFSEEIKIVSVVTNVKDAEAAYEILEKGVDGVVLIPKDINEVKDFSKLIERMNSE
589 :     SVKLDYATVTKIEPVGSGDRVCIDTCSMMEMGEGMLIGSYSRGMFLVHSETVENPYVATR
590 :     PFRVNAGPVHAYILCPENKTKYLSDLKAGDKVLVVNKNGETREAIIGRVKIEKRPLFLVE
591 :     AEYNGENLRTILQNAETIRLVGEDGKPVSVVDLKVGTKVLIKPDENARHFGMAIKETIIE
592 :     K
593 :     >45357570 geranylgeranylglyceryl phosphate synthase-like protein [Methanococcus maripaludis S2]
594 :     MQIKIGEIESKLNKIIEEEGAAYFVLIDPDEKNYREIANHVKDYADAIIIGGSIGIINLD
595 :     EVTKDIKEITGLPIILFPGNVDGVTKEADAVFFMSLMNSKNTYWNMTAPTLGALTIKKYG
596 :     LETLPMAYLGIEPISKTAVGFVGEVNEIPQKKPEIAGLYSLSASYFGMRWAYLEAGSGAE
597 :     YPVSNEMVGISKKLSGINIIVGGGIRTPEVAYEKVMSGADVIVTGTLTEKDPQAVVEMKK
598 :     AIKKAGLDKLKMLSKK
599 :     >45357571 DNA polymerase II small subunit [Methanococcus maripaludis S2]
600 :     MINDFLNIQVLLAPESYSRLQNLDSNDFSDLFNKIKEFKSKKDDFILLDSHFLNIFLGNN
601 :     LKNIFEEYGKFDFLAYYTSNEVASEEKIIEKDDFEPVNEVKLENEEIIEPKRENKVYDLD
602 :     FEDIEEEEPELDEIHKKLEEERKERILEVRSIRESVNNKINYYAKDIDAQIHVYDEYDVT
603 :     GKSTCEGTLDDFVKYFKDRCSTLRKIIELKNQKKAYPLNQLFRRKKENEVFIAGIVSDVN
604 :     STKNGHKMVELEDENGTFRVLLMKDKMEKGDLPSDVLLDEVIGFEGTINDKGDLMFVDRA
605 :     FRPDITPKPTKTTDEKIYTAFLSDVHVGSREFLNKVFAKFIRFLNGEVNNGLEEKIVSRL
606 :     KYISIAGDLVDGVGIYPGQEYDLYDVDIISQYAEVAAYLEQVPEHIKVIICPGNHDALRP
607 :     AEPQPTFDESITSLFPKENVTFVGNPGVVNMHGLDLLMYHGRSFDDIIGQISSAQYTNPP
608 :     SIMTELLKRRHLCPTYGGRCPIAPEHVDYLAIHTEPDIFHTGHIHINGYDNYHGVRMINS
609 :     GTFQEQTDFQKRMGIKPTPGIIPIQDLSKREQHMIEWNQGKIEIN
610 :     >45357572 putative DNA primase large subunit [Methanococcus maripaludis S2]
611 :     MILVFLDNMASIKDLNLIDEINDSSNLKLINDRLKLLFWTKNPEITDEENKKKYLDFLNE
612 :     YWDTLRAYGAGDLELFPDKINYLTLILAANSKNHNIYIKKLAEKYAEKIPIEDGDSKINI
613 :     WDFIDVAANSRNNDLHLERMILEGDTVLLNQKNQSIYNFEKIRLKLKNYVEKVRNAEMPK
614 :     EIKDLLVKKSEEAFEGINIGYNIESGIKVSTKEYSGEIPEDWHPPCMREILNDILSGGSP
615 :     SHYARRSFVVYRFVSQFDPNLRPIEEGIITNRSAQDIATEEQIERFLDEIINIFKSVGDF
616 :     DVEKTKYYISHNIGYKVANHITHCEYCKNWRDDGGKGLGYYCRPDSTCSRKDIIHPLDYL
617 :     CHNINRHVKKSE
618 :     >45357573 hypothetical protein MMP0010 [Methanococcus maripaludis S2]
619 :     MFIALHNTFSSKQIEEFTKTVFGMGIDSVIFTRATGSAAQNGIPIAQKMAIKLNKNLMFL
620 :     EDIDDAVEILNPERVILIADSKIAEEKIDFKSIGKRDLVIFSGNSSGFSKKELEKGTGMH
621 :     ILENNVGAIGEVAVFLYKMNE
622 :     >45357574 DNA-cytosine methyltransferase [Methanococcus maripaludis S2]
623 :     MNFIDLFCGCGGFSRGFVEMGFKPLLAIELDENAANSYALNYNGTVFEKKLNDILEKDVY
624 :     FKLEDFLVQDDIEEFKKSNNYENLNPVVINEDIREINSKYITNKIKDTSYSKIDVIIGGP
625 :     PCEGYTGANPKRERSPFNRLYRDPVGRLVLDYIRIVGDISPEVFVMENVPGILNYETREN
626 :     IEKEFSRAGYDELYFHVFDSENYGNPSFRKRVIILNIPLNLEKTDNVDVKTALSNIDRNA
627 :     LNNEKYPLPEKIAKSIHKIKIGGSAVKFKACGGVLDNYIRLSMEGNAETVMGKRRFIHPE
628 :     EDRLLTVREQARLMSYPDTHIFAGGITAQYNQVGESVPPSLSLAIAKEVKKYFNK
629 :     >45357575 CoA-binding domain protein [Methanococcus maripaludis S2]
630 :     MNRSNHTNNSNLGKILEGLEIKELINSSKNIAVIGISKNSENPSYFVSKYLIESGFNVYF
631 :     VNPNYSGEKILNHVVYSNISEIKEKIDIVSIFVNPSRTLKIAKDAVKLGFKAFWFQLETS
632 :     NKETADYVLKNGFDVVLEKCIMTTNQKFL
633 :     >45357576 argininosuccinate lyase [Methanococcus maripaludis S2]
634 :     MNILRRGRLGSNVKEDVMKFTTSLEFDKEIFESDILCDIAHTTMLVEQNVISEENGKKII
635 :     AELKKIAKRGMENLDLDPSLDDIHMVIESELIKELGEDVAGRMHTGRSRNDEVATDLRLS
636 :     LRKKVLEIIGHLITMEKNMLTVSDAHKETLTVGYTHLQQAQPVTFGHQILSHVSAIERDI
637 :     SRFFDTYNRINISPLGCGAMATTGFNLNRKRTKDLLGFYGIIENSMDGVSSRDFIVETMA
638 :     NISMLGTNLSKICEELVVFSSAEFNTIEIANEYTSTSSIMPQKKNPDVAEITRAKLSTLN
639 :     GELVTVLTIMKALPNTYNRDLQEISPHLWKSVYTLIDSIQMVDGMISTVKVNKERMKENA
640 :     EKNYSTATELADTLVRECGIAFRMAHGIVGELVKRSIEEKVEIKEIISEVLEKNNLSLSQ
641 :     EKIDTALDPFENVKLRNVIGGPAPEEVERAISSFNEKISAHKDKLDEKISEIKTAEKNLL
642 :     E
643 :     >45357577 tRNA pseudouridine synthase D [Methanococcus maripaludis S2]
644 :     MKFRQKHEDFIVNEILEYELNDYGNYFLYKLQKNGIENLKAISYLSKNFEVPTKEIGYCG
645 :     LKDRHAITTQYVSIPKEYGKLSLDEDNLKLEYVGTIEKPLKIGRLYGNRFEIIARAVDKD
646 :     EFLKIADNIRNLSSGAPNYYDDQRFGSVFNGKFIAKEILKGNYEEVVKILLTSYTKSEKK
647 :     QLKDLKRFIAKNWGNWDECLEYIDKKQIRSKMFRNMVKSLTYENDFKKAFKYVDNRLKEL
648 :     FISAYQSYLWNECLKEFLKEVIPKENRIYVDYSCGTFLFYENIEEELFDKLKEMDFPTIV
649 :     SDVEYTDPEKRIIKAILKKERIKISDFEKLDFGKLKYTKRPIISIPEDVNTGKFKSDELN
650 :     SKKYKIDLEFSLKKGSYATIILKRVFNIL
651 :     >45357578 hypothetical protein MMP0015 [Methanococcus maripaludis S2]
652 :     MESKQLINKILRDIVKNIDEYSRDLLLAESLDVELKGLNLWDENGKRYSIKNLMDCDELP
653 :     SFEATDRKYVLRKVNLKHVDDGVMIIHLSSRKADEYSFSVDNTFEVILKTFSTASYEHRE
654 :     RILLWNELSDEELDIKISEFDVNVESIVQKISENSKISSEVLVYIDVFMDLEKIENIMEK
655 :     EEEKLVLWLHPVFLFSKESTLKGLLAYELSKYDKSLIEGHYPDILEYCKEYRELCGKNLK
656 :     IIEKIREIAVKRNDYDILKEIDQMNTI
657 :     >45357579 hypothetical protein MMP0016 [Methanococcus maripaludis S2]
658 :     MKHRKLEESEISAIKAAISRYIGKKAEELDFNNFLVLRGKSKNVVHVSSQVMKSLKNHKD
659 :     IYSAGIHIGDLEEISGKEKFLPSLEGITLVSKDIEKNYAVINEKGEGLFLYSRDVFDSSI
660 :     IELKGDGKVAVFNENKELLGIGKYNGKLIKNIMDRGWYLRYGG
661 :     >45357580 hypothetical protein MMP0017 [Methanococcus maripaludis S2]
662 :     MNSAEILENSIKAFKLTEKHHGNITTLERALFLGWYCNLDDPCKFCFMSTQKEKIKDPLK
663 :     ARRKPESILAESILMKRIGWKLEFISGGYGYKTEELNDTIEMVSYIQQAKQYLNVGIIDF
664 :     ENLNLNNIEGVVGAVETVNPKLHEELCPGKPLSNTKEMLKKAKDMGLKTGITIILGMGET
665 :     EKDIDLLLNLIEELNLDRITFYSLNPQDETVFQGKTSVTTLEYMNWVSTVRLNFPKMKII
666 :     TGTWVDKLTNIGPLVMAGSNVITKFPLFSIYGKKEGKTVENEIASTGRELYSTFSDLDVL
667 :     TGEKTLKNTKYVPEKIDISEKNLELINSLSKQLDKKIESYVKTTIRKSQK
668 :     >45357581 LysR family transcriptional regulator [Methanococcus maripaludis S2]
669 :     MNKLSESDLSVTLNINYRGKQITKTQVEILKSVSETRSQNRTAEILGIPPSTVNIQIKRL
670 :     ENKLDLKLTFSSPAGTMLSPDAERIVSYYNAYLERTSKEKFIACGFISGEVGRILFDDVL
671 :     VSSFSNVLRLHRSNLTSVVGIDDPYWSYRLGDPVPVAFDHFVMVSKGDFDFKNLLGVNYS
672 :     AHRIVWKTLKNEKIDFKVSKVVKNPFYAIDLLEEGYSMFLNTCLLRYVKKDYLIKTPDYY
673 :     DKTKHTINFILNKSIPEDEFEEILYKKEKEIKLAGFDPLL
674 :     >45357582 hypothetical protein MMP0019 [Methanococcus maripaludis S2]
675 :     MIIPKKYERITFALLMSGSMALVMSLVMTMVNRGFSLDVLAFWPKVFLIGYCIAFPTAYF
676 :     VSPIVGKINSKIIIK
677 :     >45357583 nickel responsive regulator [Methanococcus maripaludis S2]
678 :     MVDMDRISISLPTNLLAEFDEIIEERGYASRSEAIRDSIRDYLIKHKWIHSLEGERAGTI
679 :     SIIYDHHSTDVMEKLTNIQHDYEKLIVATIHMHLDHDHCMEVVLVKGDAGEIKELTDKLT
680 :     SQKGVKQVKLTVMVPGGNIPQ
681 :     >45357584 hypothetical protein MMP0021 [Methanococcus maripaludis S2]
682 :     MSVVIGYYGKNGAVIAGDKRNLLFNGIESNRAKLEEVLYSGEIKNDEELFKKASEFEVTV
683 :     HINDTREKVKSLGNLLSGEVVSIGKDSKRRRMYLTKEKCAIIDIENDQITNKSVKTGSGI
684 :     VVFGNRYVKHFVESEIKKHVQKLLKMSAREIRDLFEKILKNIENATLSDTFEYYVVEAGE
685 :     PEFEKAVNKDLDDLFNYRHDLSIKMAEMQILTMIAEKIVKIGDVGVIKNGTLVLYDEFLA
686 :     INKICPEPEIYSEIEITGEFIEGDIITIDNESLKVKRTGSPVAVQKIICKK
687 :     >45357585 hypothetical protein MMP0022 [Methanococcus maripaludis S2]
688 :     MNPKTLEINGKTYSVNIADNFIKRAFGLMFRDISENEGLFFKYGNRKLHIHTFFMKYPID
689 :     VIFLKDDKIVDIATNLIPWKTYNSKVKSNRMFEVKASGINADLIGKKIKFN
690 :     >45357586 hypothetical protein MMP0023 [Methanococcus maripaludis S2]
691 :     MDPSSVIWIFFVFLFFYPQVLFRYRLLQRYKFIKQFEAVRKTRAIVMIHRQEQLALFGIP
692 :     LYKYITIEDSEEILRAIRMTPEDMPIDLILHTPGGLVLASEQIAIALKEHKAKTTVIIPH
693 :     YAMSGGSLIALAADEIIIDKNAVMGPVDPQIGQYPAASIINAINTKYTDELDDETLILGD
694 :     IARKAIVQVKEFVYDILKDKMGEEKAKYLSETLSTGKWTHDYPLTINKLKDLGIEVNTEL
695 :     PNIVYELFDLYRQPVNQRPSVQYVPVPYKRGTKK
696 :     >45357587 ATPase [Methanococcus maripaludis S2]
697 :     MSNINISNLKLKKTLQKPPVVPEEAMCLKYVILEPVGFPINVNGETLKVSVEDHALFNSY
698 :     AREQWENEIVKEGAYLFDSTIIPEYAFKVVSLYPKEGGIITKDTLFKLENNCKPQNSPKF
699 :     KETTFEEVVGQIDAKKKCKIVIKYLENPELFGEWAPKNILFYGPPGTGKTMLARALATET
700 :     DVPLYLIKATELIGDHVGDGSKQIESLYENASENTPSIIFIDELDAIALSRQFQSLRGDV
701 :     SEVVNALLTELDGIKNNLGVVTIAATNNPEMLDNAIRSRFEEEIEFKMPDDNERLKILEL
702 :     YAEKMPIAVNADLKKYVEKTKGMNGRTIKEKFLKPALHKAILEDRESITQKDLDEIIKKI
703 :     VKNSTPLNLYG
704 :     >45357588 hypothetical protein MMP0025 [Methanococcus maripaludis S2]
705 :     MIVTTSDKIEGKEIESYTGFIMGSLAAKAGTKDQVEAKKKALYGLFRKGKEDGADGIISV
706 :     KLDSVSYKSEETGEEMVEYTYYGTAVKFKN
707 :     >45357589 DNA polymerase II large subunit [Methanococcus maripaludis S2]
708 :     MLHVSASKGMTEYFKNILDDVSNLYNLAEECRKNGYDVTDHVEIPLAKDMADRVEGIVGP
709 :     KNVAERIRELVSEFGKEPAALEIAKEIVEGKFGEFGREVGAEQAVRTALAVITEGIVAAP
710 :     LEGIAYVKIKKNSDNSEYLAIYFAGPIRSAGGTAQALAVLVGDYVRKNMGLDRFKPTEDE
711 :     VERYGEEVDLYQSEVTTFQYQPKAEEIRVAVRNISVEITGEATDDVEVSGHRDLPRVETN
712 :     QIRGGALLALVEGVLLKAPKILRHVDKLNIEGWNWLKELKSKKEEVIEELEEENDEYNYE
713 :     DEEDLSQYEDYEVEAVTKFIGEVIAGRPVFSHPSKKGGFRLRYGRSRNTGFATDGFHPAI
714 :     MYLVDDFMAVGTQLKTERPGKATCVVPVDSIEGPIVKLNDGSVLKIDTVEKAKQYTDEVQ
715 :     EILFLGDILVNYGDFLENNHTVLPSSWCTEWYEKILKSQNLEYTEEFIKNPGQKEAVNYA
716 :     KITKTPLHPKYTYFWHDISKENISTLRSWVIGGKYNPSNDSWELNYDPEDEEISNAKRYL
717 :     ELIGCPHIVMEEKVEIFEYYPFLYSLGYDFDEKRDMIDNIDEKLQNTKNNMHFINTIAPF
718 :     EIRRNAYIYVGARMGRPEKAAARKMKPPVNGLFPIGNAGALVRLINKAVDEGKTDEIEIA
719 :     NVKCSCGKVSLYRTCPFCGNSVEPTGPSRIKLPIKDYWYKTLENLKINKPGDVKCIKGMT
720 :     SKDKIIEPLEKAILRAKNNIYVFKDGTTRFDCTDVPVTHFKPVEIHVPIEKLKSLGYLKD
721 :     IHGNPLENEDQVLELKVQDVIVPESCMDYFLNVSGFIDDLLEKYYKKDRFYNVNTREDLV
722 :     GHLIIGMAPHTSAGMVGRIIGYSNANVGYAHPYFHASKRRNCDGDEDAFFLLLDAFMNFS
723 :     KRFLPDKRGGQMDAPLVLTTILDPKEVDGEVHNMDSMWEYPLEFYEKSLEGIAPKEIKKM
724 :     METIEDRLDKDSQYEGIGYTHETSKIDEGPPICAYKTLGSMMEKTSAQLAVAKKIRATDE
725 :     RDVAEKVIQSHFVPDLIGNLRAFSRQGVRCKCGAKYRRMPLKGVCRKCGSRLILTVSKGA
726 :     VEKYMNVSQTMAEKYDASDYIKQRLEIIKSGIDSLFVNDKRKQVKIEDFFK
727 :     >45357590 TrkA-N domain protein [Methanococcus maripaludis S2]
728 :     MESMEKIKIGIFVLFVVIISFSLMFMYIEGWTLLQAIYFSVATISTVGYGDFYPTSELGQ
729 :     LLTILFIVFGVSTGLYTLGAFAESFIGGYFKRYNRRIKMKKRIEMLENHYIVCGYGRIGR
730 :     VVIDRLRESGLDYVAIDNNSEILQAEFEKDPNFNYIVGDATHDEYLIDAQIDRAKALIST
731 :     VSTDSDNVYITLSSKRLNPKLYVVSKADEQVAMDKLLIAGADKVVSPYMIGGLRVAELAM
732 :     KPGILDFVSTFMSIAKYEYDEDLEIRKILIGKNSKIRGKTLTESQIRYNSGVTIIGIKKE
733 :     NDLLVNPGPEIILEYNDQIYAFGTGEQLDVLESMV
734 :     >45357591 cobyrinic acid a,c-diamide synthase [Methanococcus maripaludis S2]
735 :     MEIGLIDIKGTLPCFENFGNLPTKIIHENNISKIKDLEMLIIPGGSIVESGSFTDEFKKQ
736 :     ILDFDNYIVGICSGFQILSEKIDIGRKSPIPIIKEGLGLLNVEFSPLICTDLVKFNIEND
737 :     NLFGKKNQLGHGFHCHTYGNIEITNNSTKIWTTSEIEKLNYKMVGKQNILSGVFKNKVYG
738 :     TMVHNLLDNDFVVENFLKNMKIKDDEKQEIFKKNSILKEKLKDRSKISENFKKIESNDKK
739 :     GIILLATGSESGKTFLSTSICSKLKGKTFVSKIGPDVRDIVPSLYLLREPMTKFSSIKLS
740 :     DRGWSEPSEFLEFVKNSKFNNYIIEGVMGAFTGALNKKNYSGSEVSKILGFPVYIISSCS
741 :     KTGIEGSFVECMAYHSLLKEMGVNVAGIVLNRVYNAELLEKVKKIANDLNIDLIGVNKLN
742 :     VNVDNKRGLIPEVEIDYEEFCNATMKLDFEIDIPKINPEKINEDSKTFEEYLKIWSEKLI
743 :     NIN
744 :     >45357592 hypothetical protein MMP0029 [Methanococcus maripaludis S2]
745 :     MDFERAFKFPTDDPDWIKKVVIGAILSIIPIVNFISFGYALELLKNIIDSKEELPEWSEF
746 :     GGKFVKGLVAVIIYIIYMLIPAIIMFVFGGTSIMAMANGHDAAIAGGIVGFGITMLLVIL
747 :     LAFVIGFIIPMAIANYIAYDEFGAAFRFSEIFGKIKDNFSDYIIMYLIIIVVGAVSGFLA
748 :     GLIPFIGMLIAIFINFYISLVYAFILGKIYIK
749 :     >45357593 MCM family DNA replication protein [Methanococcus maripaludis S2]
750 :     MDDKQIQNIRPRLTECLKTLNFQDIISEKKKVAVDIDNIYKHGVIDFIEFLEEFPKEGIE
751 :     LLEECYRDAYYSIKTEKPDIVITVKNIPEEFNKSEKKQNYTIEDIKSGTLGKLIEFEGII
752 :     VIATKIKSALKKATYVCTQCGEKKIQEVENPFEAYFEPPCPKCAQNMTLIEDESEYIDFQ
753 :     EIKVQQPLDSMGDPEEPPKYITVFLEHSPGIYCGRVKVTGIPIKNQKNKNIPIYDIYVKG
754 :     INCEVLEDKIEANLNEEDIKNIEKVGKNPKVIDILSERMIPEIKGYEIIKKAIFLQQVKG
755 :     VKKGNKRADSHLLLITDPGIGKSVMLRKIAEIPGNLYGSATTASGVGLTAAVIREKTEIG
756 :     DDTWVIKPGLLVKANKGTACIDELTVNRDLQTFVLEAMESQTIHVSKGGINAKLPSECAI
757 :     IAACNPRWGRFDPNVSIPEQINIPAPMLSRFDLIFPIKDEADRSKDKDIAQHIINVHRAY
758 :     LSKEVSKNMKLDHIIVDDVLIDRDFVIKYIEYAKTKSPIISESAEKLLTEFYLNMRKGSV
759 :     QITARQLEAAIRIAEAHAKAKLKDVVDEEDANEAISIITESLKETAYDPETGQFDVDKIS
760 :     GVGKKDRSKMMGVYDLIKALAEKSDNDLVIIDEIVEAGKSKGIDEEHILLSIKKLKSNGD
761 :     IDEPKTGKFRII
762 :     >45357594 hypothetical protein MMP0031 [Methanococcus maripaludis S2]
763 :     MEIIYNKPEIYATNDIWIQPVSRSSVLESDVVGNCKIINDIPILRVLGSPSLKKTVLNIL
764 :     HVLKDKMTIFKNNFEIKGMDNIFKYLNDVYFDKSVNNYYRAKKAWYRVIGDLFEDVNNWN
765 :     FKKVMGKLITILKVLNPILVFDLHDVSKWNHLKTFQRFVQFLKNEGISIVLRCPFEAYSY
766 :     LKNNFENYKTNSVAAVIYYAKTKGHLISEKVSEELLKISCGNLRIIDLILANSKRDLKNM
767 :     RDLKINWKKIIPEVLPKKYKNIVQKIFLLKKFNIKEISDMLEYSSSTVYNYLNELVGLNI
768 :     IKKRKVNKNILFKLDVDKKTAFDIIQSNVDFKDIFFEINDFKNINLKKRTEIFNGFLIFG
769 :     >45357595 transcription regulator ArsR [Methanococcus maripaludis S2]
770 :     MEAILKKLVNTKERKLILTKLLKEPGCCEDLSKELNISKGLPAQFLKLCTSLNLVKRERI
771 :     SHKVYYSINPENYLKIYNAVTIEDKKTEEKKNLKHSLKKDEFQTTLSVENTLKDYDIKKI
772 :     DNGFGGTTFILNDKDSSFEIFKTNENNYWCVACQSNDCEHVLYLKKASSKKRN
773 :     >45357596 LysR family protein [Methanococcus maripaludis S2]
774 :     MLDPIEFIHNASSISKKSMNRLKLKTNPFSEKPIRGNTKFFVGRTSELSEIADILGAAQY
775 :     GSVANAAIVGTKGIGKSSILNILYYASKRHNHWVVELEASQITARQFLIQLMYGIIKDNL
776 :     FSVDGTLSSDYMKHSQKIIEIYKRLSNYSDKTPVHYPREKIERDLKYLLNEVKEENKLCV
777 :     ILIDEADQFAKRSCLGLLQFFHSFLYEDDILTFLAGPPTMVEDLTKISPAIRDRIPKIIN
778 :     MPPLTKEEAYDLIKRRLEDSQITGAKGYQPFSEQSIEKIIEECDGIPRRIIMTCSEAVSL
779 :     GLKNGVDEIDDEIARNAMKNLGISVGHQILNHLTPAQSKIIKAMAELGGSSTVTELSGIL
780 :     NNSTGTIGTHLSDIYEMGYIYKERDGYNVYYTLSKELKDVLITKEDIS
781 :     >45357597 GTP cyclohydrolase [Methanococcus maripaludis S2]
782 :     MQCNDVQATEPDIKVSLTRVGVTNLKKLVKLKRKNKRDIVLLPTFEVFVDLPSSQKGIHM
783 :     SRSPEVIEEVVENILLEKEIYGVEDLSVEIVMKLFEKHEYATRAEVMLYSDYMMEEKSPV
784 :     TKKDSQEIGKIIARAYGVKDSNGKIDVKKMVGAEVVGITACPCAQNMLKENAVVSLTEKG
785 :     FSSEDIEKILDSVTIATHNQRGIGTVMIEVPNGYTVGISKIIKIIKDSMSGEVYELLKRS
786 :     DEAFVVEAAHKNPKFVEDCAREMIKRVVDVFDYLPEDTQVLVRQVNKESIHRHDAFAERN
787 :     STIRELRDELKTLTN
788 :     >45357598 hypothetical protein MMP0035 [Methanococcus maripaludis S2]
789 :     MKALVVGACTRPVVNSLKKLNFEVYSVSHYNPVDLNADHKKYTINDKFHGHLADKYSEKE
790 :     LLNLSKEYVDLVDYIFVCSGIFESKTSKTPNWDVVGNSPKRIKNISDKYKTVKKLENLGF
791 :     NVPVTYLVNNKYQFEKCLSELKSVVVKPISGSGGIGVTNIDFQNTDNLDINYPVLVQERI
792 :     KSESYSASFIGSNFLCFNKQLINNNIYVGNISPYVLNLKNETIQEFEEVIASLDLLGMNG
793 :     IDFMLKDGIPYIIEVNPRILGTYETIELSSRYNLSKAILENKPVKPKDCFFKKIVFSDKG
794 :     SSYSIDKNPFLRDIPQKGTYIEEGEPVVTIIGRNMADVREMECGILRGV
795 :     >45357599 transcription initiation factor E subunit alpha [Methanococcus maripaludis S2]
796 :     MNLSKDEIFTMLENPLIQQVLFEIMDEDVVGFDVLSVLINTNEVTDDEISRQLDVKLNNI
797 :     RRILYKLYEARLVDYNREKDEETNWYTYTWKPSLEKVPALVAKKMKNVLNGLKEQLNVEE
798 :     NNMFFFCSDCEIKFTFEDAMDSGFRCPQCGEMMYEYDNKKDISLLKEQIKYLEDEFNKNP
799 :     LFSTY
800 :     >45357600 metal dependent phosphohydrolase [Methanococcus maripaludis S2]
801 :     MNIVLNDLLNDATLYEKFSNFKKMQEIPNFNEYLTFLTERCEKNVVLHSIAVADYVYEFG
802 :     IKLLNKKYDFDLDTAVLGAILHDIGRSKSHNIDHGIIGSEILLKNNFNEKYAKIAERHIG
803 :     AGISRKEAEDLNLPKKDYIPKTLEEKVIANADNLVSGHIRVDIDFVIDKFKKRTNNEVSN
804 :     KVYALYLEINKLIDN
805 :     >45357601 type II secretion system protein [Methanococcus maripaludis S2]
806 :     MDAKKYLDHIYHVLIVRNIKILKKTGRKLDERVFIGILLVITILPILLKIFLGFTLKTTL
807 :     ILTFVYLGSVLSLPTIMYESKMDKFDKNIPKALYVMVLSLDSGRSVVEAINEVIRSGIPE
808 :     VDVVFSKIVTLMTERKLSFEDAMILVSNSLDSKIFRQVGRLIIENRKYGGELADTLKKLA
809 :     KTLDDLQNLKSQLLSVTANGLAVGLIILCGVIPATAGLIGGYLTVISQLAPTMPSVEASQ
810 :     ISKAIETIQMGSGLFGLFFAVPLFGLKVNRMIITCAVCMTFAIGTFYAVLRLTGLLFA
811 :     >45357602 hypothetical protein MMP0039 [Methanococcus maripaludis S2]
812 :     MKRKTEKKQGTFDKLANTLKGVKTPKKRKISRVGRSEYLKKIFERKTEDIHKDEILEFYE
813 :     PYIDETPEVSIDLDDLLFEKKEFGALGGYSRSFSYWVTNTSFLPSKRDYQYAGIVDERVY
814 :     FLKMMIAAITTVVLFIIYGVLTGDVFSGVSNGVLLAVIMVVGSIFYPKLKLTLFRGEIKI
815 :     QVLMSILHLISMLNSGASVQESLKNIANNPEYGITSFEFRSIIKDINQGGYNFVEALERA
816 :     KMRTKIHIMRQLYDQLILAANKGGTQLLLENLYNEIVRESMSKIDSSKFQISNLGNLIFG
817 :     IGLIIPFSGMIQSALGAQQGFDGIINAIDLVMGKIGLMSTIIFTIFIKMKIE
818 :     >45357603 type II secretion system protein E [Methanococcus maripaludis S2]
819 :     MGLFDRIQSRDSNPSVAKKNNVSEKVSETPSILDNSEKVKKPEIKVGFSVNERAKQPVEE
820 :     FERDSTSSILDKYFVKVDDIDFDVIIEKENGVTLYKIPEITLMNTALAKFSDMDIKTIKA
821 :     ELSESTLQKLGQIQGYLKNYSEKNNLHLRDIEILHLSHYFYLIIGKLGLLEIPLNDSKLE
822 :     EVMVNGVESPSFVFHRKYQMCETNIRLDRHEATRVVESIAYLAGRTIDSRTPMLDAFLPD
823 :     GSRVNATMSDVTLGGNTITIRKFSEDPLTIVDLINFGTFDLELAAFLWQAVEGYFGAKPA
824 :     NTLIVGGTGSGKTTTLNVVSMFSMYTDRLVTIEDTPELQVPLTHLIKMITRPGRPGIQGY
825 :     EITMDDLIKNSLRMRPDRIFVGEVRGSEAHSLLVAMNTGHDGCSGTLHANSADEALIRLI
826 :     NPPMNVPKVMMSSVDFIINQQRIKRNKKTVRRILGVVEIGGSGENITKTELFKYDGISDS
827 :     VVKTGICMWEEDVCQIAGITRDELMDDRINRKKVLKYMVNNNINDIRKVGDVLKQYQENP
828 :     ENVLKNILE
829 :     >45357604 transcription initiation factor IIB [Methanococcus maripaludis S2]
830 :     MKVESVTKEDTKKSERKIKIAIAKPEDYSNKNVILEKEEELICPVCGSKSIIKDYERAEI
831 :     VCEMCGCVLQQNLFDVGPEWRAFDHEQRVKRSRVGAPMTYTIHDKGLSTVIDWRNKDSYG
832 :     KDISADKRAQLYRLRKWQRRIRVSDASERNLAFALSELDRIASKLGLPRNVRENAAVLYR
833 :     GAVEKGLIRGRSIEGVAAAALYAACRRCKVPRTLDEIAEVSRVDRKEIGRTYRFISRELN
834 :     IRLAPTNPVDYVPRFASELKLPGEVESKAISILQKAGERGLTSGRGPTGVAAAAIYIASV
835 :     LQGTRRTQREVADVAGVTEVTIRNRYKELTEHLDIDVTL
836 :     >45357605 H/ACA RNA-protein complex component Gar1 [Methanococcus maripaludis S2]
837 :     MEKIKILHRTPKGKIIGRVKKQPRFNSPVGIKLKDRVKKIGKIYDVFGPVEEPYVKIIPY
838 :     SEDDAEKTLESDNVFVMNEQSKKQSKPRKKGRR
839 :     >45357606 isopentenyl pyrophosphate isomerase [Methanococcus maripaludis S2]
840 :     MNNNSIEYRKLEHLIVCDHCDVEYKKGTLLEDVELIHSGISNCDLDDIDTSIEIFGKKLN
841 :     APLIVAAITGGHPKAKEVNKNIAIAVEELNLGMGVGSQRAAISKSYLEDTYSVVRDHTSS
842 :     LIIGNLGAVNFVEDSWDEEIISKSVEMIDADAMAIHFNPLQEAIQPEGDVNFKGLNILKE
843 :     IISNYNKIHGKIPFIAKQVGEGFSKKDAIFLKEIGFDAIDVGGSGGTSWAAVELYRIKDE
844 :     EQKNFSNQYFNWGIPTAASILEVNSAFSGPIIATGGIRTGIDIAKSISIGANCCGTALPI
845 :     LKAALKSSEAVTTVLERMIKELKTTMFLTGCNNINELKSARYILKGDLKNWKDQI
846 :     >45357607 beta-lactamase domain protein [Methanococcus maripaludis S2]
847 :     MQLEVVAIGGYEEVGRNMTAVNIDGEIIIFDMGVRLDRIMIHEDTDISKMHSLNLIEMGV
848 :     IPDDTVMKNIEGEVKAIVLTHGHLDHIGAITKLAHRYNAPIIGTPYTLELVKREILSEKK
849 :     FDVRNPLITLENGNKLDLTANITLEFVKITHSIPDAAMAVLHTPYGAVVYGNDFKFDNFP
850 :     VVGEKPDYKALKRIGKQGVIAMVSESTRVDFEGKTASEGVAANLLKNDLLGTDNEDNAVV
851 :     VTTFSSHIARIKSITDIASKMGRIPVLVGRSMSKYCGIAQDIGLVKFPKETKICWDPSSI
852 :     DKTFHQIMKDGKENYLMVVTGHQGEEGAVLSRMATNKTPFRFEKYDQVVFSADVIPNPMN
853 :     AAQRYLLEARLNLAGVRLFKGAHVSGHAAKEDHRDILRWLQPEHLIPAHGDFNLTSAYAK
854 :     LAEEEGFRLGEDVHLLRNGQSLKFERVI
855 :     >45357608 bifunctional short chain isoprenyl diphosphate synthase [Methanococcus maripaludis S2]
856 :     MVFDREILSKIDSELKKYMEKDTKLYGASKHLLLAGGKRVRPYLSILTYLLKKDELTEIM
857 :     APALSVELIHNYTLVHDDIMDNDDQRRGIPTVHTVYGEPIAILAGDLLYAKAFEALSNIE
858 :     DSNKAHEVLKVLSKACVEVCEGQTEDMEFEERFPTLDEYLEMISKKTGALIVAPVEIGAV
859 :     MADCTPEEREALCNYAKRIGMTFQIQDDVLDLIGDQKTIGKPVGSDIVEGKKTMMVIHAM
860 :     ENLSEDKKERLLQILGNQDANQQEVAEAIELLADSINYAKDTMKNATEEAKDYLKIFDAE
861 :     KRKNLENIADFIIERIH
862 :     >45357609 hypothetical protein MMP0046 [Methanococcus maripaludis S2]
863 :     MKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTL
864 :     KKDVLIQYPDKHTFTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLR
865 :     YVNSPVSGTVIFMNEIPSERANYVFYMLEE
866 :     >45357610 radical SAM domain protein [Methanococcus maripaludis S2]
867 :     MIGFRMTSKNKYSVSKLYPLIGGTLFKEFGEIIENLDSLDILIYSFMSMQEKEVLSEINE
868 :     LKKLKKDVILIAGGAHPSGCPEDTLNLGFDHVIVGEGEISLPNLINSIKSGKTPEKIIKG
869 :     KPIENFDDYEKIWPLAPIEITRGCPYNCRFCQTPQIFGKNIRHRSIESIVKIVKTMGDIR
870 :     FVTPNAFSYGSKTGTKPDIEKLEKLMKSLFEIKKRLFFGTFPSEVRPEFVNFETLDLVNK
871 :     YCDNRYIHFGAQSGSDEVLKHIRRGHLVSDVINAVETSKECDLIPKVDFIFGFPDETDDQ
872 :     RKESIDLMKYIIKKNGKVHAHYFMPLCGTYFENSTPELLEKETLDILGKMAKKGQITGSW
873 :     GYQYSKNLE
874 :     >45357611 hypothetical protein MMP0048 [Methanococcus maripaludis S2]
875 :     MKKRPTLYIKIHYPGSILEGEYDYEAVVKLKNKYIKYLETGKGTGTLLFNEDKKNFAVVN
876 :     FQQVCAIEVDKTLMFMDEFEREWDKVYKTR
877 :     >45357612 carbonic anhydrase [Methanococcus maripaludis S2]
878 :     MAKIAKNAVVIGDVELGENVNIWYGAVLRADINKIKIDDDSNVQDNCTVHCSKDYPVFIG
879 :     KGVSVGHGAVIHGCTIEDNVLIGMNSTVLNGAKIGKNSIIGANALVSQNKEIPPNSMVLG
880 :     VPGKVVRTLTDDEVNSIKENAKNYLELSKNL
881 :     >45357613 riboflavin synthase subunit beta [Methanococcus maripaludis S2]
882 :     MVNLGFVIAEFNRDLTFMMEKMAEEHAEFLGANVSHKIMVPGSFDMPLAIKTLLQKDDID
883 :     AIVTIGCVIEGDTEHDEIVVQNAARKIADLSLDFGKPVALGIAGPGMTRMQAEDRIDYGK
884 :     NAVEAAVKMVKRLKEIQ
885 :     >45357614 phosphoribosyl-ATP pyrophosphatase [Methanococcus maripaludis S2]
886 :     MNVLKEVYATIEKRIEEKPEGSYVAKLTTDDKKTAVNKICEKVGEEAAEVIIAAKDNDKA
887 :     EIIYESADLIFHTMVLLAKSGITYEELSEEFKKRMK
888 :     >45357615 putative signal transduction protein with CBS domains [Methanococcus maripaludis S2]
889 :     MELTIVQKEILQELISIYREKNKAVKGTEIAVKLSRNPGTIRNQMQALRALNLVDGVPGP
890 :     KGGYIPTSLTYRSLGLETEEEITVPIYKRDDLVEGVSVIKIVFDTVTREKSCSSKIYVNG
891 :     DTRKFSEGDVVKVGPTHHNKIVILGRVVGRDDINHILLMDVISVASVPGITVGDVGIKEE
892 :     LIYITPEKTIRDAAKLLSDANISGIPVMDGKKLLGVLSLHDVADAVSRGLENENVTKLMA
893 :     EKIYTISKNEKIYDALILMEKHNVGRLIVLDNEEIAIGILTRTDILNLIEGTIFPKILKK
894 :     YLK
895 :     >45357616 hypothetical protein MMP0053 [Methanococcus maripaludis S2]
896 :     MKAFEIIKIIEKFAPKELAVPRDNIGLQVGLNLEKEVETLGIALDPSLEVIKKAESENVD
897 :     FLFTHHPILKDPIRNFTGPIYKKLKILTKKDIPLYSAHTNLDICKNGLNDCLAELYNLKD
898 :     VKNLYEDGLGRVGTFDGTFEDILKITKENIFAVPQTVVPKSIYDKKQLKVAVLSGYGLSQ
899 :     DSIKYVSNFADVYISGDLTHHSKIIAEELGITVIDGTHYGTEVYGLKSFLKYLEKNIPCK
900 :     TVSLDF
901 :     >45357617 hypothetical protein MMP0054 [Methanococcus maripaludis S2]
902 :     MIEIIEINGIKIKTHPKVYVPAEDSELLIENLVDVKNKTVLDVGTGSGIQAINAVKQGAL
903 :     KVIGIDINPYAVDCAKINSELNEIDSKKLFFKTGDLFKNIDEKFDVILFNAPYLPTSDEE
904 :     KLEKYLNYAFDGGKDGREVLDKFLDEVANYLKKDGIIQILQSSLTDGNKTIEKMKKLGFV
905 :     AKQTGSLKFSFEELQVITGWKK
906 :     >45357618 hypothetical protein MMP0055 [Methanococcus maripaludis S2]
907 :     MEIKRRYMLKKKELKELKEELGNIFDVEKIIPKKAVVEKAVTEEGEIILLDGTPLAMVNS
908 :     GRIFPTLKFLLEMDIENNRVIVDMGAVKFIANGADIMAPGIVGADEDIKEGDIVFVVDVT
909 :     HKKPLSVGEALMDGKTMVEEKKGKAIKTIHFIGDEIWKM
910 :     >45357619 FO synthase subunit 2 [Methanococcus maripaludis S2]
911 :     MDLMSFKEKELSKKDCVELFEDTENFFDILKLADSLRKDIVGDTVTYVVNANINFTNVCS
912 :     GTCKFCAFKAEHGDPNAFFLSPEQVAKKALEARKTGATEVCIQGGLLKEIDTYFQAEILK
913 :     KVKEITKTYGGIDVHAFSPMEVKSAAENAGLSVKEALKILKENGLNSMPGTAAEILDDEV
914 :     RSEICPTKLKTSEWIDVVSTAHKTGINTTCTMMYGHIEENKHLAEHLSILRKIQKETGGF
915 :     TEFVPLTFLHENAPLHHMDRVKSGASGMLDLKVYAISRIFFKDYIKNIQTSWVKLGTKLS
916 :     QISLNCGANDIGGTLMEESISKAAGGSYGTYMSEEKLKDMVLAVGRIPKQRNTCYEIIE
917 :     >45357620 FO synthase subunit 2 [Methanococcus maripaludis S2]
918 :     MDLMSFKEREISKKDCVELFEDTENFFDILKLADSIRKDIVGDTVTFVKNTNIETTNVCT
919 :     MGCKFCAFSVSKNSPEAFKLDADEIAKKAVIAKKSGLTEVTIHGGIHPDVDTHFQVETIN
920 :     KVNSATSKLGGIYTHAYSPQEILNGAENAGLSIKEALKMLNEAGLRTIPGTAAEILDDEV
921 :     RSDICPLKMSTKKWIDIMKTAHKTGIKTTSTIIYGHVEEYKHIVDHLSILKELQEETGGI
922 :     TEFIPMSFLHENTPLYKSGRVTDGASGLYELKLYAIARILFKESIKNIQAPRVKIGTKLS
923 :     QLILKSGANDLGGTLVEDKVSKAAGSIYEDASVDLMKNAITSIGRIPKERTTLYEIIE
924 :     >45357621 methylenetetrahydromethanopterin reductase [Methanococcus maripaludis S2]
925 :     MKFGIEFVPNEPITKLAYYVKLAEDNGFEFCWITDHYNNRNVYMTLGNLAAATNKIKLGP
926 :     GVTNPYVRSPAIAASAMATVDELSGGRATFGIGPGDKATFDALGIEWTKPVGTIKKAIAD
927 :     FKELTAGKRMAEGAQLAVKPSAKIPIYMGAQGPKMLETAGEIADGVLINASNPKDFEAAV
928 :     PLIKKGAEAAGRSMSEIDVAAYACMSVDKKAEKAKQAAIPVVAFIAAGSPPMILERHGID
929 :     PAKVDAIRAGLKEGNFGAAFGNVDENMLEGFALYGTPEEVVEKVKALEKMGVTQVVAGSP
930 :     IGPNKDTSIKLIGKIIKEFQ
931 :     >45357622 hypothetical protein MMP0059 [Methanococcus maripaludis S2]
932 :     MSEERIQFNAKKGKWYVSKKIKIDENTSNEEIARVLASIEETLSIKIKDFLPFDMEKLRA
933 :     IADEIYEKKKGRVKEEDISGALTKLKSPGTTKKLGTIDDTKEGKEILKRLLTEIVLERLG
934 :     ITSKIEAKMIEKYIEKSKAK
935 :     >45357623 ribosomal LX protein [Methanococcus maripaludis S2]
936 :     MAKIVRIKGEIVGKDEPMVFTKEYNVLKENDALETMYSEIGSKHAVKRANIKVVEISEIS
937 :     VEEIQSPILKKTLEMN
938 :     >45357624 translation initiation factor IF-6 [Methanococcus maripaludis S2]
939 :     MIMKTYFSGVSTLGVHSLATEDYGFFPLSVDQKTMERMKNVLDIPATQLNISNSSLIGSL
940 :     CVGNSNGLLVPNITTEKELELIKMFLKENSLDVNLERLKAKNTAFGNLILTNNKGCIISE
941 :     ELSRFRKTIEDVLDVESGVGNYAELPTVGSNGVATDKGCLVHPLTDELELEWIQDILRVD
942 :     YVERGTANRGVTSVGACILANTKGAVVGGDTSGPEILKIEEALDLID
943 :     >45357625 50S ribosomal protein L31e [Methanococcus maripaludis S2]
944 :     MEEERIYTIPLRDVTNKSPTTKRAPRAIRAIREFLKKHMKSDIVKLDNTINEKVWERSLN
945 :     KIPAKVRVKVVKEGDVVKATLVE
946 :     >45357626 acetylglutamate kinase [Methanococcus maripaludis S2]
947 :     MEDYTKAEILIEALPYICKFHDQKILIKYGGHAMVNEQAKNWIAKDLVLLKYVGINPIVV
948 :     HGGGPEINRAMEKMGKTPEFIHGLRVTDEETLDIVKMVLIGKINGDIVSKLERYGGKSVG
949 :     LSGKSGQLIKAKKKIQYLMKDSQKIEVDLGMVGEVEHVDTKLIDILVEKRYIPVISPIGV
950 :     DHQGNDLNLNADIAAGDIAGAMNAQKLIMVTDVDGIMDDVNDPSTLHRRLTIPQIEDMIE
951 :     KGLITGGMIPKIEACVNALDKGVQSVHIVNGKTPHAVLLEIFTEDGVGTMVVRE
952 :     >45357627 nitrogen regulatory protein P-II [Methanococcus maripaludis S2]
953 :     MKKIEAIIRIERLDIVKGILSENGFLSLTISEVKGRGVQGGITERYRGTEYVVDLLPKVK
954 :     LEMVVDDKDIDEVITIIRENAETGKPGDGKIFIIPVEDAVRIRTGESGIKAI
955 :     >45357628 ammonium transporter [Methanococcus maripaludis S2]
956 :     MATADLFADPTNIVTGLSTLATSGDVMFLVLMGVLVFSMQLGFALLEGGQVRKKNVNNVM
957 :     MKNMADWLIGAVSWLFIGGVLSVSLVPADFFSWWGQIFTTNFANNGIDLANWFFGLVFAA
958 :     TAATIVSGGVAERIKFKSYLLMSIIITAILYPLFVYLGPWGSGMIPFNDYAGSFVVHGLG
959 :     GFLALGAIAALGPRIGKFVNKKAISIPGHNIPMSVFGAFVLAIGWYGFNVGSSFAVADIS
960 :     GLVCATTTLAMAGGGIGALLASKDDVLFTANGIVAGLVAICSGTDVVSPIGALIIGLVAG
961 :     IQVPIVYKIVEKMGLDDVCGVIPVHGTAGILGGILTGVFGMAALGGAGGVSLVNQLIAAG
962 :     LTVVYGTGLGFGLGKLVGGFTGGLRVTEEEEKMGLDLAEHKLPAYPDE
963 :     >45357629 nitrogen regulatory protein P-II [Methanococcus maripaludis S2]
964 :     MRKIEAIFRPERLLAVKNALFEEGFISLTLTEVKGRGVQGGIIERYRGNEYLVDLLPKVK
965 :     IEIVSNDSDVEKIVKLISENAVTGKPGDGKIFVIPVEDVIRIRTNETGKDAI
966 :     >45357630 nitrogen regulatory protein P-II [Methanococcus maripaludis S2]
967 :     MKKLEAIIRMERVGLVKNALYKSGHASLTLTEVKGRGVQGGIVERYRGTEHVVDLLPKVK
968 :     IELVVNEKDVDSVIKIIAENAYTGKPGDGKIFVIPVEDVCRVRTGEMGPDAI
969 :     >45357631 ammonium transporter [Methanococcus maripaludis S2]
970 :     MVTADLFNNPTNIMDALNTLANSSDVMFLIFTGAFIFIMHLGFAMLEGGQVREKNVNNAM
971 :     MKNMGDWIIGCISWLLVGSVIARTLNPADFFIWWGKIASATPFLTNNGLELANWFLGLVF
972 :     AATAATIVAGGIAERIKFKSYILISIVITALLYPFFSYLGPWGAGVIPFHDYAGSLMVHG
973 :     VGGFLALGLIAAIGPRFGRFVNKKAITIPGHNIPMSILGAYILAFGWYGFNVGSSLALSD
974 :     ISGLVCATTTLAMAGGGLGGCLFSKNDVLYTANGLLAGTVAICAGTDIVSPLGALIIGFI
975 :     AGSQVPLIFKIVEKMGLDDVCGVIPVHATSGALGAILAGIFGMTAFGGVGGVSLTEQIIA
976 :     TLICAVYGTGAGFILGKLVGAVTGGLRVKESEEKAGLDISIHKLPAYPKEN
977 :     >45357632 methylated-DNA--protein-cysteine methyltransferase [Methanococcus maripaludis S2]
978 :     MKTFNEQCYDLIMQIPRGKVTTYKIIAEALNTKAYRAVGNAMKNNPKILTVPCHRVVNSN
979 :     GYVGGYVNGVEKKIEILKNEGVVISGGKITDLKKYLFVF
980 :     >45357633 tungsten containing formylmethanofruran dehydrogenase subunit C-related protein [Methanococcus maripaludis S2]
981 :     MVFGIFKKKKKAVEDYLNDKNVLELTLNESKDCILDFTYNFIWQSNFDIKSEVFNGISYE
982 :     KLVNHIKNPENVVYIKGDVGHRFCSSMGADLKYFGGSGGKIQTGTVIVDGNIDTRFGISM
983 :     VSGTVYLNEKFSLKEPIGNIIEVESDISGYKKYISITELMESNSQEKVLKPNVFKNNELI
984 :     LNDNVIRDTIGARLENGSKITVNGNVDLSTGILMKNGTVLVNGNAGKNTGSVLRGGTVII
985 :     NGNTGDFTASDMISGTIIIDGNAGKFLGSKKKNGVIYAKDGSAIPPLKKQSLNSKDKELL
986 :     SKNGFFGEFVKF
987 :     >45357634 DNA primase, small subunit [Methanococcus maripaludis S2]
988 :     MNDNPATDKVFKEVSSLYKQYFEYAILVRKWLEIPDDLSHREIGYGMLKKVDNRNMSFNT
989 :     ERDYLAWVLKESPFHLYKSLSYMEYPDIVGGAAKKGLFKREVAFDIDTHKTEKCTHDDSW
990 :     ICEECLGEARNQVLILIEDFLFPDFGLDEKDLKIVFTGNRGYHIYLKPEDPELLKRIEKW
991 :     GKNERRYFIEYILGKNLNLRNMGSRWKNILVREFNKNKIATKKFEKTSDWKTEIDNRKDT
992 :     TRRTIYETIDKVKSRLELDEKVMDDDIRLLRTIGSLHGYTGLMVKEITYNSLKNNQFDPL
993 :     NHGVFSKFHKKMYNVKIKQELDPLTLKGDTFDHNSTEIPASYLLFLFGHGIDFEILE
994 :     >45357635 hypothetical protein MMP0072 [Methanococcus maripaludis S2]
995 :     MILGIDIGGANTKITELHENGEFKVHHLYFPMWKNNDKLAEVLKTYSKDISHVALVTTAE
996 :     LADSYETKKEGVDNILNAAESAFGSNISVFDSDGNFISLEGAKTNYMKVSASNWCGTAKW
997 :     VSKNIEENCILVDMGSTTTDIIPIVDGKVVAEKTDLERLMNHELLYVGTLRTPISHLGNT
998 :     ILFKGVNTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDL
999 :     DQISEIDAENIAKTYYELWKELILENVKKVAEKYGSKKVVITGIGENILKDALGDFEVIS
1000 :     VAERYGKDVSLATPSFAVAELLKNEL
1001 :     >45357636 argininosuccinate synthase [Methanococcus maripaludis S2]
1002 :     MQEKIAVLAYSGGLDTSCCLKLLEDKYDYKVISVAVDVGQPEDDLKEPEEKAKKFGVLKH
1003 :     YTIDAKEEFAKDYIFRAIKANALYEGYPLSTALARPLIAIKIAELAQEVGASAISHGCTG
1004 :     KGNDQFRFESVMRAKTPEIEIVAPIRDLNLTRTEEIAYAKEKGIPVPVDLEKPFSIDENL
1005 :     WGRSIEGGILEDPMTETPKECFAWTVDPTDAQDKEEYVEIDFEEGVPVAINGDALEAVSL
1006 :     IRKVNEIAGRNGVGRVDIVEDRVLGLKSRENYECPGAMLLITAHKALEQLVLTREELVFK
1007 :     EMVDSKYADLVYKGLWHEPLRLDLDAFIDKTQTRMNGKVVLKLYKGSMRIAGRESKDAIY
1008 :     NEEMVSFENKEMDQREIVGMVKFHGLQAAIYEGLTRK
1009 :     >45357637 hypothetical protein MMP0074 [Methanococcus maripaludis S2]
1010 :     MNIFTSKGTIKYEKEKIIKLSSEMFPDDLCEQCGRCCIIHVFNSTECGEPEVVYCNHLDT
1011 :     ETKRCKIYKNRFKKEKKCLSMLEAIMVSALPKDCPYVKNYESYEEPWFYDCLRSKSKD
1012 :     >45357638 abortive infection protein [Methanococcus maripaludis S2]
1013 :     MIESLIRFFYFFISLVIYWINLIRAFNLELIEKRTIDIIFVFNLSVLFFSIYFMSDVNYV
1014 :     FGLSVYAASFLSVLLIRNQGFFKKFTKLLKMDLSFDNSIHKISLSLSTYILLNPVIAFAS
1015 :     GAGLIIILSDFLEILDIAAFQLIILVYAFVGIGFGTRKNLKQSIKRLDIKIPSLKYAIFG
1016 :     VILLLMVDKFIWGLFDFFIYFFQSMDPAISEHIAEHAVVESSNVNEVVSTIKTSASTPLK
1017 :     IVFLSIIVGISEELMFRGALQPRFGNIYTSLLFASLHAQYLSSMVLLDVFIISYILGMIK
1018 :     ERKSTSTTILIHIFYDVLSLIF
1019 :     >45357639 deoxyribonuclease [Methanococcus maripaludis S2]
1020 :     MAFGKPAMKNVPVEAGKEYEVTIEDMGKGGDGIARIDGFVVFVPNAEKGSVINVKVTAVK
1021 :     EKFAFAERV
1022 :     >45357640 radical SAM domain protein [Methanococcus maripaludis S2]
1023 :     MIREVFSSIMGEGKFIGKRFIFVRFKECPLDCIYCDEPNAPGGTARVEEISGSCEFMEYL
1024 :     EIEHELIEIIEKLRTPDLFAVSFTGGEPLVYSNKIKEYSEILKHKGYKTFLESNGMFPER
1025 :     LGSYDYASIDIKLPEHFENKDDDFWYGLYKKELETIERLYLAGTDVYAKIVVFEETSEEL
1026 :     IERIAIDLSKIGNITLCIQPVSPTDKIKTTTSKKKIFELMAICGKYVDVMCTPQIHKWMG
1027 :     ML
1028 :     >45357641 hypothetical protein MMP0078 [Methanococcus maripaludis S2]
1029 :     MNKNEIANLKMQGFILQNDGKHFALRIKTDAGCMDSEKIDKLSEISKKYGRNYISFTVRL
1030 :     CVEIPWINYEDIPKIKEELKNLSLISGGTGNTVRPLVACKGTVCTHGLIDSQKICNELDS
1031 :     LFFGKKLPHKFKIGISGCPNNCAKAQLNDIGIIGQRIPKINEENCNGCTLCLKSCSVDAI
1032 :     TIVDKKAVIDYEKCVNCGKCGKSCKRKCISLKDGVLISVGGKFGKKYKIGENIGIYDAPN
1033 :     LEKIVSEIMDYFKENADSHERFGDTIDRTGISSLKEKLKDY
1034 :     >45357642 orotate phosphoribosyltransferase [Methanococcus maripaludis S2]
1035 :     MKKELILKALKLRDMGFPSGDIAEELNISVKTALYLTLNGEELLKAEESPKEDSEKLDIF
1036 :     LEWDNVRASSRRLRNISKIICDMLSDVEFDGVVGISSGGVPLATLISDELDKNFSIYVPK
1037 :     KHIHTEKEKTTGFIGQNMSSIVGKDVIIVDDVMTSGNSVKETIKYLKGIANPKKVFVVMD
1038 :     KSGIDEIEGVSIEHLFRTGVVDIKK
1039 :     >45357643 glutamate synthase; large subunit; subunit 1 [Methanococcus maripaludis S2]
1040 :     MCGIIGFMSRTGRLISGDRIATALNCLKERGNGEGSGYVGYGIYPDYKDDYAIHVFLDAT
1041 :     KDYDKIRHEVEEVLVKYGYILKDEEIPTEEGIIKKEQVSWRFFYRFDEKYKSVEEDMMVD
1042 :     IVMDINAKIDGAFVFSSGKNMGVFKAAAWPLEVAEYFKIDQYKGFQWLSHARYPTNTKGW
1043 :     WGGAHPFNLLGWSVVHNGEITSYGANKRYVESFGYKCKLLTDTEVVAYLFDLLIRKHKIP
1044 :     VEYAMSALAPRFWDEIESMSEEDKKIHEAIRMTYGGATMNGPFGIVVGTQEGMAFMNGEV
1045 :     EEGNTMVGLTDRIKLRPLVAAEKDDLLFVSSEESAIRKICPELDRVWMPDAGRMVIAKLE
1046 :     KKI
1047 :     >45357644 glutamate synthase; large subunit; subunit 2 [Methanococcus maripaludis S2]
1048 :     MIPSTVPPKYKVFVDPERCMLCERCTTECSWGVYRRQGNKILTYPNRCGACLRCVSLCPR
1049 :     DAITVTLNQSCGREHPVWTPEVKQDVVTQAKSGCILLSGMGNAKEYPIYFDKIVLDACQV
1050 :     TNPSIDPLREPMELRTYVGKKPEKLEFDYVEDEIDGKKVKKAKLKTKIAPNLKLDTPIMI
1051 :     GHMSYGALSLNAHKAMAKAVKECGTFMGTGEGGLHRDLYGYSDNVITQVASGRFGVNSEY
1052 :     LNKGAAIEIKIGQGAKPGIGGHLPGEKVSAEVSMTRMIPQGSDAISPAPHHDIYSIEDLA
1053 :     QLIRSLKEATRWKMPVFVKISAVHNVSAIANGIATSDADAVVIDGFKGGTGAAPKVFRDN
1054 :     VGIPIEVAIAAVDDRLREQGNRHKISIIASGGIRNSADVFKSIALGADAVYIGTAAMVAM
1055 :     GCTVCGRCYTGQCAWGIATQKPELVKRLEVDDAARRVANLIHAWTHEIQELLGAAGINSI
1056 :     ESLRGNRDRLRGVGLSEIELNTLGIKQAGM
1057 :     >45357645 glutamate synthase; large subunit; subunit 3 [Methanococcus maripaludis S2]
1058 :     MASLGERMKELKIDAKDMDYRELNEKIHEVLDENKDLEKLVLENVLGQRFIGNGVSRKDL
1059 :     TIIVNGVPGGDLGMFMKGPKVVVNGNADHAPGNTMDEGFVVIHGSSGDVTGHSMRGGKVY
1060 :     VQGNVGYRSGIHMKEYKYKFPVLVIGGAAKDFLGEYMAGGIILNLNMDQEDSENIEGRMI
1061 :     ATGIHGGVIYVRGIVKSSQLGIAADIKEFTEEDVEKITPYIEEFCAEFGYSNEIKEKLIN
1062 :     SKYTKIAPISSRPFQKLYTPDLR
1063 :     >45357646 coenzyme F420 hydrogenase/dehydrogenase beta subunit domain protein [Methanococcus maripaludis S2]
1064 :     MKSYLNLKEEVWDKETCSGCGACVSVCPTENIYFKQQSPVQFDCDECACIIVPTENGESP
1065 :     ISAEFCKVTLYDVNCGACYNACPRTKERHIFNLEKVPGRVIENYKAKSTLETKNIQSGGV
1066 :     VTAILANAFDEDLIDGAIVMMEDKWTMDPKSYLATSKEDVLKTAGSRYNWNVPILEVLKE
1067 :     AVMVKKLNKIAVVGTPCVINAVYQMMATNNDLVEPFKKAIRLKISLFCFETFDYDKMLKK
1068 :     LKEVEVNPWDIKKMEIDKGKLIVSTIHGNVFNFKIDEMDEYVRKGCKVCRDFTGISSDIS
1069 :     VGNVGTPEGYSTVLVRNKWGKGFFDRAVINGYVSVEGEASIDPVISLSKKKMERKDIEF
1070 :     >45357647 hypothetical protein MMP0084 [Methanococcus maripaludis S2]
1071 :     MQWLWLHYQLCYTTFIFLIFHDIHHISIYLLGDIAFTPIEVLIVTLILHRLLEHRDKKQT
1072 :     LEKLNMVIGSFFSEVGEELLTYFSDNDPDLKEIRKNLIVNNNWDDREFKNAHKILKNYNY
1073 :     HVKINSDNIKELKEFLNSESPFILRLMENPALLEHEKFTGLLRAISHLSEELMKRKDIDN
1074 :     LPQSDIDHISGDIVRVYERLVSEWLDYMMYLKNNYPYLFSLAMRSNPFDLTSEIIVK
1075 :     >45357648 hypothetical protein MMP0085 [Methanococcus maripaludis S2]
1076 :     MKIIQEIPERNIIKLIPENLDDLWHLSHIIQPYNAIYAVTERRTEDKGDKLRADRGTKRR
1077 :     VFLGIKAEKINFHEDFNRLRVSGKIIHAPDDIPIGSYHTIDIEPFLQVSVQKNWKKWDIE
1078 :     RLKEAEDSSKKPKVVVVIMDDSEADIFLVREFGIKELASIKSGVSKKLDYKQNEQAKFSY
1079 :     YSDIINSISEFEGKILFAGPGFGRNNIQNYISEKYKSLAPNVVVESANHTGKSGLSEILK
1080 :     SGIIDKIYGEARISKETQVVEKLLEEISKKGLAAYGIESVNNAMNFSAIDTLLLTDEYLR
1081 :     RNRRSVENLMNSVENINGNIIIVSTEHDAGKQLKALGGISALLRFPIE
1082 :     >45357649 putative transcriptional regulator [Methanococcus maripaludis S2]
1083 :     MKSGTMESFLTEIQINVLNLRKRGHTQDEIANIMGTSRANISMIEKRARENIEKARNTLS
1084 :     IYNDIIAPSKIKIDKGTDVFSIPKIIFSKSDQEEIHVNYSSLQIMEFVNQNAQRYIKNRM
1085 :     VVEPFVVTILQNGDIFVHDYEESEENEKMPKKEI
1086 :     >45357650 hydroxymethylglutaryl-coenzyme A reductase:3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanococcus maripaludis S2]
1087 :     MENNVNIDEIVEKLLKKEIKVYQLDSKFGERNAVIARRKYVEKLSNVETRHIQEYTLDEK
1088 :     LAMQKNIENMIGAVQIPLGFAGPISINGKYAQGEFNVPLATTEGALVASINRGCSIITKC
1089 :     GGATVRVIDDKMTRAPIIKTNSVVDALKLKEWILDNFAKIKEIAESTTRHGKLIQISPIL
1090 :     IVGRNVYPRFTFKTGDAMGMNMVTIATEKACSFIESELKKEGIIIDTVALSGNVCVDKKP
1091 :     AAINLIEGRGKSVVAEVFLKEEYVEKYLKTTSKAIEQVNTYKNLIGSAISSSLGFNAQYA
1092 :     NIVGALFLATGQDEAHIVEGSMGITTAECTGDGLYFSVTLPDLPVATIGGGTRVETQREC
1093 :     LEILGCAGAEKAVKFAEIAGAAVLAGELSLIGALAAGHLAKAHSELGR
1094 :     >45357651 glutamyl-tRNA reductase [Methanococcus maripaludis S2]
1095 :     MLVVRADYKKYPIPVLEKMRIDEDEFYKKYDACVVVQTCNRIEAYFDTEVNSDLNCILND
1096 :     FSGFDILKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQKARELKKTSRYLDSVFLK
1097 :     AIHVGQRARTETKINEGSVSIGSAAVELAEKNFGLANKNVLLIGAGEIGTLVAKALMEKH
1098 :     IKAVIVANRTYERAETLAKELKGMAVHFDKLKEAINFSDVIICATSSPHYILKKEDLIDV
1099 :     GNKIIIDIANPRDVDDAVREFENINLYTIDDLRNISDKNLQKRIEEVPAVEKIIDEEYDV
1100 :     LMKQIEKINVEEVLKDFNNYIEEIRTKELEKAIKLSKTKNPEEIMENFSKAFAKRITHDF
1101 :     VSYSINTSKEDLMNSAWWKNGK
1102 :     >45357652 siroheme synthase [Methanococcus maripaludis S2]
1103 :     MIPVFLDLGGFNVLIFGFGSVGKRRFEKFLKSRAKITVYSKCIDKNDISKYKNAIFFESD
1104 :     VTNLSDEELYSIIKNHDIIITAIDEENNKRIVSVAKSLKKFINSSTFEKESNLIVPACCE
1105 :     VDGVSFAVYTGGKSPIIAREIRKNVEEYLKNSEFELDFQNKLRDFLKSEIEDQNERKKVL
1106 :     ETVFSDKKFKKELLKLIEKHR
1107 :     >45357653 glycosyl transferase [Methanococcus maripaludis S2]
1108 :     MKILLPSIYYPFIGGVSIHVENLIKNLNKLDDFEFHILNYNFDESVENSFENVTIHKVPY
1109 :     FSKLRGPSYILNGYKLGKKIIKNEKIDLIHSHYAAPQGFLGAILGKKCNIPTVLTLHGSD
1110 :     VLNLSKSSLGKYFFNYAVHNSEKIICVSEFLKHNLKTNFNIDSNVIYNGFDEELFNPSDN
1111 :     DKNYGLFVGSLVEQKGIFYFLESIKNIDFNFKIIGGGPLYNKILDFIKLNDIKNVELLGP
1112 :     KTQNEVSEYLKNCSFLVLPSISEGLGMTIIEAFACKKAVIGTNVGGIPELIKDGINGYIV
1113 :     NPKNTKALEDKINMLVNDKKLRKSLGEKSLDTSKNFSWGLSSKKTYEIYNSLLNR
1114 :     >45357654 hypothetical protein MMP0091 [Methanococcus maripaludis S2]
1115 :     MREGHEQNKREFEDYAYVLDFLEYGYPEDTRPLHQKKPIAQAFGEKQFVMMELTFKDNQV
1116 :     ADLAEKLYIGKGKREKVEFVSKMLKYEQLTPTAKTELLHVIKEAVKAQEERFVEFLNNCG
1117 :     PITNRMHTLQLLPGIGKTSMWKVIEEREIKKFESFKDFEDRVRKNIVDPLAKRIEEELKE
1118 :     PQKHYVLVKWKTTH
1119 :     >45357655 DNA-directed RNA polymerase subunit F [Methanococcus maripaludis S2]
1120 :     MIGKEIISEKYTTIAHATEIMDERADFDELSYEHGCSLDYLRKFSTISKDDADAMFEQLV
1121 :     NLGLTEKMAVKIIDLLPETEEDLKIIFYRVDVPENKDEILEVVSKFK
1122 :     >45357656 50S ribosomal protein L21e [Methanococcus maripaludis S2]
1123 :     MQKSEGFRSKTRYKLQKHPRQKGMAPLTRALKCYTEGDLVHVVLDPSVQKGMPHPKFHGK
1124 :     TGVVVAQRGSSFLVRVKDGGKYKDIIARPQHLRESKL
1125 :     >45357657 THUMP domain protein [Methanococcus maripaludis S2]
1126 :     MNIDYSVLKKYPLCDRCFGRLYGKLIRSSNFDRGHALKLAKAIELEEDLRTALEKMNETP
1127 :     ENSEVNPTDLEKLEEIKELMYALHKTGTSGIKLDLIDDIEKYETKFKNEAEYEKNEECDE
1128 :     LCPWCKGIFEPENIEKVAENVVEALSEYEFDSFLVGTKLPKRFKELENEIETPFMESIRQ
1129 :     EFGRELGKVVVPLIKRRVDKENPDIVVMVNPYNQKVTLQVNPVFIKGRYKKLVRGIPQSH
1130 :     WDCRSCRGKGCEKCNFTGKQYMTSVEEIIAEPFMDVMKGSSEALHGAGREDIDVRMLGHG
1131 :     RPFVIEIKEPKIRKVNLEELASKVNESGNVEIINVEYGVKKDVHFFKNEPHKKTYLAHVE
1132 :     CEEKVSNEEVAELVKKLEDLTIDQRTPDRVSHRRADLVRVRKVYKAWPHMIDDYNFELKI
1133 :     FCDGGLYIKELINSDEGRTTPSVSELLNKKCICKFLDVLDVHDYEDAENI
1134 :     >45357658 hypothetical protein MMP0095 [Methanococcus maripaludis S2]
1135 :     MIINADLHIHSKYSMGTSKYMDIEHILKYGPVKGLDLIATGDCLHAKWLEEIEKYADKPL
1136 :     LLSTEVEDRNRVHHLIYLPHTSQAHDLRDKFSKYSKNIDADGRPRVSLNGMEIIDAVRDI
1137 :     GGLIGPAHAFTPWTSIYKSFTSIYNCYARKPDFIELGLSADTDMADMVKELRDLPFLSNS
1138 :     DAHSFYSHRLGREFNQMDVDELGGLETNFEEVKKVLKHNKITANYGLDPNLGKYHLTACT
1139 :     RCYTRFTLEDATENNFKCPECKGTIKRGVHDKTLELSKDKKVIHPDFRPKYHKIIPLAEI
1140 :     ISLAIGKNIGTKSVDTIWEQYIEKYGNEIDVLINEDISELKKINEHVGKIIELFRTDKIY
1141 :     IYPGGGGEYGHISKVPVTVKWYKPTLTLDSWVKK
1142 :     >45357659 putative transcriptional regulator, GntR family [Methanococcus maripaludis S2]
1143 :     MALSYSKRMENIKSSEIREILKVTQKPEIISFAGGLPAPELFPVKEIKEISGIVLDEMGP
1144 :     ESLQYDITEGYPPLRQQISERMNKVLKTELTENNILIVCGSQQGLDFSGKVFLDENDVVL
1145 :     CESPTYLGAINAFKSYEPQFKEVPTDDFGMIPEELEKILKTTKNVKLIYAIPDFQNPTGK
1146 :     TWTLERREKFMKIIEKYEIPVVEDNPYGELRFDGEILPSLKSMDKKGLIIHLGTFSKTFC
1147 :     PGLRVGWIAASEDILEKYIFIKQSADLHTSSFSQRIISKMLENYDFDERVSRLKELYKGR
1148 :     RDLMIKTIAEEFPDGLKYTNPEGGLFTWVELPEKYNAREFLDECIKNNVAIVPGGSFFPN
1149 :     GGHENSFRLNYSNMPDEKIVEGIKRLSKVLKEYLN
1150 :     >45357660 transcriptional regulator [Methanococcus maripaludis S2]
1151 :     MKDLNKAISKNLKKIRKKKDLSLDALSNLTGVSKSMLGQIERGEVNPTISTILKISNGLK
1152 :     VSFTSLLKNEKPEIDQIPFEELNPVFEGEGHKLYPVIPFEDDKRFETYIVEIKPGHKYYS
1153 :     EGHVKGTEEIITVFEGELLISIGEIDYFLKKNDTIRFNANKSHVYENRGLKLTKLNLILH
1154 :     YE
1155 :     >45357661 ferredoxin [Methanococcus maripaludis S2]
1156 :     MVYKVNEDECIACGACVPVCPVQAISENADGKAVIDCAKCNDCGDCSDVCPVECIKQEKT
1157 :     CGCCQ
1158 :     >45357662 major facilitator transporter [Methanococcus maripaludis S2]
1159 :     MKEEMKGIYVLWITIFVTMLGIGLISPLLAIFAKSYGLSNFQIGLIFGSFALVRTIFQLP
1160 :     AGTLSDSYGKKVFLVGGTLLYGVTTLFYGFASGFASILIVRTFTGVFSAFVNPVAGSYIA
1161 :     QTSPKSKLGEYMGLFNSAISLGFGVGPLLGGLLADMYGFMVPFYVGGLLGIIASIIAYFK
1162 :     LEDTPKTQEKQKLSWKNLFSLEFLKMRNFSAAFIINIALTISRGAILAYLAIYAYDYGVS
1163 :     AFKIGVMLAAMNLVLAVTQKMFGRIFDEKGNRIILHGIIIGNLGMFILAMSTSFTTMFIS
1164 :     LIISSIGASMSTPGINSIAIRDIPDKRQGEAMGLYTASINVGIFFGAVLLGYISDIVGIS
1165 :     NMYKIGAVFSFLISYIAYIAIKK
1166 :     >45357663 Na(+)/H(+) exchanger family protein [Methanococcus maripaludis S2]
1167 :     MDISWVLFTIGIAIIFGKLGDHLMNKLGFPGVLGEMIMGMILGNLVYFGLVSPDHLTIQN
1168 :     NEIFDFLSRLGIIFLLFLGGLDTDLSVLKKTGKIATVSTVFGVLVPLVMGYLALQYMGYT
1169 :     AAESFAGGVVLTATSIGITVRVMMDMGVLKSEVGAASLSASIMDDFLGIMLIIFAVGTGS
1170 :     ILGLLGKFAIFFIITGFLAMKLVNKFISFSEKLHVEKGILSLAIAVMFLFSFLAENWFEA
1171 :     AIEGSFMAGLVLSRTAEGKNLIEDVKTIGYSILIPLFFVYTGASLNLTIFGDFDALYLAL
1172 :     VLTAIAIVSKVVGRGFGARIMGWNMKKSLQMGIGSIPRAEIALINLMVAIHAGVISESNV
1173 :     GKFIAATMIFITISIISTPPLLKWAFTEEVEN
1174 :     >45357664 hypothetical protein MMP0101 [Methanococcus maripaludis S2]
1175 :     MENLENALGKYHNIKLKHVIPPVDMMPVVCYNDPIIKVMELLRSRHHVWVINCKEEGSLL
1176 :     GVIKYLSVIDFLLPPDKHNLYIGSTRSALKSVIGGAKTAKEVMEKNALTINHNSTVIDAL
1177 :     LKMKRYNVQILAVLNDEERLIGEISLKILIDKFLSLCLAQE
1178 :     >45357665 protein-L-isoaspartate O-methyltransferase [Methanococcus maripaludis S2]
1179 :     MPLNEIIPVIENLISRGYIKKQSVIDAILSVPRHKFISKSMESYAYVDSPLEIGYGQTIS
1180 :     AIHMVGIMCEELDLDEGQNVLEVGTGSGYHAAVVSKIVGESGKVTTIERIPELFENSKKT
1181 :     LSELGYNNVEVVLGDGTKGYLENAPYDRIYVTASGPDVPKALFKQLNDGGILLAPVGAHF
1182 :     QTLMRYTKINGSISEEKLLEVAFVPLIGENGF
1183 :     >45357666 pyridoxine biosynthesis protein [Methanococcus maripaludis S2]
1184 :     MKKLGTDLLKRGFAKMVKHGVVMDVTNVEQALIAEEAGATAVMALERVPADIRVQGGVAR
1185 :     MSDPEMILEIKDAVSIPVMAKARIGHYVEAQVLESIGVDMVDESEVLTPADEVNHIDKRA
1186 :     FTAPFVCGARNLGEALRRIDEGAAMIRTKGEAGTGNVVEAVKHMRAVNEGIARVIGYKEM
1187 :     GLEAELIQMARNELKVPMELISEVAELKRLPVVNFAAGGIATPADAALMMQMGCDGVFVG
1188 :     SGIFKSGNPAVRAKAIVEATYNFDKPEVIAEVSKNLGEAMVGINIDEIPEEMLLAKRGI
1189 :     >45357667 polyferredoxin [Methanococcus maripaludis S2]
1190 :     MSHEGEEFNKIFSKGKFLKNIFFNLFRSYKNPEVIGETTNPELDDCICCGLCVDVCPTNA
1191 :     ISVFKFRDIICEHCGACLNVCPVDAIEKNRFSVDPEKCIKCGVCSIFCTIPILKNEIPVL
1192 :     NVPEVTTECNNCKLCIQKCPQKAISFEDGKISINSKCNLCLKCVEFCPLNALKSPKESLK
1193 :     SKIIKVDLNSCIFCKDCEEICPVKK
1194 :     >45357668 hypothetical protein MMP0105 [Methanococcus maripaludis S2]
1195 :     MFSIGLNVFGTYLESIYLFPLYLDSIGTIFSAIILGPHIGALVGLITNLITGCLLSGENF
1196 :     LFSVVNVLIGLTTGIMLYKNQINIKNIFLAAIVVSIVSSIMGNLLSIYFFGGITEGGVGH
1197 :     ITQTLTAFGESIPTAAFAAGLYTNFADKIISFTAAFFMIYVLQDKLSIYDLKLGN
1198 :     >45357669 hypothetical protein MMP0106 [Methanococcus maripaludis S2]
1199 :     MDKKVLYMTTIPVGIAINAIGGQIATFLKLPIFLDSIGTVLSGFLLGPVGGALVGFFTNI
1200 :     LLGFILDPSYIPFSIVNIVIGLVSGYVAVKHGITLKNSVIVGLVLAIIAPMVGTPIAVYL
1201 :     YGGLVGGGVDLLTAVFLHSGQDIFSSAFLARIPANLVDKLLSCILVYYIIKPFPKDILSE
1202 :     LGVKVN
1203 :     >45357670 hypothetical protein MMP0107 [Methanococcus maripaludis S2]
1204 :     MKYLKIKIYLIFTLFLLVLVIFNPFYGILAPIVVVLLTKRFEVFSKRWILFSLYLVVFYY
1205 :     FIMGQDGLNNAYRLLAYIFTVQWFINSVSIEKLVEFISSYNRDLGIGIWMTFSTLEVAKR
1206 :     EFETTKNAQLSRGLNKKGLINKYRSYYAIISPLIVKLYISAINRARSLLSKCYD
1207 :     >45357671 ABC-type Iron(III)-binding periplasmic protein precursor [Methanococcus maripaludis S2]
1208 :     MKNLKGILAIFCVMAVLVFAGCTEQQASNVSQEEQIVTVYVAYGSLDLIADEFEKDTGIK
1209 :     MEYVSLSSGEALSRLKAEQSNPSADVWLGGGIDAFISAQQDGLLEAYKSPNAKDIDPLFV
1210 :     EEDGYWTGVSLVTIGILENTDLLSEKGLPEPQTWDDLITDDYKGELIASNPTVSGTAYFT
1211 :     ICGILQMYGEDEGWNYLDKFYQNTPFLTKRGSGPGNLVTAGEYAYGVAPDPHTTVIADSE
1212 :     LPVKSVFLNKVIWWPSPVSIVSGAKHPENAKIFVDWCLSKEGQEVLMQASPRVPVRGDIE
1213 :     VIEGVPNPKDLDFLDMDFMYWGENRDRILDEWESRYREISTTE
1214 :     >45357672 ABC-type transporter permease protein [Methanococcus maripaludis S2]
1215 :     MKEVFNNEILKKIYPKILANVFLLIFIIYPVFTVFLQSFYGSNGFTLDAYSKFISDSYYF
1216 :     GILKNSIVVACFSTIISIFLGFLFSIIIFKTDFKFKNFFKIAVFLPIITPGFISSLAYVF
1217 :     LFGRHGAVTYGLLGLEPNIYGWKSVVIMQSIDYTTTAFFIISAVLLGISGEFEDAARNLG
1218 :     SNEFQVFKKVTFPLLIPGILSAGLLIFMQSMADFGTPIIVGGNFNTLATASYFEIIGRYN
1219 :     TQMASTLSVILLFPSMALFYLYSKYHKGYELKKSKITKYSLSNIQKVILGIPAVFFSIIA
1220 :     YLLFFAVFVASFTKSFGHNYALTLDYFYEAISAGQLAIKNTLIYAMSSSILVAFLGVAYS
1221 :     YIVYRGKFFGRKLMDLVITLPFAIPGTFMGLGYLLAFNNYPLLLTGTSSIIILNCMVRKL
1222 :     PFSFKTGNSVLSQVEESVEEASLNLGASRLKTFYNVVLPLLKPAIIFSMIYTFIATIKSL
1223 :     GSIIFLMTANTKVLSAMVFESTINRQLGVGACYSMFMVILSIIGILGILRLKGDKKWI
1224 :     >45357673 ABC transporter:AAA ATPase [Methanococcus maripaludis S2]
1225 :     MDLRLENISKNFEKHGVLTDIDFECGEELVSLVGSSGCGKTTCLRIIAGFEKPDAGKIFL
1226 :     NGEDITNVPPNKRNIGLVFQNYALFPHLNVFENIAYGLKLKKFSNLDISKKVKNSIDLVN
1227 :     LGGYEKYPISELSGGMQQRVAIARAIVIEPKAMLLDEPLSNLDAKLRIKMRKELKELQRN
1228 :     FEIPTIYVTHDQEEALAISDKVAVMNRGKIEQFGDPYSIYSNPKTEFVAKFIGIINEIPL
1229 :     SILNELDIESGDKKYFVRPESIEIGKGNFKGKLVDYEFLGSIIRYVIKYGDSLFTIQSNK
1230 :     LVDFKLGTEILFEFDKNSIISI
1231 :     >45357674 hypothetical protein MMP0111 [Methanococcus maripaludis S2]
1232 :     MPNLYSHLVLSKIFLEKERLNVNENLDMNNFYFGACVPDIGYFSGIERKITHFYESNPED
1233 :     LFENRTFFEKSFLKGYKLHIHLDNIWKYEIRLKNNISIEKNAKIYNYFDSFLENRFDVKI
1234 :     DSFKSYIFKGECKFLKKLNIEEDTCKNWKKTAFYTVSDFQLNEKYQKIIDSYLKILKIS
1235 :     >45357675 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 [Methanococcus maripaludis S2]
1236 :     MRTLLLLLDGLGDRPSEVLKDKTPLEYAKTPNLDAFAKKSVTGMMTPYKKGVPLGTEVAH
1237 :     FLLWGYKLSEFPGRGVIEALGEDIKLKDNSIYLRATFGYVKRNNGFFVKDRRTKNISIEE
1238 :     IKQLINSLPKKIGDYEFNLHYSFDTHCILEIRSSNYEISDKISDSDPFYRERHVLKVKPL
1239 :     KNISERIEIENAVKTAEVLNKYLLKCSEILENHPVNIKRKEKNLQLANFLLTKWAGRYRE
1240 :     IDSFHDKWGMNAAIIAKSSVFKGLSKLLKMDYYPEGDFQKAFLKGIELKNYDFVHIHTKE
1241 :     PDEAGHTKNPINKVEVIEKIDKCLKKINELNDELIIVTADHSTPSVGTLIHSGEDVPLAI
1242 :     FKNGIIKDRVEYFNEKECSKGYINIKSKDLMNLILNDTNKTRPYTTRIGNKLLNYIPENK
1243 :     SIEHLK
1244 :     >45357676 hypothetical protein MMP0113 [Methanococcus maripaludis S2]
1245 :     MDIEFKKSFKELTLSKDSLKIIEENGIDLKKIAVGEFSGRDSAAAIIKAFEDEDIDAVLP
1246 :     VLAFTGTDYGEKEIFYRNWNVINKKIKETHENKFLLPLHFIFEPKLWNALNGRFIAHTIQ
1247 :     KYGYYTPCIGCHAYLRMIRIPLAKHLGKKIISGERILHDKDFKIDQFKETLETYYKICDE
1248 :     FDVELCLPVKDIEKGSEIKEIIGEPWEQGKNQYSCMFSGNYRDLDGKVIFEREKIVKILN
1249 :     EFIYPSSIEILKNGYKNNFNYIETVKKFL
1250 :     >45357677 xylose isomerase domain protein TIM barrel [Methanococcus maripaludis S2]
1251 :     MRFSKPEKGLEYTDWGLHFCSNIDENFKKGLNGFHAPIVDIGTPNNKKGLETLKNIVNKL
1252 :     DNADYLTIHLHNGKEPEYNTLLENVSELTEYSKEKNITLCIENLRNGFSSKPENIINVAE
1253 :     ETGCKITFDIGHTPYENRMNCIDLFSDKIYNVHTYEKECDKIGHVAPKDLTNLKPVLDGL
1254 :     LNVGCDFWLIELMDVEEIINTKNMLNKYLEFHK
1255 :     >45357678 nitroreductase [Methanococcus maripaludis S2]
1256 :     MNAIFERRSIRHYTSEDVSEEIVDDLLKAAMSAPSACDQRPWDFVVIRDKNTLSGISKIN
1257 :     RHARMLNEAPVSIVVCGNMDRVNGSCGQFWVQDCAAATENILIEAQDRGIGAVWLGFYPV
1258 :     DERVEKMRKVLHAPENVVPFSVVALGNPAEKPVPVEKFDRERIHYEKWPTGYL
1259 :     >45357679 N-acetyl-gamma-glutamyl-phosphate reductase [Methanococcus maripaludis S2]
1260 :     MKTVSIIGGTGYTGSELLRLLSNHDEVEVVNVTSRKEAGKNLTDYHPQVRNLSNYNDLKF
1261 :     QNIAPEDIDSDIVFCATPHGASMAIVPTLHEKGINVIDLSGDYRFEDIDMYESWYGLKHS
1262 :     GKIDSAVYGLPELHREKIKKSKTIANPGCYPTGAILSMAPLVANDLVEDRIIFDSKSGVS
1263 :     GAGVEASQTTHFANVNENIGPYKITKHRHSPEIGKELQYLANKNLKVSFTPHLLPVTRGI
1264 :     LTTAHSFLKEDISPIDVIEIYEEFYKDEFFIRIFEEGMPSLTGVRGTNFCDIGGFEIDQY
1265 :     GRIVVVSAIDNLVKGASGQAIQNMNIIMGFDEKEGLGVGGLKP
1266 :     >45357680 hypothetical protein MMP0117 [Methanococcus maripaludis S2]
1267 :     MLAALIPVSPLSNVKSRLKDFLSSGERIELIKNILLDTYETVKECADACYVVSKDEEILE
1268 :     FSKNLGIIPIREDSNVKGLNEAINFSLNFIKEESILITPADVPLLKEVNLKAITSKSVKN
1269 :     SIVICPSRGGGTNLLLLNPKNCMKTQFEGFSFLKHIEEAEKNDLKVIKCHSFYTSIDVNT
1270 :     VEDLGEIYIHGTDTKTYAYLKSLGVDVLPKHSSAGRFNVIRK
1271 :     >45357681 beta-lactamase domain protein [Methanococcus maripaludis S2]
1272 :     MIYKLNGRGYDSNSYLIVDKKVILIDPGTPGTFEFLKKDILKYTYKIDYIINTHCHFDHA
1273 :     GSDYLFQDEFNAPVLIHELELPHLAEDSNVTVSKLFGMDLVPPKEIFTIKEADSDLKEIG
1274 :     IEIIHTPGHTAGGISIIYKDSLITGDTLFSYGVGRSDLPTGSLIELRESINLLEKIAYKK
1275 :     GILKIYPGHGEAGDLSAFSNAMLFI
1276 :     >45357682 biotin--acetyl-CoA-carboxylase ligase [Methanococcus maripaludis S2]
1277 :     MWLKLDFEIISHKNIDSTNTYAYNLGKLGKKNKIVVSETQNRGKGRLDRSWFSKKGGIYF
1278 :     SVLIGIEDIGKLEKINFLGSLCIIETLKSFSDQKFEIKWPNDVLFENKKICGILTELNVS
1279 :     KGYLVLGIGLNINNEIDPEIKNIATSLKEIENVEFNVDLILKKFIDIFVKNLKIDDELLL
1280 :     ESYKKCSKTLFNDVNLIMHEKTVTGKVVDISYDGIHIDTGKIVEVFNVGDCIHLR
1281 :     >45357683 hypothetical protein MMP0120 [Methanococcus maripaludis S2]
1282 :     MRIPAKKIPINEITSGEFVETEGQWESNYIVTKTSKQVSRVAIYGIIVSKYTNTAKEFCS
1283 :     VTVEDLTGDIRVSGFKGMAKKLETFKKGDVVLVVGRLRKDLKENIYVFPEIVREVEADEF
1284 :     FLNVFENY
1285 :     >45357684 hypothetical protein MMP0121 [Methanococcus maripaludis S2]
1286 :     MYNLQKIGEIDQSLIENKIAIIGTVIGLENDENYDKLEIEDASGKIIISKDKSVKLTTGS
1287 :     RILAFGTLKITPKGLIIFSEAIVDISESSPKLLGKFMEKIKNYEI
1288 :     >45357685 hypothetical protein MMP0122 [Methanococcus maripaludis S2]
1289 :     MLQKDPCLDDILENSEKLENNSNKKNIDSIDTIKLSDIIEKMIEINSIVRIEKIFEEKIV
1290 :     SQNPVVNVVVNDGSARGLLSLWSEQISLLNELNEGDAILIENAHAPKKYKDRIHLALSKS
1291 :     GKISKIESDLPTIDELLKKSSAQRNDFSRKSISELKEGIGAELRGLIVAIHSKEPYFPVC
1292 :     DKCNKKMTLKKGYAVCKCGNKVDEEDENLKWLFLCTCTLDDGSGTIRVTLNNNTNYLDLE
1293 :     ELKKIIIDDEEILDVLNNKLLGLDILTSGFTIYDEYLKDTAFRCNNWNKIDIMEEFNKKL
1294 :     KG
1295 :     >45357686 phosphoribosylglycinamide formyltransferase 2 [Methanococcus maripaludis S2]
1296 :     MVGTPLFSNAKKILLLGSGELGKEVIIEAQRFGVECIAVDSYENAPAMQVAHKYHIIDMK
1297 :     DAGALRAVIEKEKPDLIVPEIEAINTDTLKEMESEGYHVVPTANATKLTMDREGIRRLAF
1298 :     EKLGLRTAKYEFAENLEELKEAVTRIGIPCIIKPIMSSSGKGQSTIKSESDIKTAWNYAK
1299 :     SAARGIGTKVIVEEFIKFDYEITLLTARTAEGTRFCEPIGHIQVDGDYHESWQPHPMCAP
1300 :     TKAKAQEMAKKITDELGGYGIFGVELFVLDDEVIFSEVSPRPHDTGMVTMVTQKMSEFEI
1301 :     HARAILGLPVNVDIVSPGASHVIKSEILKWAPEYEIHEASKVKDTKIRLFGKPIAKVGRR
1302 :     MGVALAVSDDVIKAREHAEKVAHLVKIK
1303 :     >45357687 membrane-bound metal-dependent hydrolase [Methanococcus maripaludis S2]
1304 :     MNWKGHITLGILMGLPFISSPEQIFLLVAGALYPDLDHDVKSEIVQRGLYISGGLILVSI
1305 :     LAYLFRPEYFNTGFFIAAILSGVIYITPYYAEHRGITHTFLSLGVMSIILGYLTFKLSVI
1306 :     SPIMASLIALIMVTNNKLLGKSVAISVFAWVLYNMISTSFTTFQGLEFYIIPIAIGYLSH
1307 :     LVGDCMTPMGCRTLYPLNYTFHKKEGYFAIAIWVLLVFYVIKLA
1308 :     >45357688 fibrillarin-like protein [Methanococcus maripaludis S2]
1309 :     MKELIKNSLNDLDSAMELRELVINKINNQKLTESDIIEIVDTVDDLSFEDTQKLGSIFRR
1310 :     FPLGCDLLEIGVGPCSSSLTLPQFIENCVFTDHMGFPIHLCGYALADIAEKEGLTPIEVM
1311 :     NEVYNNVEVPLDLDHFGRFGPMRFPKEISHCMGDCYYNGPPYKGCPRDRIHKRLITKERE
1312 :     YSNEFGEWIKKSATVCVNVVEEQGGGDHGADISEMEDVAKAAQKFGRGVEGIFHIGDGYE
1313 :     DLITGLKACNDLDVDVLVIEGGPFNRSKDRLKDFAKSVAVSRILVKGGVVATNGAYEDEC
1314 :     RVGLRSGLNVILSGFSGNHHGYMCGYNIKEARRNNFGLPRVLKIMKEEAEKINICIANRE
1315 :     LLKVLARSSRFLNHNENHLVYPSMIGDYFIGDAHWVSITNSKMYNAPYFGKTLDSLEEEL
1316 :     NCDKVGVLGGRYISWGIADALKPEELYVSDVDPWVEHATVKILNDNGINAYACNGNDKKA
1317 :     LESAEKSVITTMIPEIVLRIKNKFDAVSLL
1318 :     >45357689 biotin synthase [Methanococcus maripaludis S2]
1319 :     MIFSKIRGNFQDLKDGKIDVKQGLITKSDAIELFNIKNWKDYLELFSIASEVRDVFKTEI
1320 :     EITSTVHVTNICSVNPKCKYCGFAAGTSSEGYVKPFRSDDDQIKSSSVAIENSGIKRVSC
1321 :     SSGHGYNGKEVIRALKAVKSASNLEVLVNAGADLTEECILELKKYKIDTICCNLETTNKT
1322 :     VFNNVKPGENLEDRINVCKMVKKHGVELSSGLLIGIGETYEDRVEHLFFLKELDVEEIPI
1323 :     MGFNPYKETPMETCPKCSAIEQAKTIAIVRLLFPDIRITSPTPTMGPELSQFALLGGASN
1324 :     IATVIPDNHPMNIKGVGNPKTGNLKDVICMIKELGLTPKLN
1325 :     >45357690 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase [Methanococcus maripaludis S2]
1326 :     MKVAILGAGCYRTHAASGITNFSRASQVAKEAGIPEIAMTHSTITMGAELLHLIPEITEV
1327 :     VVSDPCFAEEPGMVVLDQFDYKAVMEAHLAGDAEKVMPEIREAVKAKAKETPKPPKGCIH
1328 :     FVHPETVGLKVTASDVEAVKDADIVITWLPKGGSQPAIIEKFASEIKKGAIVTHACTIPT
1329 :     PKFAKIFKDLGRDDLNIIAYHPGAVPEMKGQAFLSEGLADAEKVEEFYCMAKTARGEAFK
1330 :     MPANLISPVCDMGSAVTAPVYAAILAYRDAVTQILGAPADFAQMMADEAISQILDLMRNE
1331 :     GIKNMEDKLNPKALTGTADSMCFGPLADILPASLKVLEKHANENKCECGCSIKP
1332 :     >45357691 cyclase family protein [Methanococcus maripaludis S2]
1333 :     MVEERIINLSHEIKNFVYPNDPEFIVKTKKNGKYSVSELNMGVHTGTHIDYPMHVGLTNE
1334 :     KFENVFGKGYCVSLENMNDFFKNAPKNLEILLIKTDFSKYWEDPEYFEKECDIENHVEKL
1335 :     ISMNLKAVGIDCCSIGNFSVHEKLLSSKIKIIENMKNLEILENKTFKFFGFPLNIEKIDG
1336 :     SPINAVAFL
1337 :     >45357692 hypothetical protein MMP0129 [Methanococcus maripaludis S2]
1338 :     MRYDFHTHTVFSDGELIPSELIRRASVLEHRAVGITDHADASNYKDLIEKNTLAKEELSN
1339 :     YMDDIEIVVGVELTHIPPKSIPKMAKKCKNEGAEIVVVHGETPVEPVAEKTNYYASISED
1340 :     VDILAHPGLIDIETAQNALENNIFFEITSRKGHSLTNGHVVSVARELKIPMVINTDTHAP
1341 :     SDLITYEFARKVGLGAGMSFRELENSLTTNPLEILKRI
1342 :     >45357693 fumarate hydratase [Methanococcus maripaludis S2]
1343 :     MSNISEIVVELFKEASIYLPDDVKSKLKHAEEVECGACKDTLQAIELNNKIAETKQIPLC
1344 :     QDTGVPVIFLKIGTGISSERIIEIIKEIESGVKRATAEVPLRPNVVNPITRENLGTNTGM
1345 :     GAPFINFEFSENLNNEIEISVFPKGAGSENMSALKMLTPSEGLMGIKKFILETVANAGGK
1346 :     PCPPIVLGIGIGGTADISLKLAKKALLRDIGNRNPEKTIENLEKELLDSINQLGIGTMGL
1347 :     GGKITALDVFIEVNGCHTASLPVGICIQCWADRKAKRKIKL
1348 :     >45357694 L-tyrosine decarboxylase [Methanococcus maripaludis S2]
1349 :     MDEQDILNELREYRNQDLKYEEGYILGSMCTKPHPMARKISEMFFETNLGDPGLFKGTSK
1350 :     LEKEVVSMIGGILHNKNAFGYLISGGTEANLTAMRAFKNISKSKGKPQNIIIPETAHFSF
1351 :     DKAKDMMDLNVVRPPLTKYFTMDVKFIKDYIEDSKNEVSGIVGIAGCTELGSIDNICELS
1352 :     KIAVENDILLHVDAAFGGFVIPFLDDKYKLDGYNYDFDFSLNGVSSITIDPHKMGLAPIS
1353 :     AGGILFRDNMFKKYLDVDAPYLTEKQQATIIGTRSGVGVASTWGIMKLLGIDGYETLVNE
1354 :     SMEKTMYLVKKAREYGFETAIDPVMNIVALNDENKHDTCMKLRDENWYVSVCRCVDALRI
1355 :     VVMPHLEIEHIDGFLESLSNTKKY
1356 :     >45357695 branched-chain amino acid aminotransferase [Methanococcus maripaludis S2]
1357 :     MKIYLDGNFVEKEDAKVSVYDHGLLYGDGVFEGIRAYDGVVFKLEEHIERLYDSADSIAM
1358 :     KIPASKVEMEEIVIETLKSNNLKDAYIRLVVTRGVGDLGLDPRKCPKATIFCIAENMKPL
1359 :     LGEDGIKVITSSIRRLPVDVLNPAVKSLNYLNSILAKIQANYAGVDEAFLLDSEGYVAEG
1360 :     TGDNVFVIKNGKIKTPPLSSSVLKGITRDTVVDLAKEAGYTIIEEKMTLHDLFVADEIFI
1361 :     TGTAAELIHVVEIDGRIINNGKLGPVTKDLSDRFKEIRSKIGKKYIE
1362 :     >45357696 inosine-5'-monophosphate dehydrogenase [Methanococcus maripaludis S2]
1363 :     MVVILFLDKIVSAQRAYTFDDVLLVPNKSFVDPKTTDVSVDIAGLKLNIPIISAAMDTVS
1364 :     EKDLAIALARRGGIAVIHRNMTVEEQLKHVKAVKMAENLVIRDVVTVEPSSSVLDAERIM
1365 :     YEYNVSGLPVVSENKTLVGILTTRDLKFVPDKNVAVETVMTKEVLHVHEDTPYEEILNRL
1366 :     YENKIERLPILDKNTKELLGMVTLRDILKRKKYPDAARDSDGKLVVAAACGPSDFERAEA
1367 :     LVLAGVDAVAIDCAHAHNMQVVENVKKLKEILKGTKTKLFVGNIATGEAAEDLIKAGADA
1368 :     LKVGIGPGSICTTRVVAGVGVPQLTAVAEVAEVAKKYGVPVIADGGIKYSGDIAKAIAAG
1369 :     ANAVMVGSLLAGTEEAPGSLMTINGRKYKQYRGMGSLGAMCGSSGNVADRYFQSGHMKHS
1370 :     KLVPEGIEGAVPYKGPTSDIVYQLIGGLRSSMGYCGAQNLSEMHEKARFVIITQSGQKES
1371 :     HPHDVLITNEAPNYPINAER
1372 :     >45357697 hypothetical protein MMP0134 [Methanococcus maripaludis S2]
1373 :     MDEISMASKELAKGAKMLGKHCSSCGFPMFEKDGLEYCPNCSTSEIEIKGDSKESEKQLK
1374 :     KINENNISKNDDKLRIINRKIEYLFSKLDSEEEIGRIHEITSSIKTLIKIKKYL
1375 :     >45357698 threonine synthase [Methanococcus maripaludis S2]
1376 :     MIQKCRVCGKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLP
1377 :     VKDPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRGMTVGVTRANEL
1378 :     GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
1379 :     EALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
1380 :     IWKGFKEFKETEMIDRLPKMTGIQAEGAQPIVKAIKEGLDEIVPDENPETIATAIRIGNP
1381 :     VNAAKALDAIKSSGGLAESVNDEEIIEAQKLLAQTEGIFVEPASASSIAGLIKLINMGLI
1382 :     DKDQKIVCITTGNGLKDPDAAIKASKMPTEIECDMEVLRKAIEE
1383 :     >45357699 3-isopropylmalate dehydratase, small subunit [Methanococcus maripaludis S2]
1384 :     MKKTVEGKAWVFGDNIDTDAILPARYLVYTTEEQLAKYAMTGTDPEFPEKATVGDIIVGG
1385 :     KNFGCGSSREHAPIGLKGLGISMVIAESFARIFYRNSINIGFPLLECKDISKHVKEGDVL
1386 :     RVDLDKGTVKNVTTGVELTGQNLPDFMMEILNNGGLMPHLKKKISKA
1387 :     >45357700 putative deoxyhypusine synthase [Methanococcus maripaludis S2]
1388 :     MIFMSDPKNVVFKESEELNGVFIEGPDFDETIDLKDVLTDYYEKIGFQATHLGKAVKIWK
1389 :     QIEEVRKNEEVVVFMGYTSNMVSSGLREIISYLVKHKKVDVLVTTAGGIEEDFIKCIKPF
1390 :     VLGEWDMAGSDLREKGINRIGNVYVPNDRYIEFETYMTKFFETLLKKQQDENKIISASEF
1391 :     CFELGRFMDENLGQEKEKSIIYWAYVNKIPIFCPAITDGSIGDMLYFFKKNEKGTDLKID
1392 :     VASDIVRLNDMAIDANKTACIVLGGSLPKHSIINANLFREGTDYAIYITTAVPWDGSLSG
1393 :     APPEEGVSWGKIQEKADFVEIWADATIVFPMLVYGVFK
1394 :     >45357701 formate dehydrogenase alpha subunit [Methanococcus maripaludis S2]
1395 :     MTEFKVVHTICPYCGTGCGIDLVVKDGKVVDSHPFKRHPVNEGKVCIKGNYCYEFVHSED
1396 :     RLTKPLIKKNGEFIEATWDEALDLIAGKLKQYSPDEVAFFSCARGTNEESYALQKFARTV
1397 :     LKTNNVDHCARIUHAPTVVGLGECFGSGAMTNSITDLAQADVLLIYGSNTFEAHPLIARS
1398 :     IVKAKENGTKIIAIDPRTTHTAKMADLHLKLIPGSNIDLINTITNIIIQEGMADEEFIKN
1399 :     RTEGYDELKDVVSKYTLEKTAELSGIPAETILEAARMYGSAENASIMYCLGVTEYTFGVD
1400 :     NVKSCCNLAMVTGNLGRPGTGVNPLRGQNNVQGACDMGALPNVFPGYQKVGEAYERLENL
1401 :     WETADLNREIGLTSPEVLHKAGEQVKFLHIVGEDPMVADADINHVEKALKSLDFFVVQDI
1402 :     FLTETAKLADVVLPAACWAEKDGTFTNSERRVQRIRKAVDAPGDALPDWLIVRKLAEKMG
1403 :     AGEKLNFESASEIFDEMAKVIPQYAGMSFERLGIDGLQWPCKTPEDPGTPILHKEKFLRP
1404 :     NGLGKFTPVEHKDADELIDEEYPLILTTGRIIFHYNSGTMTRRCDSITNEIDENFIEINT
1405 :     EDAKELGIKPGEKVRVSSRRGTVNADARVTENVIKGVVYMSFHFLEEATNKLTNSAYDPV
1406 :     SKTAELKICAVKVEKI
1407 :     >45357702 formate dehydrogenase beta subunit [Methanococcus maripaludis S2]
1408 :     MSYYLVQSTDEDILKHAECGGAVTAFFKYLLDKKLVDGVLALKKGEDVYDGLPYLVNDSK
1409 :     ELVETCGSLHCAPTMFGNMISKHLKDMNLAVSVKPCDAMAIVELEKRHQIDKDKLYTIGL
1410 :     NCGGTVPPQTAKKMIELFYDVDPEDVIKEEIDKGKFIIELKDGSEKSVKIDELEEEGYGR
1411 :     RTNCQRCELKVPRNSDLACGNWGTEKGWTFVEVGSEKGEELLKNAQKEGYINVKAPSEKA
1412 :     LEIRGKIEKSMINLGKKFQKEQLDEKYPEPEKWDEYWSRCIKCYGCRDVCPICFCKECAL
1413 :     GEDYLDKGTIPPDPIMFQGIRLSHMSFSCINCGQCEDVCPVEIPLAKIYHRAQLKIRETT
1414 :     GFVPGIDDSMPFLYK
1415 :     >45357703 (NiFe) hydrogenase maturation protein HypF [Methanococcus maripaludis S2]
1416 :     MTAKRIDVKGIVQGVGFRPFIYRIAKKNDLKGYVKNMGNYVEIVVSGKLNNIDAFLSDLK
1417 :     LEKPPLSKIDNISIEDIDENENLNEIYGDFTIKLSDTSKIEEEGTIPPDISICDECLKEI
1418 :     MDKKDRRSDYAFTACTNCGPRFTVIEKLPYDRENTSMKDFPLCKSCIEEYKNPEDRRFHA
1419 :     QATCCDICGPELFITDDSGKIISNDICDAVKFLEEGKILAIKGIGGTHLVCSINSDKSVL
1420 :     ELRKRLNRPTQAFAIMSREEYLDLFSKIDENELNMIKSPKKPIVALKKNELYEKYFSEHV
1421 :     SNLNTIGVMLPYSGLHYLLFENTDQIAYIMTSANLPGLPMSIDNEQILEKLENIADYFLL
1422 :     HNRKIVNRCDDSVLKEINGKMELLRRSRGFAPEPVEVNYKKIKNNSKNILALGPELNSVA
1423 :     CLVKNNKFYLTQYIGNTGKYETFNYLKDAVENLIKITNTNKIDAIVCDLHPSFNSTIFAK
1424 :     ELGEKYKIPVTQVQHHESHCHSLMGDSDIFENNVTIAIDGLGYGNDGNIWGGEVFLFKNG
1425 :     KIERAGHLEEQIQPGADLASKYPLRMLASILNKANLNVSEIIKGYNYFSEKELKLILFQL
1426 :     EKNINVSKTTSTGRVLDSISALVSLCFERTYDGEPSIRLEALANEYTGEISEIEKLVEES
1427 :     IKIENNILDTTSLVVKSLEMLNNNEKIEKIAYFIHIAIADGLSKIAIETAKKQSIEYIGI
1428 :     TGGVSYNKIISERIVENIKKESLKPLIHKRIPNGDGGISFGQAIGYLLNSN
1429 :     >45357704 hypothetical protein MMP0141 [Methanococcus maripaludis S2]
1430 :     MSNELFETLTSNIHFNVTEMGRKTWTQNWMVPENLITIVGLKNGKKPVFYYGLTENYRTN
1431 :     FVLKKGTSENGNKYINARVYFRFCKDTIVEKEKYVVANGFNGLLLGIKIGKTEFINTFKS
1432 :     MLLEEYRRGDAHTIEVLERMKDRNVFESVEESAQYIADRDYNWLIGRLKYKGKLFNYSGQ
1433 :     GYWLLPLKTQMELTKGFIEEDCDLTIDLENTEVFENYLIYVDTVNSVVRYNGERLCTSGY
1434 :     SLAEELKKHSDENTCPWCGEKLRLIKTKKGEFLGCSSYPKCLYRRFLNKK
1435 :     >45357705 thiamine pyrophosphate dependent enzyme related to acetolactate synthase [Methanococcus maripaludis S2]
1436 :     MKYLDFIIDFFENKGVKSVFAYPGEQILPIYRALHENSKINCIDVKHEQASAHAADGYFR
1437 :     ITNEVGICLATAGPGATNLTTGIATAFKDSSSVLALTGRCSTNYIGKNYFQEIPMDFLNF
1438 :     EKGYFIENPNYKYLINSYNESYNLKKPISVNIPADIYNQDVNELETDFNDKNTESIENAV
1439 :     STIKKYKDAKNPVLLMGQGIYGNLKYSEMVEIGEILKKLQIPIITTYPARGVVDENFENA
1440 :     YAMVGRRGSLNSNKLILKSDAVFSIGASLSYNTLPESIRDKILYNVIPLNLGINSTNDIK
1441 :     TIVNTFNENVSSGHVKPSGQNLSRNEFKFGDYSTKIHEILENLPKDTIITTDAGNHTVFV
1442 :     SLLKKCVAPRNIISSHSMGTMGFGLPASIGVKFGCNDYNINREVVSISGDGGFQMNIQEL
1443 :     GTVAENNLKILIVVMKNNHLNMFGKINTPDFNKIADAYGIENVYIQNSDEIGENVAYFLK
1444 :     KSIPYVMVVECENEKLPKPFI
1445 :     >45357706 hypothetical protein MMP0143 [Methanococcus maripaludis S2]
1446 :     MNVGIVVHGPEIIDSGFAEKIFAILKNLDENINLQMRLGGTIGRVAVIDNSLEDIIDISE
1447 :     KLVPSKSLKKLENNDILILLNYGKSKITGHTFGKIVVERSNVKKPVIQIERPGEADGTII
1448 :     LWNTTKYDEKLGNIVSEISDKLNLNVEECISKGLNFWVEGSKSFRKINGVDINESIMLNG
1449 :     IIIGRSSQNDVTIVSENGHIVDIIGGTVKWHGVEKLGNIDLEKVVVKTGLLRRHPSKNQK
1450 :     IAKYNLNSNLGEVLFVNHAGEDVLETIKNKKICAVITVGDDTTTICGDILSRFGVKIIGI
1451 :     TDGDRDDILKNPSILSGSVIFLIKNQKDDDVGELLERELDNSEKLGNFEKYVETIKQIMK
1452 :     KECIEFEEIIH
1453 :     >45357707 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase. [Methanococcus maripaludis S2]
1454 :     MDIKPSKIVCAGLNYKDHAEELKMKLPKEPVIFLKPTSSIIYNEEAIKIPKASERVDYEA
1455 :     ELAIVIGKTCKSVKKEDVKNYIKGFTILNDVTARDLQEKDGQWTRAKSFDTFSPIGPKIV
1456 :     SGIDANNLKIQLRVNGKIKQDSNTNNMIFSVEELVEFVSSIMTLYPGDIISTGTPPGIGK
1457 :     LEKGDIVEIEIENIGILKNFVE
1458 :     >45357708 adenine phosphoribosyltransferase [Methanococcus maripaludis S2]
1459 :     MSKLLEESLKTCPIVKRGEYHYFIHPISDGVPLVEPELLRDVSTRVIKMIDTDVDKIVTA
1460 :     EAMGIPIVTAVSIATDIPYVIMRKREYLLEGEIPVHQETGYSKGELYLNGINKGDKVIIL
1461 :     DDVISTGGTLVAIINALKRAGADIKDVLCIIDRGNGQNIVEEKTGYKVKTIVKIEVVDGK
1462 :     VNILE
1463 :     >45357709 hypothetical protein MMP0146 [Methanococcus maripaludis S2]
1464 :     MDIIVVGGGTSGLLSALALEKEGHNVIVFEKESYVGGLCRSEKIDGYSVDIGVHAITMLD
1465 :     NGPLIRLLNKYSRYLPNFRNYGDYYIRTDKLHRIPVSMHEWMTTPVIPNKDKVLITSKIM
1466 :     DLMTMGFTKDASVYDFVKEMGLSSTSVDFFNTIAYFLSGEDLENTPLWRFFTGAGYIPED
1467 :     DILPFIYKDMKINPLKSTLVKKFGTERIINILNDGFISSIKNGSKKYINKFMTEHRYSTQ
1468 :     GYPVGGVQSICNCITYSLRNTQIKNEEVKKITKNGKKYTVKTSEGEYTSDIIVYSAPAIT
1469 :     LPKVAKINKIQKNKEKLSNIKFTKSTTVWIGDEKNYFPYLGSEIWIDNPCWASTVSNYDE
1470 :     SLAPKGKHLMGFSFVNSKKEDALKTIESKLNLNTDKVDMLYVQETVPEQASCSIGQFFVY
1471 :     PKIDDTFFVVGTDSDPRSMGITRAAYSVEVMLSEFKNIYDTQKETAKK
1472 :     >45357710 nitrogenase reductase-like protein [Methanococcus maripaludis S2]
1473 :     MYYIVLLILRESFIFMLNGDILKQIAFYGKGGIGKSTTVCNLAAALSKSGKKVIVVGCDP
1474 :     KHDCTSNLRSGEDIPTVLDVLREKGIDKLGIETIIRENLLKKEDIIYEGFNGIYCVEAGG
1475 :     PKPGYGCAGRGVIVVIDLLKKMNVFEDLDVDVVLYDVLGDVVCGGFAMPLRMGLADQIYV
1476 :     VTSSDYMALYAANNICSGISQFVKRGGSTLGGIIYNVRGSMDAFDIVSEFANQLNANIIG
1477 :     KVPNSPIINEAEIDGQTAIEYAPEEEISKIYMELAESIYQNNTGTMPNPLENAQIMQIGK
1478 :     MIKERIKKQKITE
1479 :     >45357711 acetyl-CoA synthetase, AMP-forming [Methanococcus maripaludis S2]
1480 :     MKTGDKYIMLEKYSELQQKALDDPEKFWGEQAKCLEWDKTWDKALDWNPPYAKWFKGGSL
1481 :     NASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREVNKFANVLENLGVEKGDVV
1482 :     TIYMPMMTEAIIAMLACSRIGAIHNVVFSGFSSDALADRINDSKSKILVTTNLLYRRGKE
1483 :     IDLKKILDKALLNCNSIKHVVYAKRGIEEFNLVSGKEYFWDELMGGAKSYVEPVPVESEH
1484 :     PLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTWGLNEMDVFWCTADIGWITGHTYVV
1485 :     YGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGVTILYTAPTAIRMLMMYGEKWVNTHDL
1486 :     STLRLLGSVGEPINPRAWKWYYKVIGKEKCPICDCYWQTETGGHIIYPPIGIQSVPLKPG
1487 :     SATFPGIGIDVDVVDNEGNPVDANVKGNLIIKRPWPGMLAGLWNNDERYRAAYWDRFKNK
1488 :     FSTSDYAIKDQDGYIWVLGRSDEVLNVSGHRIGTAELEHELVSNKMVAESAVVGKPDDVK
1489 :     GEVPVAFVILNEKYRELPSNEVKAELIKHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRR
1490 :     ILKKLIMGEEIGDVTTLEDNTSLEEVKKELEDFKYD
1491 :     >45357712 putative RNA methylase [Methanococcus maripaludis S2]
1492 :     MNLKNTKAGFLLSAEHEKLPIAELNALIDIFSLEGNLNCFKNYVILDSSISEEIIKKMVK
1493 :     RGGYTNEGHVIFSESPIINQNVDETLENFFKSSETLDFPVERDETFAVRVLKLEKESPFN
1494 :     SMEIERKLGGIIKKKTSAQVSLKNPSKTVKVVISNDKMYTGIVIEKRDVEYFQNNRPHLR
1495 :     AYFHPGCIMPKLARCLVNLSRVKEGEIVLDPFCGTGGFLIEAGFLGCKLIGSDIDEQMVN
1496 :     GALLNLNTYDLSKQVISIKENDAKNVSKYLEALKIEKIDGIVTDPPYGISTSKKGDMLEI
1497 :     FEKIVDVLKDNDYLVFAAPNKMELDLNLVEFYEMRVHKSLTRYIHVYRKN
1498 :     >45357713 hypothetical protein MMP0150 [Methanococcus maripaludis S2]
1499 :     MKLFIYHEKQCDPKRCTALKMGRLGYAKIITNPNKVPRNSLLLNPYSEKSVSVEDREIIE
1500 :     KYGILGLDCSWKQAEIVFKKTNARNQRVLPFLIAGNPVNYGKPCKLTTLEAIVATLYIAN
1501 :     YKNEAVSLLNGFKWGNTFIDVNKELLEQYCGKTSDEIIRIQNEILNNMRNR
1502 :     >45357714 50S ribosomal protein L40e [Methanococcus maripaludis S2]
1503 :     MAFEEAIKRVFMKKICMKCNSRNSWKATKCRKCGYTNLRPKAKEARA
1504 :     >45357715 citrate transporter [Methanococcus maripaludis S2]
1505 :     MKKALILLVLAVFLIGFTKIAYVDEESADGINSQKAIITLIILGTAAVLFFTEALPLPVT
1506 :     AMLVPVALSFPGIDILSSSRAFADFGNKWVVLFMAAFILGEAVFRTGFADKIGQLTVKAA
1507 :     GKSQLKLMLLVMLAIGTMSAFLSNTGTTAAFIPIVMGICVSASLKPGKLLIPMAYAASLG
1508 :     GTLTLIGTPPNGLVNDALEKSGIAPFGFFEFAKIGILIFIVGILYYGTIGHKLLPESKAK
1509 :     AKDFVSDTLKYRTNKMWIATLVFTFVVLMTATGTIPLVTAFMLGACMVVMTGCITMQEAF
1510 :     NSISWTTIFLFAGMLPLGSAMAATGAATMIANTVITYVHSPLALLAAAYILTALITEVMS
1511 :     NTATAALVMPLGIALADAFDVSAKPILMAIAVAASSCFLTPIATPPNMIILGPGGYSFKD
1512 :     YAKSGWPLEILCAVVAIAVIPMIWPF
1513 :     >45357716 trans-homoaconitate synthase [Methanococcus maripaludis S2]
1514 :     MDWKAVSPYNPKLDLKDCYLYDTTLRDGEQTPGVCFAGDQKLEIAKKLDELKIKQIEAGF
1515 :     PIVSENERKAIKSITGEGLNAQILALSRVLKEDIDKAIECDVDGIITFIATSPMHLKYKL
1516 :     HKNLDEVEEMGMKAVEYAKDHGLFVAFSAEDATRTPLEDIIRIHKNAEEHGADRVHIADT
1517 :     LGCATPQAMYHICSELSKHLKKAHIGVHCHNDFGFAVINSIYGLIGGAKAVSTTVNGIGE
1518 :     RAGNAAIEEIAMALKVLYDHDMGLNTEILTEISKLVENYSKIKIPENKPLVGEMVFYHES
1519 :     GIHVDAVLENPLTYEPFLPEKIGQKRKIILGKHSGCRAVAHRLQELGLEASRDELWEIVK
1520 :     KTKETREDGTEISDEVFKNIAEKIIK
1521 :     >45357717 hypothetical protein MMP0154 [Methanococcus maripaludis S2]
1522 :     MNVLVNDKPKSGKTLKDVIKDEYYIPGSNIVIVKGTATVIKEETKKYMIKTTKGSFVVGI
1523 :     TEENKSVDFWNKNYKSFEKKSLIWKSISDVSFGSIEINLPVSSLKQNFKKWDVVLSVSGL
1524 :     DTSEGNLIFVQRDVTELYGLENPKIGILIGGKRVLKALTADDQIISIEKMRESKENIDYE
1525 :     VTTDLDKEIQDDWKIYTYCKAELNGPSKSTEHALAILENGTLEISEHTNTYVADCRLQTL
1526 :     LIDEENPENRDRGTITVRNVGNGVGKVYIYQENRASSLSHTVVGKVTDGIEIVDFSNSGQ
1527 :     ITVKTSPERLNLIGKTQKDAKLLFEKHGITLKMEGNTDDDAVIVEQVPEYTMDILKSKEV
1528 :     TTKGIEPEKLLYVEIFDKEAPTTAWYFRKTTGLTTKRIGTLKIYFKHDDISMFERNWDYS
1529 :     KGLLPENTPKGSVDSEIIAVTNMAKRYKGYMGVRTSSHDKYGPTGETFEGTNIVGKVVKN
1530 :     AEILKSVKQGENIYILEVNSN
1531 :     >45357718 hypothetical protein MMP0155 [Methanococcus maripaludis S2]
1532 :     MTENTEVKISSKAKKILRSQSHEIEPVVWVGKEGIEKTIEEIKRQIKDKSLIKIKVRKSA
1533 :     LENGDKAEMAEKISKETGAEVISVVGNVITIFKPKEGWKKYSTKKTKKEKYVEEFEEMRS
1534 :     KKALLKR
1535 :     >45357719 30S ribosomal protein S19e [Methanococcus maripaludis S2]
1536 :     MVTVYDVPANDLIAKLAEKLKEMGVEEPEWTNFVKTGAHKERRPDDGDWWYVRCAAILRK
1537 :     VYINGPVGVERLRSVYGGRKNRGCAPEKFVKGSGNIIRTAFQALEAKELLTKAEKGGRII
1538 :     APKGQSLVDNTAKEVADSVAQ
1539 :     >45357720 hypothetical protein MMP0157 [Methanococcus maripaludis S2]
1540 :     MNPEEIRQRRLQEMQAKAQAQGAANDPEAQRQMQEQQMQYEMQKQKILRQILSEEARSRL
1541 :     ARIKLAKPQFAEQVEMQLIQLAQAGKLPVPLTDEYFKGLLDKIYEMNRPAKKEITIMRK
1542 :     >45357721 hypothetical protein MMP0158 [Methanococcus maripaludis S2]
1543 :     MIHMAKAHVLFSGGKDSSLSAIILHNLGYDIQLVTVNFGVLDSYRHAEETAKIIGYPHKV
1544 :     ESMDRELIEKSVDMILKDGYPGNGIQFVHKQVLEIISEKYDVIADGTRRDDRVPRLDHSE
1545 :     IQSLEMRKNIQYVTPLMGFGHKTLRNLVNNYFIISEKESEELLKSDYETEIRELIRQRGI
1546 :     DPLEYFPKHIQSRVIGLKR
1547 :     >45357722 50S ribosomal protein L39e [Methanococcus maripaludis S2]
1548 :     MAGNKPLGKKIRLAKALKQNRRVPMFAIARTKGSVKQHPKMRHWRRKNLKK
1549 :     >45357723 coenzyme F390 synthetase [Methanococcus maripaludis S2]
1550 :     MIWSKEETWDRKEIEKIQLERLKESVKRAYENVPLYKEKFDSVGLKPEDIKSLDDLKKIP
1551 :     FTVKDDFRANYPFGMFAVPKKEVVRIHASSGTTGKPTVVGYTKKDIRTWAELISRVVTAA
1552 :     GVTDDDTAQIAFGYGLFTGGFGLHYGLENVGASVIPMSSGNTEKQIMLMKDFETTVLICT
1553 :     PSYALYIAEVAEKMGIDPKKDLKVRIGLFGGEACSESARTEIESKWGILATQNYGMSELM
1554 :     GPGVSGDCEYQCGMHISEDHFIAEIIDPKTGEVLPEGEIGELVITTLTKEALPVLRYRTK
1555 :     DMTSLTYEKCKCGRTTARMLKIRGRSDDMLIIRGVNVFPTQIESVLEGIEEIGPHYEIIV
1556 :     TKNGHLDQMTINIELADGKFLEKFSCLEQISKKVDHKLKTVLGLSSKINIVQPRTLERFE
1557 :     GKAKRVKDLRNVN
1558 :     >45357724 2-phosphosulfolactate phosphatase [Methanococcus maripaludis S2]
1559 :     MKISISFDFFGSSEIQKTVDFSDYCVIVIDVLRASATICTLLDLCDKIYITGSIEKAGDI
1560 :     ENSIKIGERNAKKIEGFDFGNSPVELTVNKNLIKEHFENGGNIVLTTTNGTRVLENIVSD
1561 :     HILIGSITNAKSVAKKAYKLAKENNKGIMLVPVHRKGNFAIEDFIGAGIIADYIFKEYDE
1562 :     KIPDEKFEELIPARMLTKSDWVRKIFESNSGKNLKELGYFEDLIFCTSKNTQKSVGIFDK
1563 :     KSGSISSF
1564 :     >45357725 hypothetical protein MMP0162 [Methanococcus maripaludis S2]
1565 :     MNFTDIGIFDYLGMILLILIVLAAILFVTAIGLGYYLINKNKILFPKLSLYITNNFYSIL
1566 :     LRIFLIIGTEDTFYKVASDFYNKYYCEDFKKAKNKVLILPHCLRDLKCPGKLGPDGVECV
1567 :     FCGKCPIGRVIKVAEENGYKTYVVPGSTFLKRVLKDKKPDGVFAVACHNDMFHGMTFLSR
1568 :     KNVPVQGQLLMKDGCISTLVDVEELISRLKNEPC
1569 :     >45357726 arsenite-activated ATPase ArsA [Methanococcus maripaludis S2]
1570 :     MVLSKIKESLKGITSKKLEKENGTKYIMFGGKGGVGKTTMSAATGIYCAEQGLKTVVVST
1571 :     DPAHSLKDSFEQSFGHEPTKVNGMENLYVVEIDPEVAMSEYKEKLKSQMDENPMMGGMLE
1572 :     DQLEMASLSPGTDESAAFDVFLKYMDNNEFDVVVFDTAPTGHTLRFLGLPELMDKYMTKM
1573 :     IKFKKQMSGFMNMMKKVMPFGGKGEDVDYDKALEEMEEMKARITKARGILANPERTAFRL
1574 :     VVIPEEMSILESERAMESLNKFKIPVDSVVVNQIIPEDVECDFCRARRSLQEKRLELVKE
1575 :     KFGDKVIANLELLRTEAKGLDVLKDIAHKLYGEAKSEEEKEVIVA
1576 :     >45357727 sirohydrochlorin cobaltochelatase [Methanococcus maripaludis S2]
1577 :     MEALVLVGHGSRLPHSKNVVMEVAEKIKARNIYDIVEVGMMEFNEPTIPQTIKKVIDAGA
1578 :     KKVIVTPVFLAPGNHTERDIPKILGIYEGDDEGGHHHHHDHEHHHHHHDTTAVEIPEGVE
1579 :     LVYRKPMGADDRIIDIVLDRANGL
1580 :     >45357728 ABC transporter [Methanococcus maripaludis S2]
1581 :     MDAFSAMFYRQLRRFTRAKSRVIGSLLNPLVWLVFFGIGWSRAFDFPAAREIFGGVDYLT
1582 :     YLIPGVVSMTVFSGSFISGVTVIWDKQFGFLKETLVAPTSRSEAILGRIMGDSITALIQG
1583 :     VLIMVLSLFLVSLNPFGMIPVIFTSFILAVAFASVGISLGLKINSQEGFHLIFGLLMQPL
1584 :     IFLSGAFYPIDAMPTWMKILAYINPLTYAVDSARYFLAGFSRFPIMLDVSILIVLSVFLV
1585 :     VLAMYTFEKAVIE
1586 :     >45357729 MATE family drug/sodium antiporter [Methanococcus maripaludis S2]
1587 :     MKTTKGVQNLLGDPKKAIVKISLPMVIAMSFQSLYNVIDAIWVAGLGSDALAAIGLFFPF
1588 :     MFAIMAISNGVGIGGSSAISRRIGQNNKDAADNIAVHSIVLGIIIGILLIGVIPFLGAIF
1589 :     SLIGASGITVTMAVEYSTILFGGAVVLLFTNIANAILRGEGDTKRAMYAIILGSVLNIVL
1590 :     DPIFIYVLNMGVAGAAWATLLSLVITGILFVYWLFIKKDTFLKISFEKFKLDINIIKEIF
1591 :     SIGLPASISHLTMAFSMFLLTAIVAKAGGNDGIAVFSTGWRIVSMGTIPLVGLATGVTVV
1592 :     TGAAYGSANPEKLEISYKYALKMGILVETIIAALILIFENQITYLFTYSENSVHILEGLL
1593 :     VFLKYMFLFYPTLPLGMLTAAMFQGVSKGNNSLFISLLRTIILQIPMAYTFGIIFNQGLT
1594 :     GVWFGMILGHVIAVSIAYLLGIYTIRQFKTTLTPETVKFK
1595 :     >45357730 ABC transporter ATP-binding protein [Methanococcus maripaludis S2]
1596 :     MHAIEVKNLVKKFDTNVAVNNVSFSVNKGEIFAFLGPNGAGKSTTINILTTLLKATSGSA
1597 :     VISGFDASKDPKKVRKTIGIVFQDSTLDNQLTAYENLYIHGKIYGYKGEILKNRIDELLD
1598 :     FVELLEFKDKIVRNFSGGMVRRLEIARSLIHEPEILFLDEPTIGLDPQTRSHIWEYIKKM
1599 :     QAKNNMTIFLTTHYMEEAELLADKVAIIDNGKIIAEGTVNELKKIVGNDCISVKFEEIPK
1600 :     NLSFENCELKENGKVIYYTENADLKIPKIFEFAHENGLKIQEISYKKPNLNDVFIKLTGR
1601 :     EIRSEKDKNQKSLLPMGKRRRF
1602 :     >45357731 ParR family transcriptional regulator [Methanococcus maripaludis S2]
1603 :     MKHGKKVKELIKILILKFLEKENLHGYLLISNIKEITGISVSPSMVYLILSNLKTAGLIE
1604 :     VEKTEDRGKKIYKLTKDGHSFLDKNQAKVEYCMKKSKALYHFHNFGGIELKKALHLAFEE
1605 :     FIDMDDEKRKKIGEIMQKCAKDIRYQIEYGDD
1606 :     >45357732 peptidase M50 [Methanococcus maripaludis S2]
1607 :     MELTSTAVLLFFLIFWTVLYLINHNKDKLGINLDLKTYMGIFGILRTQVGMNIIKKLGKY
1608 :     KLWQKLAYLSIPVCVVISIYTFYAFILSTVGLFDGTVEKEAAKPIIFLFGSTIPWIPGIL
1609 :     AIIIGVTIHELSHGIVAASFGQKIKSSGLLLALGIPMGAFVELGDEFKDSKPKIRGAIAA
1610 :     AGPISNVLVFFLVLFAMPYFTGMDSKLTITDVLEDTPAYGIIFEGDVIYSINGKLVNSLN
1611 :     DFYDAVGDIQPEQSVELVVLRNNEVNSYYITTSEEGKMGIVSEPSKTVMYILQTLYWTSL
1612 :     LNMLLGFFNLLPAAPLDGYHIWMALPDAIRDFRKNNWFVSKIANLVGWVISERNLNSISI
1613 :     FVWLAILASMIYSFI
1614 :     >45357733 alpha-L-glutamate ligase, RimK family [Methanococcus maripaludis S2]
1615 :     MITIACAEGGSTIYSLKKAIEDLGEKCNILLLSSDNLLVDTDFNIKTDLIHSRCGIGDYL
1616 :     DRLTLFSWQVLKNLESEGHYFINPLETIYNSSDKFKTTKILSKNGLKTPKTALIRDYADA
1617 :     KHFLDTKNMNYPVILKNSFSKCGMKVQKANSDDELKKLSKNSIWESKLIQEYVDFKNGDT
1618 :     YKDMRILVIDGEVVGGYRRVSNNFITNLYVGGQIEPLNVSSELEEIALKCSECMNGYIMG
1619 :     IDILPKDGEYYVVEVNTAPGTKGFRSLGIDVDKRIAECLIKYKKS
1620 :     >45357734 hypothetical protein MMP0171 [Methanococcus maripaludis S2]
1621 :     MIKVFESLLISFSFVLLSLILIFKEKLGIGKEIFIAEIMALIQLVVLGYVIGIVFNLGIY
1622 :     YASIMILFMVSVSAFMVKRNVTKEKNRKIVCAAFLSTITITIISLIILTVSKTVLFEVRY
1623 :     LIPLMGMVIGNSTNAMSIGLERFLSDLKSEKDVLWGYLALGATEKQAVNTFVKKAVRAAL
1624 :     TPHLNSTKAVGLIFIPGAMVGMLLAGVDPLEAAKVQITIMWMIMASNIFSVTIACYLLYK
1625 :     EFIHQISS
1626 :     >45357735 hypothetical protein MMP0172 [Methanococcus maripaludis S2]
1627 :     MNIDLFAVVNSISDLLFNQVYDLCGMFYPMFVGGIVSMFVFFVFKSVNKSIIALVVTAIV
1628 :     IFALPTTPYECRLVAVILAAVSSVFFVILFRKVR
1629 :     >45357736 hypothetical protein MMP0173 [Methanococcus maripaludis S2]
1630 :     MLIVDINHGALDLALEYEKSGKVPVIWDIYGKLERDKNFKEENKNILSKFKIISKKETPE
1631 :     FSNYNEVIAPVHCPIDVKFKTFHDAVSEIISKKYPKTVEKMITVTGVKGKTTTTELLKHI
1632 :     LSEKYSVFCHNSSDGSITPVTVLNILNKLSEEKKLQIYDFLIFEISLGIVSSNYSILTNI
1633 :     LENYSIAGGKRQASIKIYSLKNSKIAFVNEDLKNRFEIYHKNLKIVKNAKIISKYPLKFN
1634 :     YLKNDFEFNESVFGSHFIENSVFAIELCSYFMSFGEIKNSLKSFEIKNRMNVETKNNYAI
1635 :     VKNINPGLDLKAIDYAIFDFLNLFETGTIIVGGDLGCTCEEINIKKLADLIKKYDRDGVK
1636 :     FLLSGSVGKSLKEIINLEFVDINNYAVEENTLVIYRSNLC
1637 :     >45357737 HD phosphohydrolase family protein [Methanococcus maripaludis S2]
1638 :     MSKLKIIRDPIHKDIKLNEEEISIVDMPEIQRLRNIKQTGLTCLVYPSANHTRFEHSIGT
1639 :     MHVAGEIAKNLENIDKNLTKIVALLHDIGHPPFSHTLEVAGYDHEEFTKEKIKRMNFENY
1640 :     TSKEVLDVYSSKGLEGSLIHGDVDADRMDYLVRDSHHTGVAYGSIDIPRLIRSIVVIEDT
1641 :     NKLGIIEKGRTTVESLLTARYQMYPTVYMHPTSRISETMIKNATIDAIKDDIFKLRDLSL
1642 :     MDDIDLICTLRRSEGSSNEIMRKIDKRDLFKSISVQRYNELSPKERWNLINLSENELGII
1643 :     ENEMSDFFGSRIFLDIPKPPKMAEHRITVIMGDKKQRLDEISPLAESLKDAYKKSWSVMV
1644 :     YSEPETAKKSSEIVKDKNKFLFDFISDEIIDNSILNVLNEQGTVQGVTKLAGLVKKSPND
1645 :     TEFHSELQKLIFCGLVDKKVEPVRGTYRYDYTAAKLDD
1646 :     >45357738 hypothetical protein MMP0175 [Methanococcus maripaludis S2]
1647 :     MEFKNNSYFVDNVSENISILSLLKEYEERLSGFEKDSFKVKEPYVYVKFCLYTTLLFRIL
1648 :     EKEISKINLSEDEEKTVNILKKYKYRDFEAPYEENYIKFTVWKNESGTLVYQLCDLRENE
1649 :     SSSENWNKIYSVYMIHPKYFKHIKKIVLKLINEN
1650 :     >45357739 cell division protein CDC48 [Methanococcus maripaludis S2]
1651 :     MVDLMVAEAYQGDVGKGIVRIDPLTMEKLSLKAGDAIEIAGKEKTYATVWRGYLEDQGKG
1652 :     IIRMDGILRQNTKAGIGDKVKITVVEVKEAKKITLAPMQAVRFSTGFESYVGSRLVEQVV
1653 :     DKGSKVVIGVLGTAFPFIVTGTTPKGPVKINEYTQIELKTEPVTELKETKVPNVTYEDIG
1654 :     GLKEEVKKIREMVELPMRYPELFDKLGIEPPKGVLLAGPPGTGKTLLAKAVANEAGANFY
1655 :     TINGPEIMSKYVGETEENLRKIFEEAEENSPSIIFIDEIDAVAPKRDEASGEVERRMVAQ
1656 :     LLTLMDGLESRGQLVILAATNRPDSIDMALRRPGRLDREITIGIPDRHGRNEILQIHTRN
1657 :     MPLQPDYEKSDVISILNELVGEYDRSKIESLVKLVEKASSEEEIEKILKDGEVEDKVKVK
1658 :     LNQLMVKELADKTHGFAGADLAALSKEAAMKTLRRFLPDIDLEKEEIPREVLDKIKVTKE
1659 :     DFVGGLKEVEPSALREVLVEVPNIKWSDVGGLEDIKQDLKEAVEWPIKNKEMFERMGIRP
1660 :     PKGVLLFGPPGTGKTLLAKAVANESEANFISVKGPEIFSKWVGESEKAIREIFRKARQAA
1661 :     PTVIFFDEIDSVAPKRGMDFGSSGVTEKVVNQLLTELDGLEEPKDVVIIAATNRPDILDQ
1662 :     ALLRPGRLDRIVLVPIPNETARLEIFKVHTKGMPIGKDVNLEKLAKETKGYTGADIEAVC
1663 :     REAAMIALRENINSEHVESRHFDGAFKRIAPSVKDDDMDEYKDLAKEYGQNAGVSEIEKG
1664 :     PENTGYHG
1665 :     >45357740 hypothetical protein MMP0177 [Methanococcus maripaludis S2]
1666 :     MENWKLSHTTKCYSCGKIADQIIEIYPNQALVKCSNCNATRYYVIKKADIEDENSLKEEV
1667 :     GVKRKYDNWVLQKDIDCARCGHFGPQDILITENGIYIRCRHCGFTRYYRYHIHDPVGGK
1668 :     >45357741 phosphoribosylformylglycinamidine synthase I [Methanococcus maripaludis S2]
1669 :     MIKVVPKVLVMSGYGINCETETAHAFQKAGAETDIVHINDLIAGKKKMADYEIIMFPGGF
1670 :     SYGDDTGSGNAFANKIKNNLFDDLTEFINSGKLILGICNGFQVMTNLGLFALPSTDYGER
1671 :     ISALESNTNNRYECRWVHIKENDSVCVFTKGINVTHVPIAHGEGRFYCDEKTYHELKENK
1672 :     QIVFSYCDSEGNPANGEYPLNPNGAYQDIAGICDKTGRIFGLMPHPERSLYSISEPEYQL
1673 :     KKEIAKRNGDIIPEFIENNLQIFKNAVEYFNK
1674 :     >45357742 phosphoribosylformylglycinamidine synthase [Methanococcus maripaludis S2]
1675 :     MQTINAENNGKIYRIEIDTKEKSSEAKVIEKKLFELGYDVSVDVSKVYTINYDFSIANVE
1676 :     KIANSLHNPVTEMPRINVPSNNKFDWALELGFLPGVTDNVANTTTEIINDLLKIDIGLSK
1677 :     VFSSKVVYLSGNLAKHDVEKIAEELINILIERYHIKTYDNYVKGCGMDYIIPKVNLTSEP
1678 :     KVIEISLNVSDDELIEIGKKGILDPETGERRGPLALDLDYITAIKEYYQKEGRNPTDIEL
1679 :     EALAQTWSEHCKHTIFASQIDDIEEGIFKKYIRNATNEIREELGEKDFCISVFSDNSGGI
1680 :     IFDDEWMVTDKAETHNSPSALDPFGGAITGIVGVNRDTVGFGLGALPVANKYGFCVGRPE
1681 :     DTEIIYRGQNKTNPSLLPRRILDGIVHGVNVGGNQSGIPTPNGFVYFDDTYKGKPLVFVG
1682 :     TIGLIPRKLPDGRLSHEKAAENGDNIVIIGGRVGKDGIHGATFSSEAMDEGSPAAAVQIG
1683 :     DPITQKKLSDAVIKEARDKGLYNSITDNGAGGISCSVAEMAEECGGFVVELEEVPLKYPG
1684 :     LEPWEIWISESQERVTLSVPDDKLEEFMDLMKIRGVEAVVIGKFNNTDRAVVNYNGKTIM
1685 :     DLEMDFLHNGLPKRKLITKPYSYRTEEPEITVENQLETFEKILGNHNNCSFEYISKQYDH
1686 :     EVQNNSVIKPLQGKGRVNGTASVIRPLLSSQKGLVMSQSLLPRLSEISCYDMAACAMDTA
1687 :     IRNCVAVGGNINHIAIMDNFCWCSSDEPERLYQLKDAAKSCYDYAKTYLTPLISGKDSMF
1688 :     NDFKGFDENNNPIKISVHPTLMMSALGVIDNIEHTNSMDLKLKDDLIYVIGETKDECGGS
1689 :     EFYHAFGEVGGISPKVDAKSARKLYEKMYELSQKGIFSSCASVAAGGLVITLAKMAISGC
1690 :     LGLEADLSKAPNENISFEKIMYSETQSRFIVTIAPENEKEFENLMKEFKIGKIGNVTEKD
1691 :     FVIKNNKDIVITSSLESMDEVYRSRFEDF
1692 :     >45357743 riboflavin synthase [Methanococcus maripaludis S2]
1693 :     MTVKVGIADTTFARVDMASAAIKKLNEMTSNIKIIRYTVPGMKDLPVACKKLMEEQGCEI
1694 :     TMALGMPGGKDKDKVCAHEASQGLMMAQLMTNKHIIEVFVHEDEAVNGKELDWLAKRRAE
1695 :     EHAENVYYMLFKPEFLQKSAGKGLRQGFEDAGAARK
1696 :     >45357744 hypothetical protein MMP0181 [Methanococcus maripaludis S2]
1697 :     MGMGKTIIIVVAAIALIGLVMVGGCFSLAIIGAASDSGESSSSSSTSVSKIPSEYILMDY
1698 :     TGKTQSSIASSYGYNTMPDSGKVFLIVSVKLENHGYEEFYVNPTNFELVVDNVAYDPDTA
1699 :     TYSLDGYIDSLTLKNGGKTSGVLAFQIPKDSSNSYSLEYNSISWTDYNILSSSDILNFQ
1700 :     >45357745 hypothetical protein MMP0182 [Methanococcus maripaludis S2]
1701 :     MEFILPSNIRSGAMHFKMKHTVQAKKNKTKIREFFSKAGEYKEFYHDAISKIEERENKAK
1702 :     KGRKTKKAKK
1703 :     >45357746 3,4-dihydroxy-2-butanone 4-phosphate synthase [Methanococcus maripaludis S2]
1704 :     MTTDSKNARNSEVKIQGDEKISNVEKAIDALKSGKMVLLYDSDDREGETDMVVASEFITP
1705 :     EYIREMRKNAGGLICTCLHSDFCDKLGIPFMVDILDVASEKYPVLKELYPNDIPYDEKST
1706 :     FALYANHRTTFTGITDNDRALTVKKITELCSEERFKDFGKEFRCPGHVAFLRATEGLVKN
1707 :     RQGHTEMTVALAEMAGLTPITTICEMMGDNGKAMSKDLVKKYAEENGLVTINGQELIEYY
1708 :     LKEFSKE
1709 :     >45357747 hypothetical protein MMP0184 [Methanococcus maripaludis S2]
1710 :     MEIFGHVVSGLGEGKFFVGLTHYKNKFEELTGFTPFEGTLNVKLKHNFNLDEFNPIEFDG
1711 :     FEIDGKKYFGGKVLLIKLFNKQGNSINCAVVAPKKTDHSKKTLEIIAPIQLRKFLLLKNS
1712 :     DVVKLVI
1713 :     >45357748 5'-methylthioadenosine phosphorylase [Methanococcus maripaludis S2]
1714 :     MIGIIGGTGISSILNKGEERIIDTKYGKSKVLIDKESDVVLLFRHGAEHNTPPHKINYRA
1715 :     NICALKMLGVERILALSSVGSLREDVVPGDFLIPNDFLEFTKARKSTFYDGEDGKVVHVD
1716 :     VTEPYCPELKEVAKKILKKRDYKFNEGVYVCTEGPRFETKTEIQIYKNWGHVVGMTAYPE
1717 :     VVLAREMEMCYTSICNVSNYAAGISKNVLTVDEVLETLKEMEEKILNVVDDFINYEFKER
1718 :     TCFCKSALENAVM
1719 :     >45357749 hypothetical protein MMP0186 [Methanococcus maripaludis S2]
1720 :     MKTFEISESNLKNCEKEIETAKKMILGGKIILCGTDTLYGLSTNALDKNAIEKIYSIKER
1721 :     DPNKPISISLGEKKQIENYVYVDETAKKIIEKFMPGPITVILKKKDIIPDILGKDDVGVR
1722 :     IPDNDVIRKIAVVPLTTTSANISGKTAPTSLEEVDQIIKEKVDLIVDTGPCKYKVQSTIV
1723 :     KVIDGKIELIREGKIPFEEILKAVNE
1724 :     >45357750 thiamine biosynthesis protein ThiC [Methanococcus maripaludis S2]
1725 :     MTQMTDAKSGITTEEMKFVAKEEGMDVETLKNLIAKGYVVIPKNVNRNTKPVGIGDNLRT
1726 :     KVNVNLGTSPDFIDIACELKKVEISNKYGADAIMDLSTGGNLPEIRKEIIKNTNLPIGTV
1727 :     PIYEVGVDAKEKYGRVIDMDEDLIFNVIERQAKEGVDFMTLHCGITKQTVSALNNDPRKM
1728 :     GVVSRGGAFLTAYIMYHDKENPLYKEFDYLLELLKEHDVTLSLGDGMRPGCLQDNTDRAQ
1729 :     IQELITLGELVDKCREKGVQVMVEGPGHVPYNNIEANMKIQKTLCKNAPFYVLGPIVTDL
1730 :     APGYDHITAAIGGTLAAVSGANFLCYVTPAEHVRLMKEDDVKEGLIASKIAAQAADVAKG
1731 :     HPVAWKLEKEMADARIKHDWERQFEIALDSNKPRKMREEIPSKDEKACSVCGDYCALLMV
1732 :     EELGKR
1733 :     >45357751 diphthamide biosynthesis protein [Methanococcus maripaludis S2]
1734 :     MWDLETDRVLNEIKTRNARKVLFQAPEGLKRAVEKEIEFLKTKIDAELMIWGETCFGACD
1735 :     LCDEEVTILGIDLIIHYGHEELSYVHSEIPVVFVHAYFKENEYFLKDVENILEKMENPTV
1736 :     TTTIQFKKALSKFNPVVILGCRAPVDNAENILFVGTGRFHPLMMAYKLKKTVKIYNPITR
1737 :     EISEISDQEIKKLIKLRIGRVSKLLLNPPKKIGVVLSTKKGQCRLKSFENVIELLKKNNI
1738 :     EYIPIILNNLSQSYLFYKVDAYVICACPRIVMDDYQNYESTLLTPEELRMYLSNDFEYKF
1739 :     DEILENNFY
1740 :     >45357752 hypothetical protein MMP0189 [Methanococcus maripaludis S2]
1741 :     MIRICPKCLKAVVHYEKEYITGKVRPVFVDTENKCCGYLQTESVFNNAKCSKLQILKTQA
1742 :     GKISKQLNLSEELKYEFFENLKRFKRTHNEWKDYRVLEEALNYTLSTLNIKLQNEQLVLK
1743 :     KKLKI
1744 :     >45357753 hypothetical protein MMP0190 [Methanococcus maripaludis S2]
1745 :     MLGYLISYMIFGGILLAYGSDWFIEGSTRVAKHFNVSNFVIGATIVAFGTSLPEIVTSSG
1746 :     AALSGYPGLAVGNAVGSCIANIGIILGISVLMYPLIIKKRAIIKNGNIYLIATILLVILG
1747 :     YNGFSRFDGLILFLFMITYVIYTIKTSESDDEEIISDLTTKKASIFIVVGLLAVILGSDL
1748 :     FIEGAKGIAEYFNVPESIIGFSLVAFGTSLPELASSVAAAKRKLGSIVLGNVIGSNIANT
1749 :     CIALSFSAMIVDIPKYNVELMVNTIMALLIIFTMNREKIKKMLKFKNFRTDYFSKIDRID
1750 :     GISYILIYLIFLAYLLGYIF
1751 :     >45357754 hypothetical protein MMP0191 [Methanococcus maripaludis S2]
1752 :     MIKNNVKIDGIPAILWGKEQNRVFIAVHGNMSSKDDTVIQMLSEIAVKKGYQVLSFDLPE
1753 :     QGDRKNDKTPCKVDICVNDLEKIMKYAKNRWNRISLFACSMGAYFSLLAFADENLEKSLF
1754 :     LSPVVDMKRIIQNMMNWFDVTSERLEKEKEIETPIGQKLYWDYFCYVNEHPIKSWNFKTS
1755 :     ILYGSKDELCEYDTVNNFVKQFSCNLEIVKSGEHYFHTKEQLTSFENWLKKEIE
1756 :     >45357755 hypothetical protein MMP0192 [Methanococcus maripaludis S2]
1757 :     MKKFLVGFILFSMVFSVIPGAVAIECYGLYAGQDEYVGTVTIDVVGDILNFNYETIPGWR
1758 :     ISEIHLMALNESPNDNSSSWYTKGYITKTGNPKVGQFEIKEYFEPCVNEYCGTLNLTEIG
1759 :     VDPYDKLYVAAHAVVCECNRERIFAGFGYEAVNDFWAVNYSNYTEGIRKGGDERYNASLC
1760 :     LGKADTVSKTTNTFTCMGQGGSMVVYFNGGICGDGNNSTPDLEIYEVTYDHTANYYETIS
1761 :     IEVFYNGSYYPVGNVTNHDGDGTFNDHIFINCIYDLPSGVCIEKIRINEISTNNGDYDLD
1762 :     AIKANYKCVPEYEYVCNYTGNCESAWANDTCFGGETFPGNNWATYVIYPECD
1763 :     >45357756 hypothetical protein MMP0193 [Methanococcus maripaludis S2]
1764 :     MVDLSKYGTYALIKKYRVYFKEGEKPAKITIERYLKTGEDYAILKLPDGKKFSPPPTKTP
1765 :     EDALNDPVISFNVK
1766 :     >45357757 hypothetical protein MMP0194 [Methanococcus maripaludis S2]
1767 :     MSNKKIITSFLLLLVILSSISAYGNQNKGYGQNQGGQVYQLYDDTQVNHQQEIGSYPVEE
1768 :     LRQEEIDGLLLMREEEKLARDVYLELYDIWGQQIFLNIANSESTHTNAVKLLLDKYNLTD
1769 :     PVTNDTRGAFTNQDMAELYNTLVEKGSVSLVDALMVGATVEDLDISDLKKLNEISDNQDI
1770 :     TAVYNNLEKGSRNHLRSFTRVIEQNGGIYEPQYISESEYNEIISSEMETGTGYSANPAVQ
1771 :     TEQSNQYNASSSNNESKNVFERMWQGFMNWFR
1772 :     >45357758 hypothetical protein MMP0195 [Methanococcus maripaludis S2]
1773 :     MSKKWRGCDYMSDLIDKELLNYLYGRKTREKTFKVDINEVFEEFNVEKKERLMESIETLS
1774 :     LEKMIYIQGNSIEGFKMGISDNDPIFLIITRKGISNIETNEKMSHDKLSELFKY
1775 :     >45357759 ABC-type iron(III) transport system, periplasmic binding protein [Methanococcus maripaludis S2]
1776 :     MRTYLVLFSILLVFLAGCISTESKVEDTTTAVTFVSVTDFTGETSTINSPVERVVSNYGL
1777 :     IPPIIYLFGEGDKIVAGRGVMGADEFIDAVDPEFKTRSKDIKSDNVEEIKSLNPDVIFAP
1778 :     SWGSQQGQYPQLKSLGIPVVFIDIETASNYYKTIEMMGEVFQKEAYAQELIDYYNQSTND
1779 :     VLKRTASISENEKPRVLFLVYDQRKNSYWTPGGEFYQNNLITMAGGKTVSSDLPTGKAQI
1780 :     NVEQAASWNPDVIITSAHTMEYPSTKVKEDVLTDEGWKEINAVKSGNVYAMPFDGESWDT
1781 :     LGSKYVLGLYWTAKTLHPDMYTDVDILNLTSSEYERFFNVSIDEVTLVGDNIE
1782 :     >45357760 ABC-type iron(III) transport system, permease component [Methanococcus maripaludis S2]
1783 :     MIILNKNYVFPFLFAGVFLFSLFVGRYMFDPSLIFTNSLANNIFFDIRLPRAIAVSLAGA
1784 :     SLALAGVSFQNIFKNYLAGPNILGVTSGSAFGASIAILFFAYNPYLVQFSAFIFGVIAVY
1785 :     IAYKLSSLLKSGIVGLILSGMAISAFFSAMIGLIKYVADPYEKLPTIVFWLLGSFVGLRW
1786 :     VDLGISVIPMLIGIIGLVMLKWVFNILATGDENAKSLGVDSKKLKNITIFLATLAASAST
1787 :     SLAGMIQWVGVVSPHIARLLVGVDNRKLVPASAFVGATLLLLCDTLARTLTPSEIPISII
1788 :     TSFIGAPILIIILSKRGVK
1789 :     >45357761 ABC-type iron(III) transport system, ATP binding protein [Methanococcus maripaludis S2]
1790 :     MLRIENINFNYGKNKILNDCSFKLDSGIGCILGPNGAGKSTILKCISGIVPVKSGSITID
1791 :     GEKTTQMKYKDRSRLISYSPQEFSINFPYTVFEVVLMGRNPHVNFLAGPSKKDEQKVTEI
1792 :     LNLLKISHLKDKEFISLSGGQKRLVMIATALIQDAKLMIFDEPTSFLDYKNQYLVLSVIE
1793 :     KISKEMNKTVLLSLHDPNLAFLFCDNLFLMKNGKILSEIADKNSVCPENFQELYGINTKF
1794 :     ADIFGQKVVLPDKDYLKTMI
1795 :     >45357762 hypothetical protein MMP0199 [Methanococcus maripaludis S2]
1796 :     MIVDDLADKTLEILKNGDKLTLKEYSIAIPYAYVIVEGEKGVKMGVSMVLDSKCHYRRDF
1797 :     EETSLESIIECAKGYNLTERTLAMAAINAVSQYYIDFTESKNEDVLDLIVSDKDIKKIGF
1798 :     VGNIAPVVNELREIDGKNYEIYVFERNSSSCGAELLDDTFEYRLLPEMDAVIITGTTLVN
1799 :     DTIDVVLERSKNAKLKILTGPTAQINPDFLKNSGITHTASTRVINIDKTVTDLKHGSSFG
1800 :     IFSRNSSKYSMKVKDNNE
1801 :     >45357763 molybdenum containing formylmethanofuran dehydrogenase, subunit E [Methanococcus maripaludis S2]
1802 :     MNRLIGEKMNDVLSKVTDKEYLKQIEDVIKFHGHLSGGAFIGIQMYNIAKKVLDIKDTDR
1803 :     VYANCETRNCMPDAFQVLGNCTTGNKRLSIKDYDIMAVTVNKIIPENEVGTGVRIVFDHK
1804 :     KAEKYPALYNWFMNIKKVPHEEVISDLIDAGDSIYSWKSVEIHVSEKKPKFSAVCGLCGE
1805 :     SFIKKGTDDENICPNCAEKSAE
1806 :     >45357764 molybdenum cofactor biosynthesis protein [Methanococcus maripaludis S2]
1807 :     MKTADEVQNILNGFTCNREVSVEIYESYGRVLFDDVYSKVDVPLCDKSTVDGYAITNEGL
1808 :     NNDFLVISDEIHAGDPADMLINPGKCIWVATGSNIPKNTDRIIPFENTINSENTIRIVKM
1809 :     TKNSNIFKKGTDIPKNTKVLDKNTLIDEKAIGILASIGMDKINVYDTPKVAILSVGSELS
1810 :     EINEVNSKTLTAIVRKAGCEPVFLGVVEDSIEKITSAIKNAVLQYDIVVTSGGTSKGKKD
1811 :     YMFEIISSIGDILFHKVKSIPGMPIFAGKVSEKPIICLPGNVASCLVCGYAYLLPMFLNA
1812 :     AHKTFKRELVIADLSEEFNSELGIKHYFPVKLKDGIAYPAFRGSNMITSIANADGLVDVS
1813 :     ENEVKVRKNVKIWLI
1814 :     >45357765 permease [Methanococcus maripaludis S2]
1815 :     MFGWLDYGARYIVENILNMSMDTAIGSSVHFFIYDSLKIVILLSIMIFSISYIRSYFPPE
1816 :     KTKKILERYSGVSGNIMASLLGTVTPFCSCSSVPIFIGFIEAGVPLGVTLSFLITSPIVN
1817 :     EAAFAVLLASFGWQIAMIYVVSGVIIGVVGGLIIGKLGMENQVEEYVYSIRSRARKIKEL
1818 :     TQKERLKFAYDSTRDIVKRVWLYILIGIGIGAIIHGYAPEEVLAKYAGPENPLAVIFATI
1819 :     IAVPLYSNALGTIPIAEALIGKGVGIGTALAFMMATTALSFPEAVLLRKVIKPKLIAVFF
1820 :     GITSIAIVITGYLFNILL
1821 :     >45357766 hypothetical protein MMP0203 [Methanococcus maripaludis S2]
1822 :     MKITILGMGCKKCVEVYDNVKKAIEELKIDAEVVKIADAAKIAEYVMSTPGVVVDDEVIF
1823 :     EGKVPSVEEIKNELSKL
1824 :     >45357767 hypothetical protein MMP0204 [Methanococcus maripaludis S2]
1825 :     MFKDKNIVVGICACSPAIKTLDLIGQLRERGAEVDVIMTPNSVNFVSPLMVQREAKRPVQ
1826 :     IEAFELPKMYDPNHKSLSQKADLLILAPVSANTLGKAANGIADNLLATTIMSTKAPIIAA
1827 :     MHINPMMYSNPAVQRNIKQLKEDGFIFVDNGNEETPSKFPEISQIMSTVEQALNQK
1828 :     >45357768 molybdenum ABC transporter, periplasmic molybdenum-binding protein [Methanococcus maripaludis S2]
1829 :     MAKKSSGIIIGLITAILLSAMLLFAGCVSDSSSAEETTTITVSAASSLTDAMTDIAAAFE
1830 :     EDNPNINVELNFAASGSLRQQIEGGAPVDVFASASKKHVDILEDENLTSAGSRTNFASNS
1831 :     LVLIVPAGNPSNISSVEDLTSDAVTKVSIGNPETAPVGKYAKESLTDSGLWDELEEKMVY
1832 :     GENVRQVLTYLETGDVDAGFVYMTDAKIAKENSIEIITTVPTVTEIIYPVCIIDSSENKE
1833 :     EAQVFLDYLTSETGKQILTDYGFTAEN
1834 :     >45357769 molybdenum ABC transporter, permease protein [Methanococcus maripaludis S2]
1835 :     MDSIVFPLVLTLKISFISTFFVVIFGVILSYILARKSFYGRDILENIVTLPMVLPPTVLG
1836 :     YLLALQLGKNGFIGSLIYKFTGSGILFTWQAAVIAAFIVSFPLMVKTTTAAISAVDRELE
1837 :     YVSYTLGKTELQTIYKITLPLSKKGIVAGAILSFARAVGEFGATLMVAGNLPGKTNTMSL
1838 :     SIYQAFQTGNYDLANVLVVLLIIMSFLTIFLTGRFVEKWKF
1839 :     >45357770 molybdenum ABC transporter ATP-binding protein [Methanococcus maripaludis S2]
1840 :     MILEIDIEKDYYESKKLKKNKTPSFNLKSKFSIDSGSIIVLFGRSGSGKTSTLGCIAGLL
1841 :     DPDNGRIIVNNEIYYDSDKNINMSPQERNLGYVFQNYALFPHLTVKENIEYGIKHLSEEE
1842 :     KERRVFELLKLTQIEGLENRYPDQISGGQKQRVALARALAPSPKILLLDEPFSALDMISR
1843 :     MRLRESLRSIQKELKIPVVFVTHSFEEAFVMAEKVVTFHNGRIQQIGTPEEIFYNPINTN
1844 :     VAQLVGYINIFSNAEIDYNENSPDFSILDYRDMKMSIKKFNKSMNEVSFGIRPENIKLID
1845 :     INSEKTENVFECIIKDVVNEGSTSLVYLEVIQNGLRLMSKTQNDKFKKLNYAVGEKCKIE
1846 :     LLKDKITILMTQSVKKIDLT
1847 :     >45357771 hypothetical protein MMP0208 [Methanococcus maripaludis S2]
1848 :     MQYREIKKTGDKISALGFGAMRLPTKNGSIDKERAKKQIYYAIDNGVNFIDTAFPYHGGA
1849 :     SESFLGEILSENYRNKIKLSTKLPQWQVKKYEDMEMYLDIQLKKLKTDFIDYYFIHSLSK
1850 :     DSWAKMKDLGVLKFLDEAKKSGKIKYACFSYHDNTETFKEIIDAYDWDACLIQYNYLDEQ
1851 :     NQAGTQGLEYAASKGIGVFIMEPLRGGNLSKKVPKEAEEIFNSYKVKRTPADWALRWVLN
1852 :     HLEVTCVLSGMNEEAHVKENLKVASETTPDSLSNEELEIYDKVKEVYRKLMKINCTGCGY
1853 :     CMPCPFGVDIPACFSMYNEKSIFNDKKTGFLYLARLGGVMGGEESHAGLCVNCGKCVKAC
1854 :     PQNLDIPVLLKDVSTELGGSGFNLKIKLAKIAMSIYSSFNSLKQKISKN
1855 :     >45357772 hypothetical protein MMP0209 [Methanococcus maripaludis S2]
1856 :     MENPSHVISKNLKKIRNENGLSLDAVSKLTGVSKGMLGQIEREEVNPTITTILKIANGLK
1857 :     ISFTSLLSEKEADVKTVELKKVSPIYDDTQKWRSYPLFTFEDSRPFEIYHVEADSGMVMS
1858 :     SEGHIKNSEETITVYEGELTLSIEENTYTIPKGNSIRFKADVPHKYENNGSEMTKMHMII
1859 :     YYPK
1860 :     >45357773 hypothetical protein MMP0210 [Methanococcus maripaludis S2]
1861 :     MKKLLKKYELFLLMIPAVFFGAGAFITGKIGILELSWDELTFLRFLIASAIILPLVLKKE
1862 :     HKNLKLKKNDAYIVILAGLFGMFGYHALFFMSLEYITAINSALLMATTPMVTSIIAAVVL
1863 :     GEYFGIKRIFAVFIAFFGVLLTITNGNLEVLKNLSFNIGDVIMFSAVLCMALYAVLSKKV
1864 :     AQKYSPSLILTYGYILTVVLLIPYMILKNPINVILNASLETWLSIIYMAVFASVLAQLLQ
1865 :     QISLKYHGASKTMLFYQFVPIIVIGLSAIFLKEPFTKITAISTLFIMGGVYINSTIKRD
1866 :     >45357774 hypothetical protein MMP0211 [Methanococcus maripaludis S2]
1867 :     MNSFFETHHDLKYLLNRNYRKKSALNFVTNHYGLNTFERNFFGRCVFSDDHLEVVNKKIT
1868 :     DLTKDFKTKSIAIDGFNVLITLESLIEGVAIFCEDKVIRDLKYQKGYKLNEKSEETIEII
1869 :     LKTMLNLNLNNFDVYYDEQTSKSGEISKITKNLMEKYSISGEVILSKKVDFELKHYEFVA
1870 :     TSDFHIIKNVTGFLDIPKIVSKNYNLDVKNFLEIIKKGKLEF
1871 :     >45357775 glycyl-tRNA synthetase [Methanococcus maripaludis S2]
1872 :     MDKYDKIIDLTKRRGFLWNSFEIYGGIAGFFDYGPLGAILKNNVINTWRKHYIVNEGFYE
1873 :     IDSPTVTPYEVLKASGHVENFTDPLVECKDCLESFRADHIIEENVDVDTEGKTLQELQEM
1874 :     IEKNNIRCPKCGGEFKEVSTFNLMFATSIGPGGKRAAFMRPETAQGIFIQFKRISQFFRN
1875 :     KLPFGAVQIGKAYRNEISPRQGVIRLREFTQAEGEFFIDSRKKENFEKFESVKDMVLPLL
1876 :     SGKNQEDESLSSEEKVVKMSLSDAVKNGIIAHEAIAYYIAVTKKFLMEIGIDETKLRFRQ
1877 :     HLPNEMAHYAADCWDAELYTDRYGWIECVGVADRTNYDLLAHMKNSGDDLSVFVELDEEH
1878 :     EIEAYEIELNYKLVGRTFKGDAKVLEESLKELDDKKMEELVEALETEGKYVLKTCKRDFE
1879 :     ILKEYLTAKKVKKIVKGEKIIPHVIEPSYGIDRITYCVMEHAFKEDEDRTVMGFSNAVSP
1880 :     IKVGVFPLVNKEGMPEIAMDLKNKLRENGLIAEYDDSGAIGRRYMRMDEVGTPFCITIDG
1881 :     ETLKDRSVTIRERDSREQFRIPINEVVPYIKDKL
1882 :     >45357776 triphosphoribosyl-dephospho-CoA protein [Methanococcus maripaludis S2]
1883 :     MKAFDIMKASQIACCFEVGSFKPGNVHKNRDYDDIKYHHFISSGIAFGDVIHQACLEKNN
1884 :     IGNFIKKGVIESKKWSPTNANLGIIMLHMPIAIAASNLDKFSESALKKETEKIIKNTTVQ
1885 :     DAIDVYRAIEIALAFVNAPENGPDLKSKDAKDELIEKNLTLYDVFKISSTWDSISNEWTE
1886 :     NFKISYKGYNLIKEYYEKYNNINIAVTKTFINLLSNYPDTLIARKKGIDVSKMVSEKAKE
1887 :     VLNNFNEESVLEFDKFLSKEGNKLNPGTTADLIASSLLIFLLDRISNEKTILY
1888 :     >45357777 non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family [Methanococcus maripaludis S2]
1889 :     MKIYFATGNQNKVDEAEIILKEANCEIEQIEIPYAEVQGRLEEVSAFGVLEVFEKFNRPV
1890 :     IVEDSGFFIEKLNDFPGTYSRFVQETIGNEGILKLLENETNRNAYFKTVIGYYDGDNIKL
1891 :     FTGIVKGTISTEIKDGGFGFAYDSIFIPEGKTKTFAEMTTEEKSEISHRKRAFYELKNYL
1892 :     ENL
1893 :     >45357778 hypothetical protein MMP0215 [Methanococcus maripaludis S2]
1894 :     MAKPETGELNRFQLNLLSAFEGSVLSLDEIEKLYIEHKLKHYGEDRESVKELIFDLEKGF
1895 :     FKLNDEVIKEYVEILYNVYNSPCKESIDRYEMILEDIGCKKVEKYLEELEKSAYISKMGD
1896 :     GYNITEKGSEMLKHKK
1897 :     >45357779 cation transport ATPase [Methanococcus maripaludis S2]
1898 :     MQKYILKGLCCAGCASKIEKLLKEQGYPSAVINMATSELILDEKEIDLEKITKIVTSIEP
1899 :     GVIVIPKQSEIKITNEIDYNELKKIVISSVFFILGIFSSHFGYSLSIQLLFFIVSYILVG
1900 :     QKVLKKTFQNIKRLDFFDENFLMSIATIGAFLIGEYPEGVAVMLFYSIGEFFQNIAVTRS
1901 :     RNSIKSLVSIKAEYANVLENGETIKVKPENVQIGQTIIIKPGEKVPIDGIVLNGKSSLDT
1902 :     SALTGESTPKSINRDEEVLSGMINLSGLLTVQTTKNFSDSAVSKILNLVESASINKTKTE
1903 :     KFITKFAKVYTPIIVFIAVLLAVVPPIIFNEPFVPWFYKALILLVISCPCALVLSIPLGY
1904 :     FAGIGRLAKEGILVKGSNYIDVLSKTTYVSFDKTGTLTEGKFKVTKVVSKNEFSGKKLLE
1905 :     IAKMVECNSNHPIAKTIMDFGTISCKTSLDDFEEFSEVLGKGIISRINGSEIIAGNEKLM
1906 :     EEKNINFEKLDVYETAVHFAVDGVYAGYILISDKLKKDSKETVLELKKLGIKKVSMLTGD
1907 :     KKDIAEKIASELNLDEYYSDLLPEDKVKIIEEIEANKSKKETIAFVGEGINDAPVIARAD
1908 :     VGISMGTLGSDAAIETADVVIMNDKPSKLISAIKISKRTQNIAFQNIFVILIVKIAFISL
1909 :     GIFGETTMWQAVFADVGVALLSVLNAVRILK
1910 :     >45357780 transcriptional repressor related protein [Methanococcus maripaludis S2]
1911 :     MSDLCSEYSVRNEKIKDIMEKLPSNEDIVNISNIMNSFGDPNRLKILLALKESELCSCEL
1912 :     SNIADTSISAISHQLRILRDRKLVKFRKEGKFVYYELYDEKIRDFLEEIVELRK
1913 :     >45357781 hypothetical protein MMP0218 [Methanococcus maripaludis S2]
1914 :     MLYIIFYIRILKINNYNFIKKLKNSIQAITMKTKQHKIFWISALVASILMYIVQYAVFND
1915 :     YLGIINSFFGKIAFVPIQVFLITVVISGILSDMEKSSRLEKLNILIGTFFSETGTKSLKY
1916 :     FSKIDSRIEEIGSKLKVTDSWVDEDFKNALNYAKDRDYTLNASKEDIIEIYEFLSKNKEF
1917 :     LMRLLENPNLMEHEHFTELLRAVFHLLEELESRENLHESSDNDIMHLNGDMVRSYRLITI
1918 :     EWVNYMKYLKNNYPYLFSLAMRRNPFDKSAKTSLK
1919 :     >45357782 putative manganese-dependent inorganic pyrophosphatase [Methanococcus maripaludis S2]
1920 :     MMYVVGHKNPDSDSICSAIALAYFLDAFPARLGELNPESQFILKRFGLMEPELIKTAKGK
1921 :     ELFLVDHAEKSQNLDDFDKGKLIGIIDHHKIGISTTEPIIYLSKPVGSTASVISELYFRG
1922 :     ILDIIGGKNKELKADIAGVLLSAILSDTLLFKSPTATPLDKELAEKLADIAGISDITAYG
1923 :     MEMLTAKSTVGKMTPEEILHIDYKPFDMSGKKVGIGQAEVIDMSEVASKKEAIQNLIDEM
1924 :     IEKEGYDMVLFLVTDIMKEGSEVLVAGNKSSFETAFELKLDGKSVFIDGLMSRKKQVVPP
1925 :     LEKYYSN
1926 :     >45357783 Sodium/proline symporter-related [Methanococcus maripaludis S2]
1927 :     MWHYVFLAVYVAMIIGIATVTKKRIKGVSDFLLGGRNVNPWMSAFSYGTAYFSAVIFIGF
1928 :     AGKMGWSFGIPTMWIVVGNTIIGSFLAWQVLGKKTREMTQRLGASTMPSFLEKRYKSKNL
1929 :     ESLTAFIIFFFLVPYSASIYKGLNFLFEGFGISPMNAYILMAALTAIYLYFGGFIAATLA
1930 :     DFVQGCIMVIGVLLMVFFLGSNPEVGGFSGMLSNLSSIDPMLVTPINEASFIPIMGLALL
1931 :     TSIGSWGLPQMIHKFYTIKSEKAAVSAKWVSTAFAFIITFGAAYIGTVSRLFYPDAASKA
1932 :     AAGLTSPDMIVPKIMEIALPDWVAALILVLVISASMSTLASLVLASSSVVSIDFVKGRLK
1933 :     TDLSDKNTMILMRLLCVLFVVLSFILAIVPNSYVLSLMALSWGLVSGCLLAPYFLGLYWK
1934 :     RTTKEGVWAGITSALAIMLGGAYYFGINSVYMPAVGSLAMIAPIFVVMAVSLITKPFERE
1935 :     HIDYIFNKK
1936 :     >45357784 sodium/proline symporter [Methanococcus maripaludis S2]
1937 :     MISENLSIVLVFILYLLVVMGVGMYFYRRNETISDYVLGGRKLNSWVAALSAQASDMSGW
1938 :     LLMGLPGVAYLSGMSEIWIGVGLAIGTYLNWKFVAERLRRYTEIAKDSITIPVYLENRFR
1939 :     DQSKLLRIVSAFFIMLFFLLYTSSGLVAGGKLFNLVFGVDYTLAVTIGALVIIGYTFLGG
1940 :     FLAVSWTDFIQGSLMFIAIFLIPIMGISQVGGIDATMNAWNSISPDYLNPFTNLDGESLG
1941 :     IMGLASALAWGLGYFGMPHILVRFMAIKSADKVPKARKIATTWVVISLFMAVLVGMVGAV
1942 :     ALGAPLDDPEHVFMAMAQGLFPSLIAGLFLAGVLAAIMSTADSQLLVTASAITEDIYALL
1943 :     NKNASQKELLWISRFAVIVVAAIAYYFAIVPGSSVMGLVSYAWAGFGGAFGPVILLSLYW
1944 :     KRMTRNGALAGLLSGGFMVILWKNLSGGIFDLYEIVPAFLLASVMITVVSLMDKEPSLEI
1945 :     QEEFDRAVSEMK
1946 :     >45357785 hypothetical protein MMP0222 [Methanococcus maripaludis S2]
1947 :     MHYSMIKPVFKEEELLIDKGSLKTKRKFAFLLDINDRVLINRNFYVNDEVDVVLDYTYTN
1948 :     SKRPKEKIKSYVLSDISKE
1949 :     >45357786 hypothetical protein MMP0223 [Methanococcus maripaludis S2]
1950 :     MKLDAKVSIFHAIFGAAFGYLTNYVYMFGLGMFSGVASFVFMLITLVITGNLASMIFGRE
1951 :     SMNQKEWMGSGVVPFFFIWLVFWIMTYNGVFY
1952 :     >45357787 glutamate-1-semialdehyde aminotransferase [Methanococcus maripaludis S2]
1953 :     MELNIKMDRSKELFEESKKYLVGGVNSPVRLFKPFPFFVKSAKDCFLYDEDGNEFIDYCL
1954 :     AYGPMVLGHANENILNAVKSQMDLGTAYGVPSEKEITLAKEVINRIPCAEMVRFVNSGTE
1955 :     ATMGAIRLARGVTKRNKIIKFEGAFHGAHDYVLVKTGSGALTHGAPNSPGIPEDTTKNTL
1956 :     LIPFNDEEAVRKVISENKEEIACIILEPVMGNVGCIPPKDGYLQFLREITEENGILLIFD
1957 :     EVITGFRLSKGGAQEYYGIKSDLATVGKILGGGFPIGAITGKKEYMEQFSPNGQIYQAGT
1958 :     FNGNPISVTAGIETLKNLDDKFYKETTKKAGILSNCLRETAEKYNIPAKVYNVASIFQVY
1959 :     FNDKEIVTYEDAKSSDTEKFMKYFYTLLENGVFVAPSQFECCFTSIKHNDEVLEKTMNAI
1960 :     DIAMKKL
1961 :     >45357788 glycerol dehydrogenase [Methanococcus maripaludis S2]
1962 :     MIVIPRYTIIKEKASFRIQEILDNLNLKNPLVITGKNTQKYNKDFDFIYYDEIETSDLEN
1963 :     IKNYANDYDSVIGIGGGRPIDIGKLIAHKSKKPFLSVPTTASNDGIASPIVSLTQPSYMT
1964 :     EAPIAIIADIDIIKKSPKKLLSAGMGDIVSNITAVLDWELGKIEKSEKYSDSSGIFSKTI
1965 :     AIELMDYVLNSNLEEYPKKLVKALIGSGISIAIAHSSRPASGSEHLFSHALDTMKEKYSI
1966 :     DTNSLHGEQCGVGTLATAQIYLEEGKLEVETFEMLKTSLKVVDAPVTAKQLGFDEEIVIE
1967 :     ALSSAHALRNRHTILRNGISKEKAREILEKSEII
1968 :     >45357789 ExsB family transcriptional regulator [Methanococcus maripaludis S2]
1969 :     MKAICVLSGGLDSAVTSMFAKSKNYDISTVTFNYGQMALNQEIKSAKKISDILNADHHVI
1970 :     DINFVKEFSKSGLNTGNIPEPENEDLDDFEKSEKTMKAVWVPARNMIMFSIASGFAEGIG
1971 :     AEKIFSGLNKEEGVTFPDNTPEFIERFNKSLEYGTLNKVKMVAPLYELNKPEIAKLGKEL
1972 :     ELKLDLEVLKYSYSCYKDNGKDYLHCGTCESCMRRKRAFKEAGITDPTKYLVE
1973 :     >45357790 anaerobic ribonucleoside-triphosphate reductase [Methanococcus maripaludis S2]
1974 :     MISNSKYVDFKINIVKRSGNEETFNINKLVKSLLNSGVDYENIDEILSEIYGKVYNGMST
1975 :     DDLKSILYTTLKEYDKKTGKSYSKKYMSENCLKIRTSEKEFEPFNKEKIVKALIQEAGAD
1976 :     LKTAERIATEVESEVKNLNVTYLTAPMIREIVNTKLIEHGLEEFRHKHTRLGIPVYDIVK
1977 :     LIERGSKDNANLMHNPESIHKWVADETMKQFALLNVFPKYIADSHMRGDIHLHDLEYAAV
1978 :     RTVCCQHDLRNFFKYGLKVDGTGRHTSVSKPAKHPDVALQHAAKVLSAAQCEMSGGQSID
1979 :     EFNIWIAPYMRGLEYSEVRQLMQLFIYEMNQIYAARGGQVVFSSINLELEVPEYLKGKDA
1980 :     IKAGQVVGAYEEYDYEVKMIAEALVDVLMDGDAYGKPFLFPNVIFKLRENAFKDENKDLL
1981 :     VKIHELSAKWGLPYFINMFADYQHGNTNAMGCRTRLSGEWGNSIEESSLRTGNMQWYTIN
1982 :     LPRIAYEADGDDGRLFEILDEKLAIAKQALEIKHEISKRRLYHDNVLPFLTQEFDGEQYY
1983 :     RYDSTTKTFGFVGLNELLKYHVGSELHESPEALAFGVKVISHIRKYADDLKKETGLRWTV
1984 :     TQTPAESTAGRFAKFDHKYYPEETKSVVNGNLNDLSSIYYTNSSHVRVNADVTLGEKVGI
1985 :     EEKFHELCNGGHIGHFWNAEAYADPEVLMDITKKMTKTDIGFWTYTKNLSICEKCSLAMS
1986 :     GLKDNCTGCGSDHIEKFSRITGYLQNVSNWNKAKQQELLDRKSTLPGRRI
1987 :     >45357791 N(2),N(2)-dimethylguanosine tRNA methyltransferase [Methanococcus maripaludis S2]
1988 :     MKIISEGETKLMVPEESTLSKKDTVFYNPVMETNRDISVSVVQSFLDDFKRDEFLMCDPL
1989 :     GGSGARGIRYAKELKFNGDLKVSIGDINPSAVKMIKENLKLNELENVEVFHEDANVLLSK
1990 :     NFKVFNVVDLDPFGSPVPYLDSGIRASLTKGGLLCMTATDTAVLCGAYRKTCIRKYNAVP
1991 :     LKGDKELAVRLMIGYAVKMASKYDIGLKPIFSHVTDHYARTFMVTERGAGKADSAIENLG
1992 :     YIRQDSEQKSFKTFEEGSEKGYAGPFYLGEISDKNIVQNALNTAKTRNYSKRAVNILEMI
1993 :     SRESEINQVGCFDIHELCSFIKKLVPPVNDIMENLKENGFKVTRVHYNPYGLKTDAELSD
1994 :     LVVLISEYHSKKY
1995 :     >45357792 amino acid ABC transporter ATP-binding protein [Methanococcus maripaludis S2]
1996 :     MIEMVNIHKKFKEAHVLKGVDLKVAKGEVLVIVGPSGSGKSTLLRCINGLEKTTEGHIFF
1997 :     EGDDITDKKVNINKIRQKIGMVFQQFNLFPHLTVLDNITFAPRKVLNVSKKEAEELAREL
1998 :     LKKVGLEGKENQYPIQLSGGQQQRVAIARALAMKPDAMLFDEPTSALDPELVKEVLDVMK
1999 :     QLAYEGMTMVVVTHEMGFAKEVGDRLIFIDDGQILEDGNPSDVFSNPKNERTKNFFGKIL
2000 :     SHN
2001 :     >45357793 metal dependent phosphohydrolase [Methanococcus maripaludis S2]
2002 :     MKDLIALAEEIKDEKLRKKVIEYINNPLPKHPEIESTGITIENSPASVKRHHKYPGGLLE
2003 :     HTIAVTKMAVKMAEALEETYGIELNRDLLISGGILHDLMKPQNYQLKDGKFDHLSDFHLD
2004 :     HLTLGIAELYRRDFPLEVIKVVASHHGDHGPVSPDSIEAWLIHHADNVDAAINDIGIRIC
2005 :     QARAREFGIDDSQIYKIVNPLKLYEMRKKLGKDKVKEFLKEKLEIKDE
2006 :     >45357794 cysteine-rich small domain [Methanococcus maripaludis S2]
2007 :     MIDLAKDHLKKVLSLCGANRDCEYYPCHYENQSCLWCYCPFYPCEDENLGEFVKRKDGSL
2008 :     IWSCMKCNWIHKPEIASEVLKEITELTKDKKINDSIEFIDNHEILMNIKRRVEEKLGKDN
2009 :     SV
2010 :     >45357795 hypothetical protein MMP0232 [Methanococcus maripaludis S2]
2011 :     MFGFDNLILGVYLFNFLLILTATYTDIKERIIPHFVIILMLIVNLPIGYYFFGFDAITSF
2012 :     FATLILCLILGVGMGGGDVKMFTALSPLFAAETIYFVPKDISILIGLSALFAAIFPMTKI
2013 :     LKNYWKDIIPSSAYLAMLIGIIVSITEIYSIGNTKTILWSYIILSIFISRKIPKYRIISN
2014 :     KLGYITPIYLIGFYLLNPAYFVSENVLISFFVYIGQLSLISLVIYALTGAEISSKKQISD
2015 :     LKEGDIIRDIVTIKENGEVTVENANILKRFKHMIYGEMGKLEGKSLMTDGEGLSDENLEL
2016 :     LNKLQNEGKIGGELNVLTTYPFVPFVLVAYCVITLLNMGVINYLVG
2017 :     >45357796 hypothetical protein MMP0233 [Methanococcus maripaludis S2]
2018 :     MFKRFNRGQISFEFSIIVLSILLISTITITYFLTSSFDEGTRTLDKIDLGAKTAVSLVNS
2019 :     GYNGTQTEGTLIYAGMTWDNAGNNYENITVYISNTTPVPVNTRLFVKNYTIESQGIDTTK
2020 :     YDFTIAWSG
2021 :     >45357797 hypothetical protein MMP0234 [Methanococcus maripaludis S2]
2022 :     MPAEEYSGKLKSLKSKSKKSSRIPPKQLRMALVIVVSVIVIFEVYNIYFTAKNRELEELE
2023 :     NNRAVAIDTIDKLFFEYPNDPQKIAYVIKLQQSQDEENIERILDDAQKYLEIKQYKTLAI
2024 :     NQIKDMYGEYYGSSIKANELERKINAANSTAEVDELFKQSNVEEEVKEILEKSLEKTISS
2025 :     GDSYFYVEMSGQEYFMTKDDVLEITDSMGIMQLKEFRVTPVSNLNKLTVVVSSRQCGKIP
2026 :     LSGDSILVYNKNTPEAPIAYAVIDSSYVILPDIGYSEERSVSNVVNDEGSESTVESTSSI
2027 :     SYTLNNLPGVLHATAADKLDIGTVIDKFGSYGERLNKIEDNTQIFDENVNYLLIVAVPSE
2028 :     KVSNLVAVNSEDLYIVKAAGGN
2029 :     >45357798 hypothetical protein MMP0235 [Methanococcus maripaludis S2]
2030 :     MKMLNIKYLTIFLFLISIIPNAHSETTVATMDTYWSLTGEITNEYPYSVFITIPEEIEYI
2031 :     EKDLKSSKNFMELTNGESDDDDEEESTDPVTFDITPKSELNGQEGFWIPPYTTANIKMYS
2032 :     TRVDVLTTNEDDDEEDDDEVVRTMEISGPAAYPKTKLIDLSEIIPASKKDKIELDNFKLY
2033 :     VKGSIVKNDTDVLSILIPAPIVLKDYSTCDKFISKYSVNTWVDSYSDWVTDHNELSSYGS
2034 :     TMLDNTLVPVFDLGPGFYKTFDVPALVYTTSSNQELSFSYKMYWYAEEEDTKDIWML
2035 :     >45357799 hypothetical protein MMP0236 [Methanococcus maripaludis S2]
2036 :     MSKGQVSVEFIVLFLALLVAVVVSTMTPGIFGLNKSVELSSASLAHAALSKVKSNIEILS
2037 :     VSGEGSYKLVYVKSPPANWTFENRTIRVYGNGFNISTNTSVDLNTYNYLASSLKILSVNL
2038 :     TRNDKNVTVAIQ
2039 :     >45357800 hypothetical protein MMP0237 [Methanococcus maripaludis S2]
2040 :     MIKMLQLPFNKKGQVSFDFIIAMLFLLLIFAFMGQNVLNMAKSFRDSETAEHAHAILDSF
2041 :     ENYAIMAYSKDVTVNATFEPIGNLNYTIMLSNKSISVNSSTNIIFQPETDANGDYVSIKC
2042 :     NNVDNSVNTIPLNAVRISFGDFTVSKDEMEVNIR
2043 :     >45357801 hypothetical protein MMP0238 [Methanococcus maripaludis S2]
2044 :     MIQEKSSIFKSISWILILFLLFSSSNALELNDLSVSSTHTEVSKSFSINKVEDYTYILSY
2045 :     NRYGTLNETIVANIYLNGQMIAMHGEGSQRNDFSKDITNILKDGENSLKIVSEIPPAYTV
2046 :     SFKMRDIQISEPTPIINLPISPNVDFLAFILCLIFLMKKKW
2047 :     >45357802 hypothetical protein MMP0239 [Methanococcus maripaludis S2]
2048 :     MTLKSKLRSKKGYIFTYEAVAVVILFVAVFYMGYFTFTHVNLTNQEQKRDLERFEKANLI
2049 :     SDMIFKDYLFPSEYYADDYHEFLEDVAIKHYGFKKIPASYDPLIVYTKNEVLSYYIEVEG
2050 :     YNSSGVGLQNVIDIDTISNPKPNYSLRNIYSKEKNLYVPTHLNYFEADNISQNVSEGEIL
2051 :     YFAINGSSKIESINVSSNSDTNATFLVNDVPYKLSLTSTEKVSEFEKVMNTYNETSFRSN
2052 :     EIKLLDIEENSLENVTINIYCNDTSKFYILKIKPYNVTLSVDMAQ
2053 :     >45357803 hypothetical protein MMP0240 [Methanococcus maripaludis S2]
2054 :     MIFDSDMVIAIVILTVGMAFYTSSLVEHGGMYGDTIKTNIFHDKVSSQLKEMVTDGTIDT
2055 :     AMLLKNNNETVVAENLIKSRVVSDNYVLTIGNWTIDNSNPTDEFVLVSTVVLINRSEGWY
2056 :     GFYWNESLNPNVNSRGPFIDENIAYAVLGTYDSDYNKTIYYYNNNESIDISLKVYGE
2057 :     >45357804 hypothetical protein MMP0241 [Methanococcus maripaludis S2]
2058 :     MYLSHTTVTLVLLMMLTATMIYTTIDLQKDQIITESIATSVDLRSSSLEHVVETSIPIAF
2059 :     NKVLNDMELQVMQSGTYYENESYVLENLTYSLDSEINGNLETIKNEYSSEYDMDYDFEVT
2060 :     NITMVDGFTFKVDYDLEYYLAKENVYDSKNVSESQEITVKTIISAYHYLMPKNLIEINSP
2061 :     SDLTDYQFKVVLTDTDFDFSENNNGSGIEFIDEYGNSLPYWIEYWNYDDKKAIVWLNGNL
2062 :     TTGINYINITTSGTGVSNGGAVFELFEGFENLESNFDSDTIFYTTIASGTWENDSLDSLL
2063 :     ISEYNEKMVKCENAPIFAKVISDYDMNHYSLSEYIVEVNAKGNNSDGENSPNVMVGFFVD
2064 :     LDAEPTYGYHPESFYTADLGGVYNDHIYEYSDSGFRNAPAPDFKSTFGISNEYPDDKNLD
2065 :     RVIRNRFVSSLEVQENIWYYIKLKINESITDDVVTASFMSLDGYVDGLDFTTEISYAVDE
2066 :     SNNYLLLGTSVGSYYYVPNNYNQSIYFDNFRVRKYVQNEPTQIPRYQGLYYISPPRGYGT
2067 :     VYGTEDSENLYFIENNTEPSIIDMLAGKGSYDGPYWNYGYGIKLVEN
2068 :     >45357805 hypothetical protein MMP0242 [Methanococcus maripaludis S2]
2069 :     MKVAVPMDMDTISDADSAKYFLIFKIEEKEVVDTKTLLTLEEMLKEKPNAVIINKREKFN
2070 :     GKMENYFCEKNDVDVCILEFIEGNLEKIE
2071 :     >45357806 hypothetical protein MMP0243 [Methanococcus maripaludis S2]
2072 :     MSEKSLEKNEIFDSYFKNLSDRERAVFEGGISLGALFHQFIGTPVSEKTKKSLEIAMSES
2073 :     LKNQPFIEDVSVSIVGIIEDGKYVSLTGEMLDVSLTVKTEKNRALLRLKYIKELDYPLMY
2074 :     VEKI
2075 :     >45357807 hypothetical protein MMP0244 [Methanococcus maripaludis S2]
2076 :     MKKKIEILKDYLKNDDIIFLCHHNADPDAVGAAIGLKQLANSFSKKKSKEKNLKISADSV
2077 :     SKLSRSILKELNEKIEIIEYPKLPKTVFLVDTSSINQVTVNSEELTNSDVILIDHHKKTD
2078 :     LINFCKFYIVDENSTSTCEIVANLFREMKIYPPKNIRIGLLCGILYDTKHLKIAKESTFN
2079 :     ILSWLMKDISFQKVLYLLSQESDPSKRIAHLKACSRMELMELDSYTIAISHASSHEASCA
2080 :     KTIVSIGADIAFVVAARKRDREIRISVRSRKAISKKIHMGALMEKVAKILDGQGGGHAEA
2081 :     AGLNAPWNKEKTKEEAVESVLSVCIKSLEEELSGVENV
2082 :     >45357808 prefoldin, beta subunit [Methanococcus maripaludis S2]
2083 :     MELPANVQNQLMQFQQLQQQLQMIMYQKQQFETQLKEMEKAIEEMEKSDSEEVFKMAGGI
2084 :     LVKRNKAEVKEELSEKIETLQLRVTTFEKQEEKMQKRYTELQESLQKVMGQGQ
2085 :     >45357809 hypothetical protein MMP0246 [Methanococcus maripaludis S2]
2086 :     MNSVIMTYPKFTLKLTFETPKKARIIYESAYPEHVASQVRSKCKMDLFENSIIISCISDE
2087 :     LSILKASIYSYIRWIKVAESIYKLTEDE
2088 :     >45357810 ribosomal biogenesis protein [Methanococcus maripaludis S2]
2089 :     MIITTSRKPSQRTRSLVNDLARVFNFKILNRGKIPLSELIENKDDMIIVEELKGNPGRLK
2090 :     IFNFENNKILSMNLSLKLQREVSGKAFKNSGKLGSKFDKNTEHLKEFFFEYLFKKLSNYK
2091 :     EENFEVVITFKTVDESTFYIEVHKGSENMGPSLKIKTVKILDIE
2092 :     >45357811 DNA-directed RNA polymerase related protein [Methanococcus maripaludis S2]
2093 :     MAEYKCSNCGKIVTLDEIGLKAKCPHCSNRVLIKLRPKIVKKVQAR
2094 :     >45357812 50S ribosomal protein L37Ae [Methanococcus maripaludis S2]
2095 :     MVEFSHTKKIGSAGRFGSRYGRKIRVRLRDVEIKQNKDYKCPVCAFPKLKRAGTSIWVCE
2096 :     KCGAKIAGGAYTPETGAGKVVTKAIRRVIESKSREI
2097 :     >45357813 putative RNA-associated protein [Methanococcus maripaludis S2]
2098 :     MVSLDNAVIARLQSHGEKFEILVDPYLAAKFKEGQPIGISEILAAETVYKDSGKGEKVPE
2099 :     DVLLKIFETLNPLEIAEQILKKGTVQLTANQRKEIQELKRKQIVSIISKNTINPQTDTPH
2100 :     PPKRIENAMEEARLSVDIYKSAEEQIPKIIKELRKLLPIKFEKRDVAVKILGEFAANAYH
2101 :     TLHEYGATKQEEWLGDGSLVLVIEIPSGIENEFYMHLNKLTKGTVQTKVLKRYD
2102 :     >45357814 proteasome subunit alpha [Methanococcus maripaludis S2]
2103 :     MQQMVPASGYDRAITIFSPEGRLYQVEYAREAVRRGTTAVGIKCKDGVVLAVDRRITSKL
2104 :     IDVSSIEKIFQIDDHIVAATSGLVADARVLIDRARIEAQMNRVSYGEAITVEALAKKICD
2105 :     IKQAYTQHGGARPFGLALLITGIDRHSARLFETDPSGALIEYKATAIGSGRPIAMEVLES
2106 :     KYDENMTVSEGMELALYALSKTTEELKPENIDMAIIKDSGKLVEKISVDEIEKIVKAVYE
2107 :     KVKAEEEEAEKNKGEEDSE
2108 :     >45357815 hypothetical protein MMP0252 [Methanococcus maripaludis S2]
2109 :     MARQVLNEVYIIVKKSVFSGKYLAVKGAGGCC
2110 :     >45357816 CoA-binding domain protein [Methanococcus maripaludis S2]
2111 :     MNTLEGIFNPKSVAVIGASEIEGKVGQSVMKNLLNFKQHGGKVYPINKKYNEVYGIKCYG
2112 :     SVLDVPETPDLVIISIPAEYAVDAMEECGRKGVKAAIIITAGFAETNNHVLEDRLKAIID
2113 :     QYGIRTIGPNCLGVINLHNHLNASFSKEFSNMGNIAFISQSGAIMTALLDIANYYNLGFS
2114 :     KIVSMGNKIDVQEYELLNYLENDPHTKVVALYIEGLKDEKFISAAKKISRKKPVIVLKSG
2115 :     KSEEGAKAASSHTGSLAGNNAVYDAAFKKSRVFNVESFEDLVNLLKIFSVQPPMKSKKLA
2116 :     VITNAGGFGVLAADSVEKCGLELADFSATTISELKKYLPDTSGISNPLDLIGDADVNRYK
2117 :     HAFELVENDPNVDGLLAILTPQGMTDALGVARELVKLKNYMICKKDKIPIVASFVGGTSV
2118 :     LEARSYLQEKGIPSFICPELAVHALACLYRQSHLMDKYDSPEYLNEIRSEIAEAKANNPE
2119 :     KIDELLANANESNSKEFLKLNGFAIPEKFVATTKEEAKEYAENLGKVVMKVVSADILHKS
2120 :     DAGCVIIDPSDASEAFETIMKNGEKYLFDRKIDGIIDGVLIEQFVTGKEIIIGAKRDPVF
2121 :     GPVVMTGLGGIFVEVLKDVSFGITPITKEYAGEILHSLKSYKILEGVRGENRSDIEFLKE
2122 :     LIVRVGVLMETYDEISEIDINPAFIKEEGQGGFVGDALIITK
2123 :     >45357817 carbohydrate kinase, YjeF related protein [Methanococcus maripaludis S2]
2124 :     MKDIKCFQKTGNILKFEELRAKLKINDKNDVSPLEIKVIDENSEQYGISKETLMENAGRA
2125 :     VYEEIVNLNVDFSKTYLFCGTGNNGGDGFVIARHLANNFATFVVLIGNERKIKTSETQRN
2126 :     FNTVKNMEFFGNLDYANILDDERAVELLKTIEKELENKQNDHILIIDAMLGTGITGILKN
2127 :     PYSTIVDYLNVLKSKYSKKLKMVSVDIQTGNLNADLEVILHKRKFENKNKNFVVKDIGIP
2128 :     KYIENMVGKGDFYLLNERKQNSHKGQNGNVLVIGGSKEYHGAPVFSALAASKFADIVTVA
2129 :     SVSNVMNTVSNYPELMPYELTGDYIVQNHVDELLELSKNYDCVVLGSGISVNSDTKEFVN
2130 :     SYLNETNGKVVIDADAIKLIDYSNFKFKNNFIFTPHKKEFEYIENYIESSGFKSTVVLKG
2131 :     SLDIIFNSNNIKMNITGNQGMTVGGTGDILCGIIGAIYACNDAFPSACCGTYINGYCGDL
2132 :     LEKEYGYYYNSTDIIKILPKALKELLY
2133 :     >45357818 isoleucyl-tRNA synthetase related [Methanococcus maripaludis S2]
2134 :     MENDVFKADMHIHTKYSGMMKYMGLKFPDSVEEPLKVMKCAKANGMNIIAVTDHNTIKGA
2135 :     LETKKYEKEFGIEVVVGSEIMSKDGEILGLFLNEDIPKRLSAEETIEKIHEQGGLAVCPH
2136 :     PYSPICEAIGDKMFELDFDGVEVYNAYHRDGIVNNIALDKVLKNYHKSPFAFLGDSDAHL
2137 :     ARMIGNGNTKFEGNSSDDLFNAIKRRKTTYEGTPTPLSDIILWSYNVIYASEKALLKSMV
2138 :     KKDDNIVNYNCSKFKKGIAAFGGLMYIGTPLPLVAGVLGNIYLKKKAKQKLKEVIQEVI
2139 :     >45357819 imidazole glycerol phosphate synthase subunit HisH [Methanococcus maripaludis S2]
2140 :     MIAIIDYNAGNLRSIEKALELYTKNIVVTSDPETILSADKLVLPGVGNFGDSMKNISQKT
2141 :     GDCSLNEIINKCVQKVPFLGICLGMQLLLEKSEECPETPGLGVIKGDVIKFKHSEKIPHM
2142 :     GWNTVNQVQDIPLFEGIANNEYFYFVHSYHVNPSEKDVISGTTNYGYEFPCILNKKNVYA
2143 :     TQFHPEKSGKNGLKMIENFVELI
2144 :     >45357820 transcription factor [Methanococcus maripaludis S2]
2145 :     MEPEIKVVNVVVSTQIGTDIDLEYAADILDNAEYEPEQFPGLVCRLSEPKVALLIFRSGK
2146 :     LNCTGARCKEDAVIAINKIVKELKEAGMDLIDNPEVKVQNMVATTELGMEPNLDDISTLE
2147 :     CTEYEPEQFPGLVYRLSEPKVVVLIFGSGKVVITGLKVIEDAYIAFDKISKTLKELEEEL
2148 :     Y
2149 :     >45357821 50S ribosomal protein L12P [Methanococcus maripaludis S2]
2150 :     MEYIYAALLLNSAGKEITEDAVKAILVAGGVEANEARVKALVAALEGVDIAEAIEKAAIA
2151 :     PVAAAAPAAAAAAPVEEKKEEKKEDTGAAAAAGLGALFG
2152 :     >45357822 acidic ribosomal protein P0 [Methanococcus maripaludis S2]
2153 :     MIEAKSEHKIAPWKIEEVNALKELLKSSNIIALIDMMEVPAVQLQEIRDKIRDQMTLKMS
2154 :     RNTLMKRAIEEVAEETGNPEFAKLVDYMDKGAAIIATEMNPFKLYKTLDESKSPAPVKGG
2155 :     AIAPCDIEVKAGSTGMPPGPFLSELKAVGIPAAIDKGKIGIKEDKIVVKEGEVVSQKLAV
2156 :     VLSALDIKPVTVGLNVLGVYEDGVIYTESDLKIDEEEFVGKIQKAYTSAFNLSVNAVIPT
2157 :     SATVETIVQKAFNDAKAVSVESAFVTDKTADAILGKAYAQMIAVAGLAGDDALDEDLKGK
2158 :     ISSGAAAPVEEAPVEEKKEEKKEEAAAPAGLGMLF
2159 :     >45357823 50S ribosomal protein L1P [Methanococcus maripaludis S2]
2160 :     MDSEKILNAVKEARTLAKPRNFTQSVDLIVNLKELDLSRPENRLKEQIVLPSGRGKDVAI
2161 :     AVIAKGDLAAQAEDMGLTVIRQEELEELGKNKKTAKKIANAHGFFIAQADMMPLVGKSLG
2162 :     PVLGPRGKMPQPVPANANLAPLVARFQKTVAINTRDKALFQVYIGTESMSDDELAANAEA
2163 :     ILNVVSKKYEKGLYHVKNAFTKLTMGAAAPIEK
2164 :     >45357824 DNA directed RNA polymerase; subunit L [Methanococcus maripaludis S2]
2165 :     MNYVKIIEKNKNFIELELVNDDHSLSNLVKEILLAKDGVILASYGVEHPVLDPDTGRYIS
2166 :     NPTIMLKTDEKTDAETVLKEALKDIVDLCNKTLEDL
2167 :     >45357825 hypothetical protein MMP0262 [Methanococcus maripaludis S2]
2168 :     MKRIISIKGTEEEIIEICERISKLGIDYSFDAKANYAENRAYNSARIKIFGDEKYKLVED
2169 :     HKNILTIIDTVHNKYNADTKGLFEYKLNDLKYPVNKDLVLDTLSALKINFKYLKDENVIK
2170 :     CERKIEEINRILKDILDIYSELNFYNIGSKPVKNVLTLAVYITGRDIDELIEEGLEKELF
2171 :     REEDEKIVLNKDINLTRKELLSVKK
2172 :     >45357826 tyrosyl-tRNA synthetase [Methanococcus maripaludis S2]
2173 :     MLIFVKSGENMLESILKNTSEIVSIEELTELLKKEEKIAYIGFEPSGRIHMGHYLQIRKM
2174 :     IDLQKAGFKIVILLADLHAYLNQKGTMDEVRALGEENRKVFEAMGLVADYVYGSEFQLKD
2175 :     EYTIDVYKLALSTTLNRARRSMEVIAREDENPKVASVVYPLMQVNDIKHLNADVAVGGME
2176 :     QRKIHMLSREILPSMGYKAPVCIHNPVLTGLDGEGKMSSSKGNFIAVDDDEATIKKKMKN
2177 :     AFCPMKEVSGNPVLEIAKYYLKYPATVKRPEKFGGDLVLESYEALENAFVEGLHPMDVKN
2178 :     LVSEQLIEILRPIREKMNK
2179 :     >45357827 MscS mechanosensitive ion channel [Methanococcus maripaludis S2]
2180 :     MALDQLYFGNTLYSYMIFLIFIFFGVFFGKVMYIFLNKYVRVLAGKTKTKLDDVVLDAVE
2181 :     IPLIIVVFVLFFKYGLNNLVLPDNLSLWLNESLTVAITFAGVLFLLKIVDDIIVNYVVPI
2182 :     VEKSENTLDDQLVPLMRKLVKFLILIAGLMLILSNVGYNISALLAGLGIGGLAVALAAKD
2183 :     TIENLIAGFIIIVDRPFKLGDWIKWGGKEGIVEEVGIRSTRVRSFGDTLITVPNANIVQT
2184 :     EIENFSERRKRQVKATIGLTYDTPVEKVKRAKEIIENVLNDHHGVVDPIRVSFVEFGSFS
2185 :     LDLRVEYFVRDFGFDFFLNTKDEINIKIKEEFEKENIEFAFPTQTVYYKKE
2186 :     >45357828 hypothetical protein MMP0265 [Methanococcus maripaludis S2]
2187 :     MDRTWALIFAIVVGFVASLQPIINSKLGEHIGSKNAVFVNFIIGLVLIGLIILISDPSSI
2188 :     KQLSKVPAINPVYLLGGIMGVVIVLLSLIVVPELGALSAFSIFVGVQLISGALIDHFGIF
2189 :     GIQKSPITLLKLFGISLLLLGMRILIK
2190 :     >45357829 MarC family integral membrane protein [Methanococcus maripaludis S2]
2191 :     MDVQFIILAFTSLFSILNPFGVIPTYLVLTSQYSKVEKIKIIRKSMLAAFALLMMFALLG
2192 :     NQIIGFFGISIPAIKITGGVLLFLIALDMIQGNTSKVEKSPKLESHLKSHSEEIEDMDEI
2193 :     AIVPLTVPLLTGPGSISAVIAMMAQTSDFDGKLSVIIAISLCIIISYFVLKFSKDLEKML
2194 :     GKIGFKVLTKMMGLVLTAISIQMALDGILMVFG
2195 :     >45357830 hypothetical protein MMP0267 [Methanococcus maripaludis S2]
2196 :     MKYISSISVDISSNDVETSEVVNEKIERELQLEMSKIGVKSTITNVTGDDIVISSFVSED
2197 :     RIEEVNDIVFKLLYKHAEGFEDLEGVSNDPKTAGEGVSYALSKTPSEYGDSIIIGFDTYC
2198 :     GESFVNEAALFVEEIGKKFGYDSSSSVSDVPTKIPGIGYSGVSTDDPVVVITLENVKDLQ
2199 :     KIAGMIYGGLLGFENVYFVKRGSPTNILPPGVIYTMTAFLNGNAIDLYDGIKRKNNLL
2200 :     >45357831 tRNA pseudouridine synthase A [Methanococcus maripaludis S2]
2201 :     MYIFKIAYDGKLSFQTQPHGETVCDKISNALLDCGYLDNKDRVPLYHGGRTDRGVAALGN
2202 :     YVVYEMDKKPVLPRVQSKLKWDGIWVLGCKKIEIFPEIEHRHYQYTLPNKNHDVELMKKA
2203 :     SEKLIGTHYFQNLSKRDKTKVKDPVRTLYDIKISSNDYFITIDIFGESFLWNMVRRIIRL
2204 :     LSDIGKHKIENPEKFIELILSEDYKKGYPPSPAEGLILVDVKTNIDIDLDSYVIRNLKNS
2205 :     WEKSLNNSLMRLGLCKTVLSKT
2206 :     >45357832 hypothetical protein MMP0269 [Methanococcus maripaludis S2]
2207 :     MTKVLVIDPKIAGMSGDMFVSSLLALTNSYDLMDELILELEKLNNCNSFKVSVMDEKVNG
2208 :     ISAKQLKIEIDEERIKNPDELKEIIINTSKNLMSEKGVKICENIINDLIEAEKKLHGDHF
2209 :     HLHEISSLDTVFDIVLPVLILEKNGFLDGKIYSTPPSLGNGRISMDHGIIPSPAPSTLEI
2210 :     LCKHEIKCSKVDSEFELLTPTGAAILSNVTDEFTDSYPEIVLLKTAYGAGTKRMEHVPNV
2211 :     LRLVEGKTDEKIIEKTVILETNIDDISSEILAYAVERLLNEGAPDVFITPVFGKKNRPSS
2212 :     MISVICPYHVHEKFAKILIEETGTLGVRINHYDKIRAKRRMEKLTLDINGVNFGFDVKIS
2213 :     DLNGEIVNIKPEFEDLKKIAKNLNIPLRDVLRHANNKIKEIYGF
2214 :     >45357833 Fe-S cluster domain protein [Methanococcus maripaludis S2]
2215 :     MENLKEIVKLLPGYNCKACGFKRCDLFAEKILEGENPENCPLLFKEEFKGNIEKIKEIAS
2216 :     TLKPLEIKKTCASKTGLVGLLDGYEADFLLDPLPEEHSCRETLIILSKNPIKKGDHIKYR
2217 :     PLGCPIPHFAEIIDDAHGMYVVHLEGPCNRFNSEKIDYIEVGIALIAAFEGVYNGKTPEV
2218 :     GKTVKFIPTHCMMQKVHSGVVVEVEGNRVLIEGIDLKVW
2219 :     >45357834 ATP binding putative nickel incorporation protein [Methanococcus maripaludis S2]
2220 :     MIIVAGTPGAGKTSVMTHTIKQLLNKGNKPAVVKIDCLYTDDDTRYGKLKIPTLVGLSKD
2221 :     MCPDHFAIYNLEEMAEWAEKEGVDTLIIETAGLCHRCAPYTKNSLGICVIDATSGPNTPR
2222 :     KVGPFLTSADVVAITKGDIISQAEREVFRERVLEMNPKCTIYDVNGLSGQGCAEISEEIM
2223 :     EAKDIVDLENEELRHNAPLCVCTLCVGETKVAKKHHRGVLRRIDGFTKYVGE
2224 :     >45357835 ABC transporter ATPase [Methanococcus maripaludis S2]
2225 :     MNIEEIKIMGGFNKFGESEKVKELVVKRGEIFGVVGPTGSGKSNLISDIEQLAQGDTPSN
2226 :     RKILVNGNVPDTEMRRDPRKRRIAQLSQNMNFLADMTVEEFLIMHAKSRGMNSEGIVDKV
2227 :     IKLANNLTGEPIEKDYNLTILSGGQSRSLMVADVAVISDSPIVLIDEIENAGIKKHEALE
2228 :     LLAGCGKIVMVITHDPVLALMTTRRVVMRNGGMNEIIETTEEEKEVSQRLSEIDSWMLSM
2229 :     REKVRHGEKLNLKDIETPAVSGN
2230 :     >45357836 phosphosulfolactate synthase [Methanococcus maripaludis S2]
2231 :     MIIDKGLSPDFINDYLKVCGKYITFAKFGWGTSAVQSRELVKEKIENYKKYGIKTYPGGT
2232 :     LFEVCFSKNLFEEYLKECKDLGFECVEISDGSMELKPEDKDYAIKQAKKAGFIVLSEVGK
2233 :     KSIVLDSELEIHERIELVKKDLESGADFVIIEGRESGKSIGLFDEKGNVKKEELEILAEN
2234 :     VDMDKIILEAPQKNQQVEFILRFGNDVNLGNISFEEVISLETLRRGLRGDTFGKI
2235 :     >45357837 hydrogenase expression/formation protein HypE [Methanococcus maripaludis S2]
2236 :     MNITRMHGAGGTVMQKLIKETILGNLENTKIEGGIGLESLDDASTIPIGDKEIVFTVDGH
2237 :     TVHPIFFPGGDIGRISVCGTVNDLSVMGAKPVALSLSIVLPEGFDIEKLDKIMKSINEAC
2238 :     KEAGVAIITGDTKVSNVDDIIISSAGIGIVDSGKAVRDCGMKEGDVIIVSGNIGEHGLTI
2239 :     LLSREGFEFESELKSDVAPVNGLVQSVLNAGFEINAMKDPTRGGLADSLNEMAEKSDLGI
2240 :     LIHEDKIPISDEVQAIGEALGIDPLTVANEGKVVMSVKEKDSEKILEILTAHPLGKNAKI
2241 :     IGNVTSEHKGVLMETIVGKRIVDTPMGDPIPRVC
2242 :     >45357838 periplasmic copper-binding [Methanococcus maripaludis S2]
2243 :     MNLGHSIYDFEEGVLMKIFKVFLVMVILGAISGVFAEDTIIYVNDTHYWYQSGAFFESNN
2244 :     SIQDAVEYVPENGVVEVTTDLKVSNGIEVNKSNIIIDLKGNKLSGNYEGRGISISGNNVS
2245 :     LKNGVVSNFDYGIVLENAENCKISNNEVFGNTYDGIYILNSKNNDISENLVYENGVIGIV
2246 :     TSGIFLDGSEFNNITKNTVNNNIYNGIELLNSKNNLISGNNVFENEDNGVFVWNSKNNSI
2247 :     IFNELYQNENNGILTRESKFNTIESNNIFENDDSGIYSWKSFENTISKNKISKNSEGIIL
2248 :     WNSDLNVLFKNKLLNNVKSGISIEFGTKYNTIYDNLFNNSLNVRFEDSGKNYWNAPVINE
2249 :     SNILEGEFTAGNVWYTPECTGFSQKAMNQDTNGDTLSETYYELNSENIDNIPLAPDSVPP
2250 :     VVSIVSPRENAFFGENETILVDVSVTDNSEIHSVMLEVDNSYKEIMVQNGTTYSKSLDNL
2251 :     DYGAHTIKIYAEDAVGNVNFFESRVFSISTPDSTPPEVRIISPVSKSYAEGSEVSIKVQI
2252 :     TDESDIYSAYAKIDDYTVDLIESNGYYINILDNLEWGAHTLWIIVTDAAGNSNYNEKVTF
2253 :     DVNEGDITPPEVEIIEPEIGDSFEENVSIKVSATDDSGIDSVKVMLDEKVSFTLTKNSEY
2254 :     YTGTLTDLSYGIHTLRVYAEDNEENINSDEVIQFEIEVPDYSYTKPTTDNTQEPAETSNP
2255 :     ENKTTDTPLNNETGEITPNESENESNGEIENNTNESQNSETQNNTDAGDEGNISDNPSEN
2256 :     DSPLEHEDTSDTEPDNNDEGAEDSGDTTSETGDATGEEPTETSDDEPSETPPETEDTTGD
2257 :     ESSDTTSDDNSGGESESNSETEDSETSDDEPSDSSSESESNSDASPEDNSDGETSDNSPE
2258 :     ESGDSVA
2259 :     >45357839 hypothetical protein MMP0276 [Methanococcus maripaludis S2]
2260 :     MQKIVVFLTVILVLLMAGCIGDQKSKSYNDKGLELYNQGNYVDSISEYNLALLENPKSAE
2261 :     IWVNKGNSLLKLGIYGESTECFDKALLIDPENSEAFNGLGTVLSKTGNYQKALEMYDKSL
2262 :     NIDSENSEAWKNKGITLNNMQRYSEAIDCFDKSISINAKNSDVWYNKGETQFKLGEYEKS
2263 :     IDSYNKALLIDEKMETALLGKGNSYLKLQNYESAIECFNTAETINPKSEYPPYYKADAYR
2264 :     DTENFEYALKYYDEALEINPSNSDILISKGICLDKMKNYSAAISNFDLAIQLDPKNVQIW
2265 :     ILKGNSYVGLKDYESSISCYKKALEIEPKNENAKENIDIIEKII
2266 :     >45357840 TraB family protein [Methanococcus maripaludis S2]
2267 :     MYIRVNNGVTECNIRLVGTAHVSDDSVKEVENAIIETDPEIVAIELDKDRFVAMFQNKKN
2268 :     NVDLKSVIKQGKVGIYIVHSILANFQKNIGEQFGIKPGSEMKKATDLAIQHGKPISLIDR
2269 :     PINVTLSRTVNKMTLKEKFDFLMGLLTEQNLELDEKAVNDMVSNADDLILLLKDISPSIY
2270 :     ETLVDERDRYMAKNLFEASKGKENIVAVVGAGHVPGIKNYLKKMEIGEDIDLKSLMEIKK
2271 :     KSNVLGKLISIAILLIILYGFYTASSNLEALKTLTMEWVLINGCLSSLGVILARGKIHTI
2272 :     IAAFLAAPVTSLIPVVGAGYVAGLVELKFRDVSFNDIGKMMNTENFKELMENQAMRVLLV
2273 :     AALANLGSAIGTFYFVPRFL
2274 :     >45357841 putative signal transduction protein with CBS domains [Methanococcus maripaludis S2]
2275 :     MIFVKDVMKRPITLNKDDNIEKAISTFRENKISGAPVVEGEKLVGILSESDIIKALTSHD
2276 :     DRFSLVLPSPFDLIELPLKTAIKIEEFKGDMENALKTEVFEAMTEKVVSVSSETPITNAA
2277 :     EIMVKNKIKRLPVVEGEKLAGIVTRGDLIEAMI
2278 :     >45357842 beta-ribofuranosylaminobenzene 5'-phosphate synthase family [Methanococcus maripaludis S2]
2279 :     MKLNSPSRIHMGLIDLNGELGRVDGGVGVALDYPNFQIEGKESSEIEIDFRIEIDEKDKE
2280 :     NLESRIKNAAKNVLDIIGETGISLKVNDAILSHSGLGSGTQVSLSTGKITSLVYGIDLNA
2281 :     ETLAKITGRGGTSGIGVAAFETGGFIVDGGHTFGEGKDKIDFRPSSASKDVKPSPVLFRH
2282 :     DFDWDIVLTIPKGEQVCGDREVDIFRKFCPVPTEDVQKICRLVLMKMMPAVIEKDFDSFG
2283 :     KVVNELQNLGFKRAEVGLQKESLKGLLSKLQEVSYSGISSFGPTIYSLGDKDTITEISNE
2284 :     FFDKFGIEGEIISTKANNSGYEIIK
2285 :     >45357843 phosphoribosyl-AMP cyclohydrolase [Methanococcus maripaludis S2]
2286 :     MDKNIKEIIKNMDLKFRNIDGKKLLLAISTDKQKNVLMTAFMSEESLEKSIETGYMHYYS
2287 :     TSRDKIWKKGEESKNVQKIIDVYRDCDGDALLFTVEQTGWACHEGYMSCFHNKIDLNTGD
2288 :     STVIGTKLD
2289 :     >45357844 ATPase [Methanococcus maripaludis S2]
2290 :     MSIEEINQNLNENKKFKDCKITVDTCVVIDGRITELILDGRIEKCKIIVPEAVISELEAQ
2291 :     ANKGREIGYFGIEELKKLVTVAKENEILIEYYGERPSTGEVSLARAGEIDAMIRKVAKDT
2292 :     DSILFTSDKIQYNLAIAQNIDAHFLKVHEEKVALKLIEYFDEITSSVHLKENCLPYVKKG
2293 :     RPGKVRLIPFADEIMDRTEIKVIIDNILKYTEQNHGLVEIERRGATVIQLGNLRISIARP
2294 :     PFSEALEVTAVRPITKVSLEDYNLSEDLKVRLDSAEGIFVSGAPGSGKSTFVSALAERYK
2295 :     NMDKIVKTMESPRDLQVDEEITQYAPLEGSMEKTCDILLLVRPDYTIYDEVRKTKDFEIF
2296 :     ADMRMAGVGMVGVVHASKAIDSIQRLIGRVELGIIPQIVDTVVFIENGKIGKVYEVEFNV
2297 :     KVPHGMKEADLARPVIEVVDFLTKTPEYEIYTYGEQVVVMPIKETTESRGAVLAYAEEKI
2298 :     SEVLKKHLPKKSRPDIRVVNKDTVEVKVLEKFIPAIIGKGGKEISKLEEITGLRISVREK
2299 :     DEVVENEKDFETYEFINDYESTKLTQTGKHVIVELGEDYIGANIKIYIEGEYACSATVSS
2300 :     NGTVNISKKTAIGKDLANAMKKGKDIYVEF
2301 :     >45357845 phosphoribosylaminoimidazole carboxylase, catalytic subunit [Methanococcus maripaludis S2]
2302 :     MITIIMGSKSDVKIAEKAVSILKEFKIDYEVRVASAHRTPELVEEIVKNSKSKVFIAIAG
2303 :     LAAHLPGVVAAMTTKPVIAVPVESKLDGLDALLSAVQMPPGIPAACVGIDRGENAAILAA
2304 :     EMLSISDERIEKKLAEFRENQKKKIFSDDAEVSSLFKN
2305 :     >45357846 nucleoside-diphosphate kinase [Methanococcus maripaludis S2]
2306 :     MACENELERTFVALKPDTVERKLVGRVIQRFEDRGFEIVEMRMLTLTMEMAEEYYGEHKG
2307 :     KEFYERLIKFMTSGRIVAMVIKGERAISTVRKMLGNTCPCDAEPGTIRGDFGLYTPANII
2308 :     HASDSLESAEREIDLFFGR
2309 :     >45357847 translation initiation factor IF-2 [Methanococcus maripaludis S2]
2310 :     MALRCPIVSVLGHVDHGKTSLLDKIRRTRVTQREAGGITQHIGASEIPINTIKKVSKDLL
2311 :     GLFKADLSIPGILVIDTPGHEAFTSLRKRGGALADIAILVVDINEGFKPQTIEAINILKQ
2312 :     CKTPFVVAANKVDRIPGWNSSEGPFILNFNEKNQHPNAMTEFEIRLYENVIKHLNELGFD
2313 :     ADLFSRVKDTTKTINVVPVSAMTGEGVPDLLVIISGLAQRFLEQKLALNVEGYAKGTVLE
2314 :     LKEEKGLGKTIDAIIYDGIAKTGDFLVVGNPDGVLVSKIKALLKPKELDEMRDPKDKFKP
2315 :     SKQISAATGVKISAPDLDSVIAGSPLRIVPKNQVEAAKEEVLEEVEEFTILTDDEGIIIK
2316 :     ADTMGSLEALANELRKVNAKIKKAEVGDISKKDVIEASSYASTNPLNGLIISFNTKVLAD
2317 :     AKAEIEKSDVKLLEGKIIYKLVEEHEEWTKEMEELMKSDEINRLTKPAMIKILPNCIFRQ
2318 :     KEPAVCGVEVLYGTLKIGSPIMSEDGKKLGYVKEMRDNQQENIKEAKVGMQVPVSIDGNI
2319 :     VLGRNAKENDILYVEVPEPEARKLHHEFKDELRGDEKEALSRYMELKQKIENNIFWGM
2320 :     >45357848 TrkA-N domain protein [Methanococcus maripaludis S2]
2321 :     MILVIGYGSLGRKVVNNAKNIDKVTVIDKNEAVFESLENGDFNYVIGDASELDVLERAKV
2322 :     KEADTLLVLTNDYELNRKIVEITSELNSKAYIIARGIIKYPELYNGLDINKIIYPLESAA
2323 :     KDAVNEIEKSKLRRKLAELKEVANKAKKSFNEHYSEKEDETQENHKAPFLILMHRNPDPD
2324 :     AMASAMALKTIFDKWGVNSEIAYGGKIGYDENKAMVNLLSIKLNQIDEINLSRYCSIAVV
2325 :     DSSSAKTLPIDIEGSKLAVIIDHHNDSDIVAKYMDIMPEIGATATILTNYLLGLDITPNR
2326 :     DLATALYYAITSDTNYFKRKTSKKDFEAASYLQGLMDPKVLEMIENPDMDTETMEILGKA
2327 :     IMNRKIIKGNLALSYVGTLKNRDALPRAAEFLLKMEGISTTYIFGIAENEIHISSRTKDL
2328 :     RVDVGNIMKTAFGGGGHQSSAAASVELGIFQSVSDKQSLRKLVEEAIQAKIFETMGIEEE
2329 :     EPAGQD
2330 :     >45357849 hypothetical protein MMP0286 [Methanococcus maripaludis S2]
2331 :     MLKELINKLLWHPDYNPEDYIINYLHRGAENDEKSVPLKNIVIEDSFLVFDETHIPFHRI
2332 :     LEIVNTKTGEIIYKKR
2333 :     >45357850 CBS domain containing protein [Methanococcus maripaludis S2]
2334 :     MVYAEEYMTKKVHSITPDATVSDIIKLVKETTHDTFPVVVNSKVKGIVSVHDLIGKDELD
2335 :     EVSEFMTPRDDMIVTKPHTKIMDVGRIMFRTGFSKLPIVDENNNILGIITNTDVIRSQIE
2336 :     KTTPKKLKKIVNSYINLGYEVTTKRETIQIDDLIPTQANVYEDELYGRAYELKRGLAEPI
2337 :     IVIKTNVNEKYILVDGHHRAVAACLSNIKELEAHVLEINTDKTMGIEKTAEKQGLKSLKD
2338 :     IKILDEEKMNCSSAYKLRANILEL
2339 :     >45357851 hypothetical protein MMP0288 [Methanococcus maripaludis S2]
2340 :     MDVCSMQKTGRFLEIDFFRGLAIIMMVISNFVTDLKYFLGYSDYLLFWSFFALFVASSFV
2341 :     FISGVSFNVSFSKKVASQNLTYKSYFNRFLKLSVIAVVITAVTAYFLTSGTIYFGIMHFL
2342 :     AISGILGIIFYRFKKLNLFFSVIFLILGVLFSEIVLDTYCLLPFGILPNNFYTLDYFPIF
2343 :     PWFGVYLLGMSFSEKYYKNGVSRHSFEIFKTGFFNKICILGQNTLIIYIIHQPVLVGLLI
2344 :     LKYGIFSKIAL
2345 :     >45357852 hydrogenase expression/formation protein HypD [Methanococcus maripaludis S2]
2346 :     MDAKIMNINNKELIKKSIQTIQKLSEKLDEVKIMHVCGSHEHTICKYGIRDVLPDNITVV
2347 :     PGPGCPVCVTTQKEIDKAMYLAEQGYTIATLGDMYRVPGSKKSLMQLQSEGADVKIVYGI
2348 :     GDAVKLAKKQDEKVVFVAIGFETTAPTTAAELLNKPENFYILNSHRQTPPVMGFLLGGGT
2349 :     SLNLDGFICPGHVSTITGLKPYYDPCKTYHAPMVVAGFEPIDVMASIVMILKQLVNGEAK
2350 :     VENEYTRGVREEGNVIAQKIMNKVFEPADVAWRGFPVIKDGGMKLREEFKKYDVHENIDV
2351 :     PDIKETINKACICSEILRGEKLPHDCKLFGKTCDPMNPVGSCMVSDEGTCRIFYKYSKFR
2352 :     >45357853 nascent polypeptide-associated complex protein [Methanococcus maripaludis S2]
2353 :     MFPGGGKFNPRMMKQMQKMMKDFGMDAEDLKAVKVTIELEDKLLVFEKPKVQVMDMLGNK
2354 :     TYSITGKAKKVAKEEEKIEDVEVKVEVTEEDIDMVSNQCGVSKEEAKKALEEVNGDLAEA
2355 :     ILKLGN
2356 :     >45357854 hydrogenase expression/formation protein related [Methanococcus maripaludis S2]
2357 :     MDIERYVRKCLKKGISESKIIEDGFKKVIEVKDTDEGWARRFVEAVVEEVKTTEKYRESE
2358 :     DKNLKYILDCPESGITMGKMGVGSRGEGDFFVHREIARIIESTNQDTEVDSTEQDDAGVV
2359 :     RANAEHVVVAVDGTHSRLSDFPFIAGFHVARAALRDVYVMGADAVAVISDVHLADDGDVS
2360 :     KIFDYTAGICAVSEAIDVPLVAGSTLRVGGDMVLGDRMVSAVGAIGTIEKGEPTARKRAE
2361 :     VGDVILMTEGSGGGTISTTALYYGMFDVINETINVDFLKSCKNLIENDLLKHIHVMTDVT
2362 :     NGGLRGDAFEITNTAKVSLEIYKEKVNELVNPKVLEMLQKLNIDPLGVSIDSLLIIVPKD
2363 :     KAGEIMEKTGAKQIGVVKEGEVSYLIDENGEKELLIPKFREAAYTPVKKVVGEQKPDNFE
2364 :     EMKEKVRKTCDMAIEKKDFVVKEMFKN
2365 :     >45357855 hypothetical protein MMP0292 [Methanococcus maripaludis S2]
2366 :     MDMEMILGLIDTLEQKGVGIQLSVENQKTVEISIKNKNVDINIVDPSKIGKLIKELNIKT
2367 :     D
2368 :     >45357856 aldolase [Methanococcus maripaludis S2]
2369 :     MVKKITFEDVLIPMETPESMHDEYVQNYLKLTRNTGNLMLFAGDQKIEHLNNDFYGENIS
2370 :     KDDADPEHLFKIAKNSKIGGFAVQFGLLSRYGQNYKDINYIVKLNSKTNLVDVDQKDPLS
2371 :     RALLDINDILEFKKNSGVNIVGVGYTIYLGSEYESEMLSEASKIIYEAHKGGLVVILWIY
2372 :     PRGKAVQNEKDPKLIAGATGVASCLGADFVKVNYPKSENPAESFKEAVMAAGRTKVVCAG
2373 :     GSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSLSDAVAMCNAIYAVTIDGKTVSEAL
2374 :     NIYSERKS
2375 :     >45357857 Pyrrolo-quinoline quinone [Methanococcus maripaludis S2]
2376 :     MLRGGVNDCKIKWEFLIGNSIDSSPILAKNGTIYLGSSNKNLYAINPDGSVKWFFKSGEI
2377 :     IECKPSIGKDGTIYFGSDKVYAINPDGTEKWRFDTKKAIVSDFTIFEDILYVTSLDGHLY
2378 :     AINPDGTEKWRFKTNDAITSAASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTVTRP
2379 :     AISEDGTIYVTSLDGHLYAINPDGTEKWRFKTGKRIESSPVIGNTDTIYFGSYDGHLYAI
2380 :     NPDGTEKWNFETGSWIIATPAIDENGTIYFGTRNGKFYALFN
2381 :     >45357858 homoserine kinase [Methanococcus maripaludis S2]
2382 :     MKKVKVCSPGTSANLGPGYDIFGLALSNPYDIVEVEKTENGITISVEGEKAEEIPTNVDE
2383 :     NTAGVVAKKMIEDFKIESGIHIHIIKGIKPGSGLGSSSASCAGIAFALNELFELKLSKLE
2384 :     LVKYSSLGEAVAAGAPHADNVAPAIFGGFTLTTSYEPLEVLHIPVDLEVLVALPNIQVST
2385 :     KTAREILPKEIPIKDMVNNVGKAAGMVYALYNNDLDLFGRYMSKDCVVEPCRANLIDGYT
2386 :     EVKEKVKDMVYGITISGSGPAIITIPKKEHVIDIENIFKEVWNCPVYYTKVGPGCYVEEI
2387 :     E
2388 :     >45357859 hypothetical protein MMP0296 [Methanococcus maripaludis S2]
2389 :     MKGFCYRCGHEGELLDGLCKICYTHMNPLIEVDNEVHVEVCHMCGSYKRKLWQDPQKRET
2390 :     YEIMEEIAYFGVKDNLKKANKSIDVEIMPQEPRQLPGGKRSRVEIPTVVFAKGRLVGEDN
2391 :     DREEERHITVYLDMVQCPRCSRCMSNYYEGTLQVRAMNRFLNDKERIELDDFVRDEAGKR
2392 :     LNKDRMAFISKYIPQKEGLDYQMGSMGAIRNIASAIKAKYGGKSIETAKLVGVDKDTGKD
2393 :     MYRITVAVRIPEFKLGDILEHKEKIYVVSSLNESRVYMEPVELGDKIALVWNEIDKSAKL
2394 :     IKKGEDCETATVISITPDTITAMDDSNYEIYEYNNTIENVKEGNKIRIFKNEEINRILEI
2395 :     IE
2396 :     >45357860 translation initiation factor IF-2 subunit beta [Methanococcus maripaludis S2]
2397 :     MVDYFDYSSLLTRAREQLPEEVFKDVRFEIPSADSFVEGNRTIIKNFKDIAKFMERDPQE
2398 :     FAKYVMKELGTAGDMEGVRLILQGKFGWRMVNEKIQNYVNEYVLCPECGKPDTKIVKEGR
2399 :     IHFLKCTACGAMKPVKTL
2400 :     >45357861 50S ribosomal protein L15e [Methanococcus maripaludis S2]
2401 :     MSMYNYVKEAWKVPANSYVKELQWARMQDWRKEPSVLRIERPTRIDRARNLGYKAKQGIV
2402 :     VVRVSVRRGGLRKPRPKHSKKPATLGINKITMAKSIQRIAEERAAKRYPNMEVLNSYWVG
2403 :     QDGKQKWYEIILVDPCHPSIKNDKSYSWLSTGNHKGRANRGLTSAGKKGRGLMYKGKGAE
2404 :     KARPGVRANGKKTK
2405 :     >45357862 hypothetical protein MMP0299 [Methanococcus maripaludis S2]
2406 :     MNFFRWGISMNQDEKQFKKILLDSLFISCIIIAIPAILCLFGAGHCTLGLFFGAILTFLV
2407 :     GIMVLFRKDEIISLILGGRRRYHIKKLKSED
2408 :     >45357863 hypothetical protein MMP0300 [Methanococcus maripaludis S2]
2409 :     MVNNITISTIANATEDEEKVLDSIVFFLPEIIEEDDLETETVETEGNFGNPIEIHTVKIS
2410 :     GKKAKLVFNYIIDLIKSDERNVNRLKKELDSRIEKNKLYLRFDKQKAYLEECKLFDGDDT
2411 :     VRIVVNFKIFVPSGKEEKVKEMVLERLDKRGVF
2412 :     >45357864 hydrogenase nickel insertion protein HypA [Methanococcus maripaludis S2]
2413 :     MHELSYATSVLNAILDAVKQQEELGRKVIKVNDINLEIGDLTLISLDQLQFVFEVISEDT
2414 :     ICKGAELKAEMVKPKIFCNDCEFEGNLDTKDELEVVCPKCESRNIKLKGGKEFNIVNATI
2415 :     EFDDEE
2416 :     >45357865 hypothetical protein MMP0302 [Methanococcus maripaludis S2]
2417 :     MKKEIKLKELSNNIVKSLLENPDKPVHEIMDELDIYSMNLDDEDLDLAKSLVCELLSRID
2418 :     VVSMNLDDEDIAHTMSMISLRFHMHDKYNKFEIMDVPHLQARIKDAAKYIKYVKKSNKA
2419 :     >45357866 rubredoxin-type Fe(Cys)4 protein [Methanococcus maripaludis S2]
2420 :     MSVWKCTICGYVYDEEKEGKKFSELPDDWACPICGAKKSAFVEQK
2421 :     >45357867 N-glycosylase/DNA lyase [Methanococcus maripaludis S2]
2422 :     MRNLEKINELLEIFGHFDVNFAKTMEEKIDTQYFVLENLKNSMNNDEMFIKLVILNSIVS
2423 :     YQLCTTGELWWEEFSKYWSKHDANNENLGESYVNFLENSKGNKRLLNVKIKRIERITPFL
2424 :     ENLNLLDFKTYYSDMEKLLENLSKYLNSKKNSKTVVFAVKMFGYASRIVFNEFFPYPMNI
2425 :     EIPKDSRIEKYTLKFTDENPIKFWNEVSKTAKIPPLHIDSIIWPVLGRNFDFKSCENKLD
2426 :     ENFRYLLKLTEL
2427 :     >45357868 2-oxoacid ferredoxin oxidoreductase subunit beta [Methanococcus maripaludis S2]
2428 :     MENSSFQRNEKLDISWCPGCGNFAIKASLSNALTELNLKPENVAIISGIGQAGKMPHYIR
2429 :     VNGFHTLHGRAIPAATAVKATNPNLTVIAEGGDGDMYAEGGNHLIHAIRRNPNITVLIHN
2430 :     NQIYGLTKGQASPTTLISTKTPTQPWGVFEEPLNPIALAISLNASFVARTFSGNLEKTKE
2431 :     IIIKAINHKGLSIVDIFHPCPSFNKLNTLQWYKENTYFLEDHDVTNRKKAFEKSLETEKY
2432 :     PLGIFYTCEKPVFEEVVPPYISEKTPIWKREPNLEKIEEIINLKRS
2433 :     >45357869 oxidoreductase family protein member subunit alpha [Methanococcus maripaludis S2]
2434 :     MNLEKEVSIVLGGAAGQGIQTIEESLTKILKLSGYNVFATKEYMSRVRGGINTTEIVISS
2435 :     EKQRSFLKRIDLLVTFKKGVLNHLKDRISDETIILGEKENIDEEFLNNKNIIDIPIQEIS
2436 :     KNIGNILFSNTVGSGIILGIFDCDLDFFNKYLEDKFSKKGKEIVDKNIQAAKEGYELGKK
2437 :     ILKDLDLSLNIEKNEKISNEIILSGTEAVALGAAKAGCNFVSFYPMTPSTGVSTFLANHS
2438 :     KDLGIIVEQVEDEISAINMAIGAGYAGARSLVTTSGGGFSLMCEAVSLSGMTETPVVIYL
2439 :     AQRPGPSTGLPTRTAQGDLELALYSGHGEFPKIIYAPGKIEEAHKISQIAFNMADKYQVP
2440 :     VFVLSDEYLADTYYNLSDNELESLKKENHVVKTSLDYKRYEINENIVSKRGIPGFGEGIV
2441 :     LACGNEHDEFGDITEDIDLINKMTEKRNKKLDLIKKEAIEPEFIGDETYKNLIVSWGSTF
2442 :     YPIKDALEKLNLKDTAFLHFSQVYPISDSAEKYLKNAEKVINIELNYTGQLGKLLKREFG
2443 :     IEMNDSILKYDGRVFAVEELIEKIEKVLRG
2444 :     >45357870 hypothetical protein MMP0307 [Methanococcus maripaludis S2]
2445 :     MNDDIYDEMVRERGREYFLKNMVKYCVKRGNTLHGTVYGSDKYITKVDLKTKTGICTCPY
2446 :     QYNCKHAYALLESYKSGKYVDGDELFLNFSKLDKLEILKIFESIIEKHNLWDEFITEDKT
2447 :     LLDTAKNMLELTKIEKKNVFTFTSFLRNQFLKNAGNEELLLIIPDVIKYIQERKKLEEIL
2448 :     FLIVDELFERGKTDKDTLKKLIELSRKYRELWMVKDNILDYEYFELLEY
2449 :     >45357871 SirA family protein [Methanococcus maripaludis S2]
2450 :     MELDVTGTVCPMPVLKTKKALDSLTSGDELTVTGDYKPALQNIVRFVEDKGHEVLSTEES
2451 :     SDGFKIVIKK
2452 :     >45357872 DsrE family protein [Methanococcus maripaludis S2]
2453 :     MKFTVIIGDAPYGKERAYSALRFALTALLEGIDVNIFLLEDGVYVGKKDQNPAGVPKYSE
2454 :     LLENAIEAGAVVKACGPCGKARGISEEELLDGIAFGTMHDLIAFVKEADKTINF
2455 :     >45357873 hypothetical protein MMP0310 [Methanococcus maripaludis S2]
2456 :     MFNDDKEFTLKKLQEALDNDFVDLEVMYLVDKINEFKDYYTTSSCIGRCGIIEFPKDKNP
2457 :     KINSRWLGKWHHYANYDEIDEALLKKSENFEKISFVLNSPILHVASRNADTSKKLLELAY
2458 :     HNGLKASSIKSISSKRYIVEIMTTAKMDAPIAYDGKMVVNREYLDILLDEGNLKLKHARK
2459 :     SLKRFYEKLNELQD
2460 :     >45357874 hypothetical protein MMP0311 [Methanococcus maripaludis S2]
2461 :     MLDLKGTSSKDIFPLAYAIHILVNKSPVTMRSRDKPGVRIEKGKLLDDNYEGYVLKQVLD
2462 :     CGEILRVTPICGPYAGVPVVVVPVKEEDEITGAVGIVDLTAGIFEEIHSITRRKELAKFL
2463 :     PDEAFPR
2464 :     >45357875 hypothetical protein MMP0312 [Methanococcus maripaludis S2]
2465 :     MKKVFIFPSNSLILADLVERFGHKPLMINNAIGDKVRNLEIDTPPLNITDEDPKKGLKYA
2466 :     AIEVPSGVRGRMSLIGPLIDEAEAAIVMVHAPIGFGCVGCERTNELTKYLIRRKEMPVLN
2467 :     IEYPENDEDAKVVVKKIALFLESLEK
2468 :     >45357876 hypothetical protein MMP0313 [Methanococcus maripaludis S2]
2469 :     MKKTAFMLLLVFSLVLSSVSGEIINLSENTDLFSEMKTIAMAHSKDLDKIPFATNIAKNE
2470 :     RINLNVKTNESDLFVSVIVEDGIITSFEQGSLENATMNMYTDESTVREILDSDDPVSSAQ
2471 :     SALKADKIRMEGVGIVNSIKVSVVNVLMSFF
2472 :     >45357877 coenzyme F390 synthetase [Methanococcus maripaludis S2]
2473 :     MLPNYPQKQLCWRAIMNNKQLETYALVKKLLRHVSEGSEFYKNKFSKAGINIDEISSLED
2474 :     FKKIPFTEKEELRSAYPLGLQAVPDEKIVRIHSSSGTTGSPVIIPYTQKDVDTWSEMMMR
2475 :     CYQMAGVTNKDRIQITPGYGLWTAGIGFQLGAERLGAMAIPMGPGNTEKQLQMMVDLKST
2476 :     ILTSTSSYALLLAEEIRKKGIHDKIHLKIGVIGSERWSEKMRNRIESELGIKSFDIYGLT
2477 :     EIYGPGIALDCEYHEGMHYWSDHLLFEIIDPVTGENLPDGELGELVITTLTKEGAPLIRY
2478 :     RTRDLTRIIPEKCKCGSEYPRIDRILGRADDRIKIKGVNIYPGQIEDLIHKLNGVSSEYQ
2479 :     IVLSRFEGRDSMLFRVEVDVLEKDFEETKLAIIKAFKTYIGISPDVECLKVGELPRSEKK
2480 :     SRRVFDNRD
2481 :     >45357878 indolepyruvate oxidoreductase subunit B [Methanococcus maripaludis S2]
2482 :     MNFSVIICGVGGQGVVLASRLLAITAMNSGFHVNTAETLGMSQREGSVVSHLQFGDFIKS
2483 :     SLIPEGGADLIIGLELSEVARNLHFLKKNGKIITNCKMILPSARSSNEKYDSEQIINFIN
2484 :     KYVKSTICIDFSKIAKIAGNPKSMNVSVLSAAFYTGFLPLEYNDFLKTIESEIPEKYRDI
2485 :     NLNAAKLSAETIMLEGNNE
2486 :     >45357879 indolepyruvate oxidoreductase subunit alpha 1 [Methanococcus maripaludis S2]
2487 :     MSNKHFLMGNEAIAYGAIAAGLQFGAGYPGTPSTEVMETLIKNAKKYNYYVEWSTNEKVA
2488 :     LETAIGASFSGASSIVTMKQVGLNVASDPLMSLTYLGIKGPLVLLVTDDPGPHSSQTEQD
2489 :     TRSFGLFSNIPVLDPSNSQEAYEMTKYAFKISKEYETPVILRTTTRVSHRCDDVVLEELK
2490 :     PSDENIEEFSKSSRWAIFPKLTAERHPILEKLQKTLSNKFSDSKFNFKTGTGKIGIITSG
2491 :     ASYHYVNEAISNNKELFSVLKIGTPHPFPENKVIEFTNEVDSIIVVEELDSYLEDQLLQL
2492 :     LGKQGILKPIYGKKNNIFPCCGEYSVDIVKIGINKVLDSLKLQKLEISEKLIDKNDIIPL
2493 :     PVRPPNLCAGCMHRTVFYAFKEVSKELKKHNIQTIFSGDIGCYTLGNAPPLELIDTCLCM
2494 :     GAGISIAGGISRTTKNSKNVAFIGDSTFFHSGIPAVINAVYNNADVTIAVLDNRTTAMTG
2495 :     HQPHPGTGKTALGKPTKLIDIEGILKSCGVEFVKTVSADDFSACKEISKEVIEYNGPSAV
2496 :     VFRGNCVSLVKSDKKYVIDKNKCINCKICVERLGCPAITMNDEIPEIMDNCTGCGLCKAV
2497 :     CPANAVIEVTKQ
2498 :     >45357880 hypothetical protein MMP0317 [Methanococcus maripaludis S2]
2499 :     MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDETLIDYYVTNCGDDIDMIMT
2500 :     HNKGTDNEEVHKLAWDALEAATEVAKELKLYGAGQDLLSTSFSGNVKGLGPGCAEMEFVE
2501 :     RPSEPVVVFCCDKTDPAAFNLPFYRMFSDPFSTAGLVYDPSMTTGFRYEVLDVMEHKRVF
2502 :     MDSPEETYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
2503 :     AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVAEEDAMPARFDGPARVMALGFQLS
2504 :     HGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
2505 :     RFLEMDEGCECKLDEIRERGDME
2506 :     >45357881 dihydroxy-acid dehydratase [Methanococcus maripaludis S2]
2507 :     MISDNVKKGVIRTPNRALLKACGYTDEDMEKPFIGIVNSFTEVVPGHIHLRTLSEAAKHG
2508 :     VYANGGTPFEFNTIGICDGIAMGHEGMKYSLPSREIIADAVESMARAHGFDGLVLIPTCD
2509 :     KIVPGMIMGALRLNIPFIVVTGGPMLPGEFQGKKYELISLFEGVGEYQVGKITEEELKCI
2510 :     EDCACSGAGSCAGLYTANSMACLTEALGLSLPMCATTHAVDAQKVRLAKKSGSKIVDMVK
2511 :     EDLKPTDILTKEAFENAILVDLALGGSTNTTLHIPAIANEIENKFITLDDFDRLSDEVPH
2512 :     IASIKPGGEHYMIDLHNAGGIPAVLNVLKEKIRDTKTVDGRSILEIAESVKYINYDVIRK
2513 :     VEAPVHETAGLRVLKGNLAPNGCVVKIGAVHPKMYKHDGPAKVYNSEDEAISAILGGKIV
2514 :     EGDVIVIRYEGPSGGPGMREMLSPTSAICGMGLDDSVALITDGRFSGGSRGPCIGHVSPE
2515 :     AAAGGVIAAIENGDIIKIDMIEKEINVDLDESVIKERLSKLGEFEPKIKKGYLSRYSKLV
2516 :     SSADEGAVLK
2517 :     >45357882 precorrin-2 C-20 methyltransferase [Methanococcus maripaludis S2]
2518 :     MVDKIYGIGVGPGDTDLLTLKAVNVIQNADTIFVPISKEGKASVAYDIIKTIIPENKKVV
2519 :     ELLFPMSKDVEFLQKHWNNAAEKVMEENGTVAVVTIGDATLYSTFSYVWHIFNENNIDVE
2520 :     IINGISSPFAAAGVLNIPLVEGDEKLAILPQGKDLEKYLEEFDTLIVMKTNDLEEKLKNL
2521 :     KDKKDNYLVGVVNRVTSKNQKTALGKIDEIDFEPFKDYLSLAIIKKLK
2522 :     >45357883 shikimate kinase [Methanococcus maripaludis S2]
2523 :     MRCSAVSLGSGTIINAIATGFGSAFGVDLKIKADVELIDNGKKIVNGISIDNPTLKPSLV
2524 :     ERCVKNVFDHFEVDYSAKISTIGDIPIKSGLSSSSAASNAAVLATIGALGEKVDPDLVLD
2525 :     LAIKSSFEENLTVTGAYDDATASYFGGITVCNNMERKILKKDKFKEDIKVIVLMPEFKKN
2526 :     VDVNRMKLIKDYVDMAFEKCMNGDYYKALFLNGLLYSSALNFPSNISVDALEAGAITAGL
2527 :     SGTGPSYVALCYFEDEKNVENALKKYGETTITKPSNDGAKILY
2528 :     >45357884 hypothetical protein MMP0321 [Methanococcus maripaludis S2]
2529 :     MKYEVVITSGNSNQAPIGAFFKGDFVTLHLYGGSHTFENLQKDGFYILNTCSPYLIAKSV
2530 :     LDDAGDYEYLDNDGIKIPYLKDSYKIELIEIKSRKIVETKNEFGSSKLMIVEGKPIFEKI
2531 :     LNCNTSAYNRADGAVVEMAVLYSRKNMISKEEINDEITRLMKIIKKVGSKNHIELAKKLG
2532 :     V
2533 :     >45357885 replication factor C large subunit [Methanococcus maripaludis S2]
2534 :     MEEWVEKYRPKSLNDVAGHNKTKQALIEWIESIIGGQNQKPILLAGPPGSGKTTLAYAIA
2535 :     NDYAFDVIELNASDKRNKDVISQVVGTAATSKSLTGRRTLIVLDEVDGLSGNDDRGGVAE
2536 :     IIKVLKTAENPVILTANDVYKPALMTLRNSVNLINVGSVHTNSIPPVLRRIALKEGFEID
2537 :     EKIIKMIASHSGGDLRAAINDLQSLATGGSIEIEDAKELPDRDSEKSIFDAMRIIMKTTH
2538 :     YDIATSATRDVKEDIGTIEEWISENLPKEYLKYKDLAEGYDYLSKSDVFLGRVYRRQYFG
2539 :     LWRYASALMTAGTALAKEEKYRGFTRYGPPAIFTKLSRTKGSRQKMKDILKKIALKTHTS
2540 :     TKRARNTVDYLTVIFESNAEVSAELVEYYELTKDEIEFLTNKTITKKILSVIAGKKPKVK
2541 :     KETPKKTEKPKEVMPIIPKRPRISEPPKEPLKEVIEETLEKSVEKADTKEEKKKDPKKQA
2542 :     TLDSFF
2543 :     >45357886 hypothetical protein MMP0323 [Methanococcus maripaludis S2]
2544 :     MVFCIKVNFKLGEKTRKIMLDNHLLSKSYKLKKEGEFLYIPLTSSNFDKKIFEDENIEFE
2545 :     ISELDENEISKINSEKKTSFKDYLLKNFKDEVEGNSIAHAYDIVGDIVILQISEEITPEI
2546 :     RKKIGENALKLIPSVKAVFRRESDVKGDFRVRDLEHLAGEEKTLTLYKENGYRLLVDVAK
2547 :     VYFSPRLGWERKRIMDLVTFDDIVVDMFCGVGPYSIACKNAEKIYSIDINPDGIELLKQN
2548 :     IVLNNLENKIVPILEDVRNVDVKGTRVIMNLPKYAHQFVDKALEIVEDGGTIHYYTVGAD
2549 :     FDEGIELFKSKCECEILDKRIVKSYSPREYVFVIDFKILKKN
2550 :     >45357887 hypothetical protein MMP0324 [Methanococcus maripaludis S2]
2551 :     MKYLRGHSFEEFVEKIENLDAEEDAIYINTELSKNIIIEILESCEVKKIILPESKFKRTN
2552 :     KKVLGALKEIGIEVKSIKPVTGRPTSKKEIVEKYIEKTPKEISEITQIPLKTVEYHYYKI
2553 :     KKAISQ
2554 :     >45357888 glyceraldehyde-3-phosphate dehydrogenase [Methanococcus maripaludis S2]
2555 :     MANVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEAKMAVEKGYKLFAAIPERKHL
2556 :     FEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKHGVKAIIQGGEKAGDAQDS
2557 :     FNSLWSYDRCYGKDYIRLVSCNTTGLCRSMYAINSVADILKARIVLIRRAADPNDIKTGP
2558 :     VNAIVPNPVTVPSHHGPDVVSVIPELDGKIMTSAVIVPTTLMHMHSIMVETSGTNRDEII
2559 :     DALAKTPRILTVKASEGFDSTAKIIEYARDLGRSRYDLNEIAVWEESVNVVDNEVYMMQA
2560 :     IHQESDVIPENVDCIRAMLEMESDNLKSIEKTNKALGLIK
2561 :     >45357889 methionyl-tRNA synthetase [Methanococcus maripaludis S2]
2562 :     MRHLVTTALAYTNGPLHLGHARSTYIPADIFTRYLKLKGEEVIHVGGTDNHGVPITLTAE
2563 :     KEGVKPIDIVDRYHNAIKADLDSLNICFDNFGRTHSDIHIETAQEFYSKLKENGYIYEKE
2564 :     IEQFYCEKCDMYLADRYVEGICPFCEGEARGDHCEVCGRHLEPTELVNPYCIHCNSKPEI
2565 :     KRTTHYFFKLSAMQDSLKEYIENSPEMPEHVKNMALRWIEELHDWDVSRNIKWGVPIPGC
2566 :     DDQVMYVWIEAPIGYVSFTKQLGDIWKSYWLENTDDSKISHFIGKDITVHHAVFWPGILK
2567 :     GIGGYKMPNAVVSGGYLTLENKKMSTSKNWVVWVKDFVENFSSDYLRYFFMINAPLNRDT
2568 :     DFSWDDFQKRINTELIDIIGNFTHRTLVFTERKFGSTPIVDLNQLKDEDKKLISKCDDTE
2569 :     KLVDSLIREYNFKDALMEIIHLAKEGNGYFQGMAPWAIKNEERLKEVMYTCSVVLKYIIY
2570 :     LLSSFMPEKTALLLEYMNEELDLKVRGNPLKKPKVIFTKVSDEDISRMKENLMKATKKAE
2571 :     TKSDEKSKKVKSGEKMDIIDIDYFGNIDLRVGQILEVEEVPRSKKLYKIIADLGDEKRQI
2572 :     VSGLIGAYDAEELVGKKVIIICNLKPAKLCGVESQGMLLAAEDDSIVSLLSLDRDLPVGS
2573 :     KIH
2574 :     >45357890 thymidine phosphorylase [Methanococcus maripaludis S2]
2575 :     MLFLNAKFIDLDLGENAVIVNEDDLKGTSYYPQDRVLIESHAGSVIGNIYSTKTMVQKGE
2576 :     VGMLVSELAEISISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
2577 :     NIELSAFVSSTYINGMNMDEIGEMTKRIAETGDMISWEKNLVVDIHSIGGVPGNKYALLS
2578 :     IPILAAAGITIPKTSSRAITSPAGTADVMEVLTNVELKEDEIKRIVKTTNGCLVWGGGVN
2579 :     LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYSVIDIPVGKGVKIKNEAEGAKL
2580 :     ARKFIELGELLNIKVECVLTYGGQPLGRAIGPALEAKEAIEALQDPKNAPKSLIEKALSL
2581 :     AGILLELGGAAQIGEGQNLAWEILESGRALEKFNQIIIEQGGTPKKPEEIELGDYIEEII
2582 :     APIDGYVTDINNTGITNVVKEAGAPRDKKAGLLLNSKIGNKVKKGDVLYTIYSGSEERLV
2583 :     SAVNLARRVYPVKVEGMLIERISKF
2584 :     >45357891 hypothetical protein MMP0328 [Methanococcus maripaludis S2]
2585 :     MNGMLLIREFIYRYYIYPIDTKQGYNLIQEITYGILLFVMVYTFYRMCLKLKIAIDRRFA
2586 :     EVTVFYVILITLMRALVDAGLFPRLYYTVTPGIVVAVGIYYMLSIIISGILLKKRYYLLS
2587 :     IAMAVVPILYMLFEFSSRITHPEAIVYVSGILVLSYYLLIYIVEKLKKAKIERIDKYAIF
2588 :     SQLVDASATSVGIGVFGYWEQHPVPRFFMDYFGPYSIIPLKMLVVLLVLDIFNKEVKDDN
2589 :     LRNILKITVMALGLAPGLRNLFRTVMGV
2590 :     >45357892 hypothetical protein MMP0329 [Methanococcus maripaludis S2]
2591 :     MAEPEYNEEINMEVTEEKMREYMDNEVDEGDYIEVYFGRCHVEGTIDSKEGTHYRVDTDN
2592 :     KTFGLMEFDIENISRDVLEVAHIPENSNKKIILSVL
2593 :     >45357893 precorrin-8X methylmutase [Methanococcus maripaludis S2]
2594 :     MGAVTKDGKEIADRSREIVKTKISEVLGKNVVLYSKDEMGIIERVVHATADPEYSKLVNF
2595 :     DNKPIEHGLKAINDESPIIADISMVKAGIRYEDVLCTISEKKVFEVAKKEQVTRAVASIR
2596 :     ASKELIDGGIVVIGNAPTALLEVIRLNKKEGITPKLVIGAPVGFVKAAESKELLRTTKIP
2597 :     SISTIGPKGGTPVAVSAINGIIALSKNERI
2598 :     >45357894 histidine triad (HIT) protein [Methanococcus maripaludis S2]
2599 :     MCIFCDIVKGDIPARIIYEDDKFLAFMDAFPRAVGHTLIIPKEHFETFDELPKELACEMM
2600 :     EVIHKIVKKLEKLEMDGYNLLNNNKQVSGQEVPHVHFHIIPRYENEGYPVYVLKDPINVD
2601 :     LDSIYDRIME
2602 :     >45357895 hypothetical protein MMP0332 [Methanococcus maripaludis S2]
2603 :     MYLSKVHIENYRSIKELDLTFDQGKNVIVGKNNAGKSNIIKAIDIVLGERVPDWNKYENI
2604 :     SKSDFFNADTSEDILIVCELSKEHGENLKFSNVNNSAFFKVCKSNNEQYHVNDLSDIDRI
2605 :     FYFTSEKGSIDLDSGIYRKIWIGGKNYCKIDYDDEFSNVDRYALVFRARFEENVIKKDLV
2606 :     LLYKKDDEEEWTVGINANSLRGNLIQSAIIPSFRDPKDQLRINNYTWFGKLLKEYTKGRN
2607 :     GEGIKEALKNLATESNQVFEELQKSVCNDNIQIAFPNTSFSVQYNPDPKDQDIYKSALIY
2608 :     VDDGFKSELKDKGSGIQSAMTIGLFNFYIKHIAHNSGSLLAIEEPELYLHPHGRRIISDR
2609 :     LSEFIGEDENQVILTTHSPEFICCANENINLIVVKKDKSESKAYNLQFNDIKTRQILIKK
2610 :     QNSEMFFADAVLLVEGADKYILEEFSKEYGETKQVKSESELLGKNWLNNYNVSIINCGGK
2611 :     TELQKYVAVLNNLSIPNYTLADFDFFRNDLNSYLQFLGFNDLKNELNGLKSKFTFLNKGK
2612 :     CIDDVPDDFKKDVIEYLKKLHEINLYILSGELENFYFKKPYHSKEQGVLELICKTLCENR
2613 :     GITEYVNTDEFEELFDLFLKKCLKLN
2614 :     >45357896 hypothetical protein MMP0333 [Methanococcus maripaludis S2]
2615 :     MDMLLKIIYSAAITGLLAALIYKKKYLDKWGIFGSSVMAFTILFLADLKWLLLLISFLVL
2616 :     GSLVSKMGYGFKKTIKMAESRRSLKNVLANGLMAILFVLAYSSGFITEEIALVGYVGAIA
2617 :     AANSDTFSSELGMLSRETPRLISNFKTVKTGTDGGITVCGTFAGLLGSFLIGLLAYALFN
2618 :     DILMFWTATISGMIGNFADSFLGAFFERKGILNNEHVNFMATLSGGTFAVLFYQLVL
2619 :     >45357897 RNA methyltransferase, TrmH family, group 1 [Methanococcus maripaludis S2]
2620 :     MKTVVILVNPKYGGNLGAIARNMMNFDVEELRIVGTPEILDDEAYIRAVHAKNILNNAKF
2621 :     YSKLEDAISDIDFTVATTGAVCGDRNVNRVPITPRELAKKHSSISGTLGIVFGREDDGLK
2622 :     NEDVELCDILVSVPTSNKYPILNLSHAVSVILYEIYFESFSKDIPYDLNMKNASVDEKNA
2623 :     LLRFFNEFVDRSKDVPDYRKDICKTIFKRIVGRAFISGKEANSLICVFKDKCPK
2624 :     >45357898 hypothetical protein MMP0335 [Methanococcus maripaludis S2]
2625 :     MSISGAQGKSLVLKYENNEIIFNLSNEEEGLLDTVSMDLETSALFVTLLNHGVVSAEEIN
2626 :     RKFKKEGIKLQKIQDVGTCFANESRVSIAILPADEKRTASILIGIHKEDEHSSIIIKPKR
2627 :     AAYLSISITKMLINTME
2628 :     >45357899 Holliday junction resolvase [Methanococcus maripaludis S2]
2629 :     MAHKYQKGSTFERELKKKLESHGFAVIRSAGSHGVDLVAGKKGKKPIVIECKSTSKDKYY
2630 :     IPNEDVEKLLEFSKTFDGIPFIALKINRKCLFINPHLLTSAGKNYALDYEKLCPIALDIK
2631 :     DVAEDSIQKKLDSEM
2632 :     >45357900 hypothetical protein MMP0337 [Methanococcus maripaludis S2]
2633 :     MKSKVIVLAEDSKTSPSRLFRYLNSLEYDINVKETCFGAFIEGEDGVVDEVVKLVRDLEK
2634 :     NKIFCKDRGFPIWDQRRCRAFRKGGPREGFHQLEAEQKILDRISKALDAVENEEISEEKI
2635 :     EEEFKNLKNKKLKVDAFEKIADEVLKEN
2636 :     >45357901 hypothetical protein MMP0338 [Methanococcus maripaludis S2]
2637 :     MPIISINENGFLDKLKGTNGLFSCVISSIETTKYVGISGVNKSVIDYTPAADMELVTIGE
2638 :     SLSLNHPPIDATGCPSPATITRAAVDILKIPVMTVDAGSYIKPKIPYISVDQRPTGDIQK
2639 :     GLGMDNSKELLNLGKIIGNNNIYDSLVIGESVPGGTTTALGVLLGLGYDARDKISSGSVE
2640 :     NPKDLKLSVVESGLKNSKSKDVFDVLNAVGDKMMPVVAGMAISAVSKGKPVLLAGGTQMA
2641 :     SVLAAIKEISPKILKSGLLGISTTEFVLNDKNADLKDIIEQIGDIPLYASKFGYENSKID
2642 :     GLKAYCNGSVKEGVGAGGIATYCYSNGLNPKDIREYVEKNYEIWYSKLIQ
2643 :     >45357902 NUDIX hydrolase [Methanococcus maripaludis S2]
2644 :     MEYNLLLKIKDESMEKEVLDELLNFLDKKYAGKVVAEPYRRINLTVDILIKYNFGIVLIK
2645 :     RKNEPYKDYWAVPGGFVEYGERVEEAAKREAKEETGLNIDNLTLIGVYSDPNRDSRGHTV
2646 :     TVAFLADGIGTLKSGSDAKDARIFNLDELNGVDFAFDHKKLINDSIHYIFD
2647 :     >45357903 pyruvate carboxylase subunit B [Methanococcus maripaludis S2]
2648 :     MVKITDTSFRDAHQSLMATRLRTEDMLPIAEKMDEVGFYSMEVWGGATFDSCIRYLNEDP
2649 :     WERLRELKGKIQNTPLQMLLRGQNLVGYRHYPDDVVDKFIQKSIENGIDIVRIFDALNDI
2650 :     RNVEYSIKAVKKYGAEVQGAISYTTSPVHTTEQFVELAKQFEELGCDSLCIKDMAGLLRP
2651 :     FDAKELVGMLKEELSIPIDLHSHCTAGIAPLAYMSSVEAGIDILNCAMSPLSMGTSQPPV
2652 :     ESIVAALKGTKYDTNLDLVLLTEIRDYFDEIRNKYKCLINPISERVDARILRYQVPGGML
2653 :     SNLVSQLKEQGALDKFEEVLNEIPNVRKDLGYPPLVTPTSQIVGTQAVMNVLTDERYKII
2654 :     TNEVANYLKGYYGKSPAPISKDLVKRALQDGEKQITCRPADLLEPEYELMEKEAFAKGIV
2655 :     SKEEDILTYALYPQVAVKFLRGELKAETIPQEKDVSKFMEIPNEYIVEVDGDSFNVKVEP
2656 :     VYSSGIKKEEKKEIITAETEGAVTSPFRGIVTKIKVSTGASVKQGDQILVLEAMKMENPV
2657 :     ECPVDGTVEKIIVKEGQSVNVGDILMIIK
2658 :     >45357904 pyruvate carboxylase subunit A [Methanococcus maripaludis S2]
2659 :     MFKKVLIANRGEIAVRVIRACKELGIKTVAVFSEADEHSLYRNIADECYPIGEPPASKSY
2660 :     LNMERILKVAEKAGVDAVHPGYGFLSENVKFADECHKRGIEFIGPPTNAIDVMGSKINAK
2661 :     KAMKTAGVPVLPGREESIESEEEAIEVADEIGYPVIIKASAGGGGIGMNVVYNKEELVDT
2662 :     IQSTKSIAQSAFGDSTVFIEKYLEKPRHIEIQVVADKFGNVIHLGDRECSIQRRHQKLIE
2663 :     ESPSPIMTEELRERMGNAAVKAAKAINYHSVGTVEFLYSKGEFYFLEMNTRVQVEHPITE
2664 :     VVTGVDIVKEQIKIAAGKKLSYTQDEITFRGHAIECRVNAEDAINDFVPAPGKIKYYRSP
2665 :     GGPGVRLDSGVFGGAEIPPYYDSMVAKIITYGLTREEAIERMKRALSEYMVLGIITNIPF
2666 :     HRAVIEEDNFLKGNLSTHYVEDNLCSFRKAMVNYALEAKDREKIFSEKVFHGNKKVIAIA
2667 :     GGLNAYITSLSNKNKDKYDKN
2668 :     >45357905 hypothetical protein MMP0342 [Methanococcus maripaludis S2]
2669 :     MGFSEIYGVAFLSIILLISITVIYGTVDSNLNNILSANDDHAYNLLKKSKENLTVQYEGI
2670 :     DSDSGILNITVVNNGNILEDASKWTVIFEGDVVNNPVIEKTYIEPLSRTQIYIETIYNST
2671 :     TIDDKRVVISGEFGTTFLKTIDVN
2672 :     >45357906 hypothetical protein MMP0343 [Methanococcus maripaludis S2]
2673 :     MKIASLYSGGKDSAYALFWALNQGWDVNYLVNVASKNKESYMFHIPNVELTDLVSESTGI
2674 :     EMIKVITKGEKEKEILDLQKNLEKLDIDGIVSGALASEYQRARIDHICEEIGIKSFAPLW
2675 :     HKDQELILRDTSKFFDFRMVSVAAYGLDKKWLGKRIDETNIEELLKIMEKYQINKAFEGG
2676 :     EAETFVFDAPFFEKKIEVLDYEIIWDGISGSYNIKDAELVSKK
2677 :     >45357907 hypothetical protein MMP0344 [Methanococcus maripaludis S2]
2678 :     MVKKIVIGVFCMISLLLLCGCTETDSGDQALDEVDSGDENIVSDDAEYIGTFYAAKTDDS
2679 :     LKFTLIFNDAENKLVTATGTAKLNIYDDYDNKIFEKEYVVDPSKAGTNSKYTLIVSLDDI
2680 :     EKGMTESGYAEVIFTSKTGKVINKITNSIQIPYYTEEEILNIAEQEFLENAVESGDSYEL
2681 :     DDVEITILRSGFYTIYGEKSEKIFRVDLKIENKYGQPKDFTPSEVVVYDKYENRYRYVSG
2682 :     GSLDEFSEIPSLDTIEGYWFFEEVPENMENPRLFFKNGRDDNGEWLIYDFNLK
2683 :     >45357908 hypothetical protein MMP0345 [Methanococcus maripaludis S2]
2684 :     MNFQKIALFLVLLISISCFSGCMDNSGEVSEPVTIKMAGGTALIPIIEDISKEYMLENSN
2685 :     VQIEVTGGGSGFGVKETGEGHLTIGMAGRNLKSEEKELYNDITVYKIGLDGIAIITSNEN
2686 :     NISDLTTEQVQKIYSGEITNWKSVGGSDSTINVYTREEDSGTRDTFWKEGLLQSNISKKA
2687 :     LMVASNGEMKSKVSSDANGIGYVSIGYVDESINTVQFNGVEPTQENVKEGIYTIYRPLNL
2688 :     LTKGEPDENVKKFIEYVLSEKGQEIVKNDGFLPVN
2689 :     >45357909 2-hydroxyglutaryl-CoA dehydratase subunit D-like protein [Methanococcus maripaludis S2]
2690 :     MEELKSIKKISEAFAGRKNELYGQKDEGRKVFGLFCTFVPTELILAANAVPVGLCGGKEG
2691 :     TIPSAEEILPRNICPLIKSSFGFKKDKACPYIEASDVIIGETTCDGKKKMFEHLAEMTRL
2692 :     HIMQLPHFRDDRSAKLWLAEVEELKKLIEEETGNKITEEKLKEAIDKVNNVRKLFYKIYE
2693 :     LRANNPSPINGKDSLKLFQLSYLLDINTIESVLEDLVEELEERVKKGEGYSGKRILIAGC
2694 :     PMVAGNTKIPELIEDTGAVVVGEESCTGTRQYENYVEGYTIEKLADRYFKIPCACKFSNE
2695 :     ERIERIKELVKEQNADGVVYYTLQYCHTFNVEGALIEKELKKAGIPIIRVETDYSESDKE
2696 :     QLKTRIEAFVEMI
2697 :     >45357910 hypothetical protein MMP0347 [Methanococcus maripaludis S2]
2698 :     MNGELFLILIISQLVLWIFVTKIGLGKSVSFVFGSILIILAYYRLLFMDPNIELVCSTNN
2699 :     FGIIKNGIINCSLSSKELFLVAIIPWVGYLCNAYVLKAKQFTKF
2700 :     >45357911 GPR1/FUN34/yaaH family protein [Methanococcus maripaludis S2]
2701 :     MQEKYTTIFDTSANPAPLGLMGFGMTTVLLNLHNIGLFELSSMILAMGICYGGLAQVIVG
2702 :     IMEWKKGNTFGTLAFTSYGLFWLSLVVILTLPKLGLGNAPSPLEMAFYLGLWGLFTLGMF
2703 :     FGTFKTNRALQFVFGTLTILFLLLATGDITGNLTVTRVAGLVGIICGSSAIYTGFAEVLN
2704 :     ETYQKTVLPIFPVTKKP
2705 :     >45357912 2-hydroxyglutaryl-CoA dehydratase subunit A-like protein [Methanococcus maripaludis S2]
2706 :     MILSIDIGSTTTKFVLMENNEIIDYKIKDLGVVIEESDVLKMVEEFKKGRNIEKTVATGY
2707 :     GRHKISFADKVVPEVIALGKGANYFFKDADGLIDIGGQDSKVLKLKDGQVIDFILSDKCA
2708 :     AGTGKFLEKCIDILNLDKELNEYSSPNYAKISSMCAVFAESEIISLLSKKIPKEEIIMGI
2709 :     YDSISNRIVPMVKRMNLENIVFSGGVAKNKILIQVLEKHLGKTLLIPEEPQIVCAVGACI
2710 :     MALEKP
2711 :     >45357913 hexapeptide repeat-containing transferase [Methanococcus maripaludis S2]
2712 :     MGSYQAHPTAHVENNSKIGDNTRIWHFSHIRENSEIGKNCNLGKGVYIDTNVKIGNNVKI
2713 :     QNNVSVYAGVEVEDDVFLGPHMVFTNDLYPRAFNNNWKIVRTKVKTGASIGANSTVVCGI
2714 :     TIGNYAMIGSGSVVTKDVPDYALVYGNPARLNGFVCTCGKKLENMVEKTEKLVKYRCSNC
2715 :     STIVEIKKEDHDLLGD
2716 :     >45357914 DegT/DnrJ/EryC1/StrS aminotransferase [Methanococcus maripaludis S2]
2717 :     MIPIAKPILGNEEISAVTDVLKSGMIAQGKEVELFEREFCEYHNVKYGLAVSNGTTALDV
2718 :     ALKSLKVSSGDEVITTPFTFIASSNCILYQGAKTVFADIDEKTFNIDPNEVLENINSKTK
2719 :     AIIAVHLYGQPADMKALREIADDHKLFLIEDAAQAHGAEFEGKKIGNFGDITTFSFYPTK
2720 :     NMTSSEGGMVVTNNPEIAKISDLIRNHGQAEKYLHTALGYNFRMTNISAAIGRVQLKKVE
2721 :     EWTEKRIKNAKELSKRLSKIDGLSIPYLDKRVRHVFHQYVLRVEADFSLSRDEFSRYLNE
2722 :     NGVGTGIHYPIPVHNQPVYQNLGYDKDECPNSIDAAKKVLSLPVHPSVSLDDIEYITQKI
2723 :     ENRGGVN
2724 :     >45357915 putative oxidoreductase [Methanococcus maripaludis S2]
2725 :     MLKVAVVGIGVMGYNHARIYNELQKDGNVELVGLSDMNKDRLNEVSEEFGVKAFSNYMDL
2726 :     LEEDLDAVSIVVPTFLHKEVALPFIKKGISVLIEKPIADTIENANEIIAEAEKNNVILSV
2727 :     GHVERFNPAVLKLKEHVEKGNLGDIVTMTAKRVGPMTTRIADAGVILDLAVHDIDVMAFL
2728 :     ANSKVKHVHALAKNVKHPNNNAEDYALIISSFENSIDGIIEVNRLTPHKTRTLNIVGTKG
2729 :     IAYLDYMNQDLTLYDEEWVKTAKINKEEPLKKEIAHFVDCVQNNKQPLVTGLDGLNALET
2730 :     AIYALKSSNGN
2731 :     >45357916 UDP-glucose/GDP-mannose dehydrogenase related protein [Methanococcus maripaludis S2]
2732 :     MNELGNLKIAVFGQGKMGLPLASVFAEYGINVIGVDINQMVVDNLNNGINHITEEPGLSE
2733 :     LVSKNVENKKYTATTDGVGAATDADIIVILVPTLIDDRGNIKLDPVYSVSEIISKGLKKG
2734 :     NIVITEATMPPGTTEKLIPILEKSGLKLGEFGLAHAPERTMTGTALRDIKGQYPKIIGCS
2735 :     DERTHNIVSKLYDLINKKGTIKMSSIKAAETVKVFEGVYRDVNIGLSNEMALWCEEHSIN
2736 :     ALEVFEAANTQPFCHFHTPGAGVGGHCIPVYPWFVINTSNEVNPRITKTARELNDYMAHH
2737 :     IVELTIKGLNEFKKCLNGSKILVLGLTFRGGVKEFMKSAAIPIINELNSLGANVYSYDPL
2738 :     CDELDAKKYNSKLKTDFNGIDAIIVTSDHEEFKHLDFEKISKEVSTKLIVDGRNIINVSN
2739 :     ATENGFRVIKVGNLK
2740 :     >45357917 putative oligosaccharide transporter [Methanococcus maripaludis S2]
2741 :     MDLKKKVLLNSSQLFGGQFLHSIISYAIVLMIGRTFGTEGLGQYSFIIAFTAFVAYIADF
2742 :     GIEYYLLREIAKDNQNYDLISKSFGIKVFLGILCWFLIVFLTIFINKDPLVKLAIIIYGL
2743 :     ASICSSIGLLFKSIIHANMVSKYESISILTERILTLIVGGVLLYFTKNLFLFMVVLTLDI
2744 :     FILNILRYNYASKYAKIRLKFNLKDGINILKKSYFFWFIYVFSFIYYNTDILMLGIMQSD
2745 :     SSVGIYRGGYFFIQAAMIIPVVVISTVMPSISILHTENRELLKTLFKKAFIFLSFLGISL
2746 :     NLVLFIGSQSFIGLFFGNEFVESILVLQIMSFSIISIFLNSLYGSLLNATGNEKKYAKVL
2747 :     GFSAILNVCLNFLLIPSMSYAGVAVSTLISNWVVTVILMFSCGRVINLKRL
2748 :     >45357918 hypothetical protein MMP0355 [Methanococcus maripaludis S2]
2749 :     MIPLHKKMLLIIYLILVPTILINIYENSIDDFIPKHMAVAYQMSNDQLTSEGKYIYDQIP
2750 :     GFYAFITTFNQVVGISSYEMSSYPITLYPYFAIVLLATYILSDKNKMVSALLTLFYMSIT
2751 :     TTGTLKIFLWPHGIGGLLFFMLVVTTYKVIKSPKLKNSYLILCILATVSITFISYNFTYY
2752 :     CIVYLFSLSILQWIFKKPSEVFINTLLILLGTLMGFSSFVYGHAKPLLELSNSLYILKTF
2753 :     ERFLINFFDIGHVNLDPIQNYLMTYPQLLTHIFLTKYVLMIPILTISIFSIIYAETHKKI
2754 :     ESVKFNLVLSVCLAVTLFILTRLTIGHFSIPEIWYIFMVALPISYPLLKKRPKFLIKVSL
2755 :     IILIILNFSAIIVSNASEVVQKDEYSYIVNAASWLYQKEPQNRIYTPDQLTYGWTYLPCT
2756 :     LKFNNWNEPKYLGIEDILNIYRGKKISSSGYIIINYRAKYNALSGWDNTQSFKNFRTVIE
2757 :     PLDYDKIYSNNEDITIVLN
2758 :     >45357919 glycosyl transferase, group 1 [Methanococcus maripaludis S2]
2759 :     MLKKRILVIAPHYNSFVKGQVDEISKSVEHIDLLIKYNPLTEISNYIPHKNSKHFQNFRK
2760 :     KNLATFKDKPSNVSVHLIPTVYFKPDGKNKKLGDMLFKKFDKYIQKNNLNFDLIHAHFTW
2761 :     PYGYVAMKLKEKYNKKVILTVHENRNWLIKEYESKNKKFITTWKNSDVIIRVNKKDIPLL
2762 :     KRYNENTVNIPNGYDEIIFKKIENIDKIKEDLNIPKNKKIILNVANYVIPHKNQLNLVKA
2763 :     VYELQKKRKDFILYLIGNYTGDEKKIINLIDELNLKDVVKVLGPKPHDEIPLWMNVADLF
2764 :     VFPSYSESFGVVNIEALACATPVISTINGGSEEIITSEEYGFIYTNPEDYEKLAELIDKG
2765 :     LNKKWDSAKILEYSKEFTWENISEEILNLYSTDI
2766 :     >45357920 UDP-N-acetylglucosamine 2-epimerase [Methanococcus maripaludis S2]
2767 :     MKIVTIVGARPQFIKLAPVSKEIRRHFEEIIIHTGQHYDFEMDKIFFDELEIPTPNYNLN
2768 :     IGSGSHGFQTGEMLKKIEEILLKEKPDLVLVYGDTNSTIAGALAGSKLNIKIAHVEAGLR
2769 :     SFDRKMPEEINRVLTDHISNILFTPTETADINLKNEGINSGIFNVGDVMYDSLLNALKLI
2770 :     EKKNFKILDELNISKKKYILATVHRAENTDIKENLENIINAFIESNEKIIFPVHPRTRKY
2771 :     LEKYRLFEKIKNYDNLKLISPVGYLEMIYLENNAKKILTDSGGVQKEAYFLKVPCVTLRN
2772 :     NTEWVETVLDGWNILVGSNKEKILENISKFNPASETYNYRFGEGNSSVKIVEVLRNL
2773 :     >45357921 hypothetical protein MMP0358 [Methanococcus maripaludis S2]
2774 :     MNIAIFINTPAQFHFYRNIAKELKNRGHFVELLFRDYGENLEIAKELGLNPTVYAKPSDS
2775 :     KYGKILSLPSDVLRATKLLKKFKPDIITGFGVYDAFSSFLVNVPCIVFNDSEPFINSSYA
2776 :     VQFKLFMPFTNVLITPEAFQPNFGTKHINIPSYKEFSYLHPNYYTPKEDIFELIGIEKNE
2777 :     EYILLRFNAFDAVHDAGITGFTKENKIKLVKELEKHCKVFISSETQVPKEIEKNILKTPK
2778 :     SRIHDVLYYAKILITDTQTMTTEAALLGTPALRYNKFVGGKDMSNFIELEKNYGLIFNYQ
2779 :     NSEKIFERAFELLNTENLKEIWKKKRELLLKNKIDSTSFMVWFFENYPESFEKMKTDVTI
2780 :     YENFNDNLAKIKG
2781 :     >45357922 glycosyl transferase family protein [Methanococcus maripaludis S2]
2782 :     MKTLIIIPAYNEELTIGSMILLAKEYGDVLVIDDCSTDKTFEIAEKSAKVIKHTINKGKG
2783 :     HALKTGFEYALNSNYDIVVCIDADGQHDPKEIPKLCSPLKNKEADLVIGSRYLNKTHRKI
2784 :     PAYRKLGLYILNKSTNLVSKSNISDSQSGFRAYSKKCLLNSDLNFSSGYGVESELLHELS
2785 :     KKKLHIKEVDINVRYDVPHKHKKNPVLHGLGVLYNIFLMFGKKAY
2786 :     >45357923 hypothetical protein MMP0360 [Methanococcus maripaludis S2]
2787 :     MNLKKTWDLVLIIFLSITLNFFIFFSPENPLRIVLGLPFVLFFPGYVFINLLFKKENSLE
2788 :     NIERFALSFGLSIAIVPLIGLLLNYSPYGIRIIPIMISITLFIMLFAIIGIYNRNTVNEP
2789 :     WFPKINIEELKNDFEWKTSSKLDKFLTVILIISVIASVMTLGYVISAPKQNEKFTEFYLL
2790 :     GPEGKAYDYPTNVFTNEKNEVIIGLVNHEGKSVNYSIEVWLVNLTYDMNINQTNISNMYI
2791 :     MDEIPVNLDNRPVHIDENWTKQWETNYNFSIDTSGKWQQWYLLFKNTDKEEFETLKSLTP
2792 :     EEKIKFALNGSIQSLKLNINVND
2793 :     >45357924 hypothetical protein MMP0361 [Methanococcus maripaludis S2]
2794 :     MKNITVTSLIAAIIGGIYFKTFFPILLIIFYIRDTRFKNSFLFLFTIYMLIFGYFFNPSD
2795 :     FSILLIISMIVIPHLLILFELLLEIKQKYEKIDILIIICLLCGIPYPEIYIFGIVLLLIK
2796 :     RFNNFLNKKIGIILIPTIISLLIFIKHLDMLNQNLIYKILVLTGPGVVLYSIYSFLNKES
2797 :     MNNK
2798 :     >45357925 hypothetical protein MMP0362 [Methanococcus maripaludis S2]
2799 :     MEKQDFLAYVSILLFLEGYLFVNILPTLFGITILLFILLLKFSFDPVFETRLQNSEFEVV
2800 :     ENESFEIKLNIKNNSKCPLNFKIKENNDNFTWESNNVLILPKKSAEILVSLTPKSKGSFV
2801 :     IENMDLIVSDSFGIFKKICQIKTSINIDVYPSNESIIEGIKINKNKKLGKESLLSSKTGQ
2802 :     RTSEFDYLRDYNLGDQFRHIDWKSSLKSGRLISKEFLREFEGEITVIIDTSKNFLKDFNG
2803 :     GTLKTDYVSILSFQIIYYLIKNHKFANVLFFDESGHVTLKNNIKTKESLKKCMKNKLTSE
2804 :     KGIPYIPTSKSIISEKTAFLDILKPFLKNSPEKCLSILKYVKPNSTAIIITDISNYNEII
2805 :     TLNSELAKKNSKLMVISPNPFLFGLEELNTEKIPEIYNRYLKREKNMIKLNKICPAVDVS
2806 :     PNDLADHIIGEFK
2807 :     >45357926 methanol dehydrogenase regulatory protein related protein [Methanococcus maripaludis S2]
2808 :     MEGKEFLSKIETEISKCVVGKENIIKLLLISMLSKGHVLLEGIPGLAKTTIVKNFAKTFG
2809 :     LSFSRIQLTPDTMPSDIIGVYYYSEKTKDFAIKKGPIFTNILLADEINRTPPKTQSAMLE
2810 :     AMQEGQATVEGTSIKLPEPFILLATMNPLESEGVYSLPEAQMDRFMFKITLEYPKKDEEI
2811 :     TMLKKKYEGSFETVNSVISPEELKKAFEKVLEIKISDEILEYIYEIVKMTRTDDRLLYGV
2812 :     SPRASEQILYASRALAYLNGRNYVIPDDVKEVSKYVIVHKIKLKIDYEIEGISNKNIVNE
2813 :     ILDKAVVFKKNQG
2814 :     >45357927 hypothetical protein MMP0364 [Methanococcus maripaludis S2]
2815 :     MEKYFKYILIALLGVIFVSLPAGVPMIKSFSEYSSFNTDWNGCSKFTKMVYDSEIIVTPI
2816 :     YSPYDDYNFDKNGVLFIIGPEIDFSNSEIQKIGNFVKCGNTLVIADDFGTSNQILEQLNL
2817 :     TDKFTKKRLNDLFYTSNENLIEYKVPEEYGSGYIVTNIPTYTSKIGFVTASNFSNSNLKN
2818 :     QNPALISKVYYENGNIILIGDPDIFTNGLYNYNKNFLKDFTEKLNSNHVYIDEIHHKDFG
2819 :     YEISVFYVHKSVPKKLILIVLLLLVCSFHVQNKKVFNNATKKLISKFSKKGTENEEEILK
2820 :     NISEKHDIDLNDLKRVINNIKDGNNGRKRISK
2821 :     >45357928 hypothetical protein MMP0365 [Methanococcus maripaludis S2]
2822 :     MNPFKSKILFIVFIISFLSFSVVTAESMNLEDLKSDDTYVYSYFNAILDDYDTTINDMIQ
2823 :     NNISYVNESKLLFEKTAYLNSEISIYEEYGMNTPAKTVITPFYNFSKNLEDLSGLCQEFN
2824 :     KNIELNTSSSKYFSKIIGSNIIEKINLMKSNLQDINDLSELKKDEKTLTFDTSNIEKSLD
2825 :     YLELKFTKHIENIGNVTPSSNLTVLISPENPLIYENTTIYGTGLTGNGKIVITGPENITE
2826 :     NIVLKNNHYSTDYSFNKSGIYTLKLTQYGRESEAIEVNISKIPTKIISENYFEFLVLKEN
2827 :     NILGKVIDFYGNPITSGEIFFENKTLNLKNGTFTIYTYSDYEKMNNCTLKFVETEKYLSS
2828 :     EKNIEINFSKPILNIQIYSEIGKIDKNEPLMITGTFEKVQDLNLNLWVDNTSLENFNSNG
2829 :     TFKKEILFERPGNYEVFVTFDGNDYYDLSKSNVLMINVTDKDNDLNLLATSIYKAVEVNW
2830 :     KILILIIAILAFGIKFSDILNIFKNKTQETASKPEFNNSLPERSEKSTVVEKTVVLEYQE
2831 :     LYNKIMKKYNINVEFTPNELLKYLKKINPKIYYDLKIITKIHEKAVYGKEKLDNNTLKQF
2832 :     HDLIKRVLENL
2833 :     >45357929 hypothetical protein MMP0366 [Methanococcus maripaludis S2]
2834 :     MVLGSFTVLISTFILYYGITNSIISFINLGIAGFFIFVILNTLIPQKMIDYSVHEALTAS
2835 :     SSEFLKKIFENLSLCGNPIYLPPYENMENGGIFIPSSKKFTLNLSAFTKNSIFLANKNAS
2836 :     SEMGVLINPPIGLGLLKKFEENFGESILKMDTNTAFSVIQSALSSMDLLSDIDFEEKNGK
2837 :     ISVKIYKNKEIEAFEEFYYLSPVISSIFLALSKSMDVPVFIEEFLEFDGYIEFTASKYKL
2838 :     DDY
2839 :     >45357930 hypothetical protein MMP0367 [Methanococcus maripaludis S2]
2840 :     MGYFMKKINLMIIAISIWAILTALLSSSIDLYITLLLIGTLIFFEIGDFFISKSDKDSLK
2841 :     IIIYILAGIFATVVLNKIYTIIK
2842 :     >45357931 hypothetical protein MMP0368 [Methanococcus maripaludis S2]
2843 :     MAYDYPTELYSGESGNLIIGIVNHEGRNVTYHGETWLINSNNTNYSTLTAENAVMLDSYS
2844 :     VRLEPNH
2845 :     >45357932 hypothetical protein MMP0369 [Methanococcus maripaludis S2]
2846 :     MKIINFFIPILLLLSAIPMGFASSENVVVIASTPADAILAAQYAKEMGYKFVYTPSDSLS
2847 :     EAAGNAITGASHAIMIGGPDAISETVKSQLEAKISNVERVYGADRVDTSLALLERMYTEK
2848 :     PEALNNVVFAEGFNGDITPAALNFGAPIAYFAPDNYEKVSAFISSHPVKNAVIMGSSVPD
2849 :     TLRNAVSNAADTTNLALGSAETIIETALSVASNLNPSILGSVAALVYSESVNDPVIDAIL
2850 :     GYASGDVGSVVPLPSDDEGTVNEIVLSVTAITSTISISSDSTAVSESISESVPAGTTTTT
2851 :     TTSSSGGGSSSTPYYTQYYTVVSINNVEKVKFADISASATDGNNVKITGDDSIVLPDLTI
2852 :     TTNMVQKSYTGSSGTVKISYQGTGSGLNIVYPVESGALTYGSDLDVTFYGSRALANTQVT
2853 :     AHVITDRQEFRDSMNDLLDGNANTFISMLNNADTVTSTTNYYGDATFTVTPSTYGENIVI
2854 :     VTLGDGTIGTTATVLGVSGFEYLKYDLNLTQMWFNPLDNTTEISMDLNETPANNVRYGLI
2855 :     GITKSGYSFTFDIIGTSTADKNFDVSLVGNGGTSKVIDDSALVSLTASSIQNILEAAFTE
2856 :     NTAGITYSYVTKDVNFPATVSINAQGQDCYFVGVVYDLNDKKIVAMEQISGNLS
2857 :     >45357933 hypothetical protein MMP0370 [Methanococcus maripaludis S2]
2858 :     MFKKMVMILSILMAISSISAISDVEISPENPKIGDTIILTGKSNPNEEISCSAWFEINPT
2859 :     ISEPYYGALLYGVEIPEPPNNFKVTAENVESLSVSIKMGLWVTISGSVDSSGNSAVSKSN
2860 :     VPEGEYDIKIGGKIKDTSKPVTLKVYASTKIQADENGNFEYHYSTDSIDEGTTIYLTIGG
2861 :     VSKEVTVQGTTPAPVVTPVTNITTTEDTTPPIIKVLAPLKSEYGVNSVEFNIVVTDDSDY
2862 :     DIKIYLDDKEQTYGQNGNYFSGSVYLSEGKNELKIVAEDEYDNKNTKIVYLTYSEDLEEV
2863 :     TENLDNLEDNEETSETSENSNEDILTDDKNIVLGTMIFNVGSAILTVNDGTEISNSGDIK
2864 :     IEEREIPETSMAYVIYPEYSEFSIPLTLEIDVFDLSDNLKVIYYDSKKGWINTKYVLNED
2865 :     TITLNVTKSGYYAIKETEVVEENESIIDTIKGFFNAFKIIITAIFDRI
2866 :     >45357934 hypothetical protein MMP0371 [Methanococcus maripaludis S2]
2867 :     MITENIFFIMNIIGLLAFAVVGALKGIKKGLDLLGIIVLGIMTALGGGITRDLLVNTIPY
2868 :     ALRSPNDMGVALIGVWCAIVIFKVFNEDVSNKYIIQIPDAVGLSAFTTTGAMIAYNFDVS
2869 :     FFGIIILATLTGVGGGIISDILLQKTPSALTEDFYASCSIIGAIAFYLAILSNLSLEMSA
2870 :     VICSIVVLMIRIVAILCKWSLPKFYSEQK
2871 :     >45357935 F420-dependent methylenetetrahydromethanopterin dehydrogenase [Methanococcus maripaludis S2]
2872 :     MVVKIGILKCGNIGMSPVVDLCLDERADRNDIDVRVLGSGAKMGPEQVEEVAKKMVEEIK
2873 :     PDFIVYIGPNPAAPGPKKAREILSAGGIPAVIIGDAPGIKDKDAMAEEGLGYVLIKCDPM
2874 :     IGARRQFLDPVEMAMFNADVIRVLAGTGALRVVQNAIDDMVFAVEEGKEIPLPKIVITEQ
2875 :     KAVEAMDFANPYAKAKAMAAFVMAEKVADIDVKGCFMTKEMEKYIPIVASAHETIRYAAK
2876 :     LVDEARELEKATDAVSRKPHAGAGKILNKCKLMEKPE
2877 :     >45357936 hypothetical protein MMP0373 [Methanococcus maripaludis S2]
2878 :     MDDFEKIINSLSDKEVILRVDLKQNIKVINFKIGSMDINGELGISFRSINPEKKAEEIPE
2879 :     NIIEVPEEVSEAAEKVEEKLKI
2880 :     >45357937 hypothetical protein MMP0374 [Methanococcus maripaludis S2]
2881 :     MIKILDASAFIHGYNPSIEDGEHYTTNGIVSEVVSKEDIVKLAIEYGKLKILDPKPETIE
2882 :     KVVKTSIETGDTISNNDIEILALAIDLGGTLYTDDYGLQNVSKKLKINYENIVSAGSKDD
2883 :     FVWKKICKGCKKMYPINYLDEECEVCGSPLYRKMVKNRLKKGKKFYDKKKKPKKLF
2884 :     >45357938 radical SAM domain protein [Methanococcus maripaludis S2]
2885 :     MTRNANKNNKECEKCWIFDLNQFKMITNSILEENTLVLEINQNYEVSVLMDYDVFLENGI
2886 :     LTFKDFVNDNSKSAQVLTGSLKTGILNKMSQSISEGLLNKTTNRRTYYITEPTPLIGHTA
2887 :     FGLIDRGTNVIQVRGLSGCNINCPFCSVDEGIHSKSRKNDYYVDKDYLVSEYEKIADFKG
2888 :     YKKLEAHLDGQGEPSLYYPLPDLVQNLNEINSKNNGIVSIQTNGVHLTEKLIDDLEVAGL
2889 :     HRINLSINAMDEKFSKGLSGSKNYDIEKIMKIAEYIKNSKIHLLIAPLLLPNYNDEEFKK
2890 :     VLDFAVELEQKNPQNTINPITNKKNPIVGPQLCLTYQFGRKIPKMRVWDFPKFYNLLDVY
2891 :     HKEYLKDGINVDLEVPLHGFFGSHGRKRLPCPFKLNETISVTVLMDGRVNGEVIGASKNR
2892 :     VIQIIDCKTDINKLIGKRVKVKVLRVKDNVIVGSMVK
2893 :     >45357939 ATP dependent DNA ligase [Methanococcus maripaludis S2]
2894 :     MDKTYFSEDILNFEEFIIDASKKLNIDEDTLKNGFKRKLITKYEYNGRKYLCFKKKLKHI
2895 :     ERGTILFLNDNLDFIIGYPKIRRAMVLESSVKKYFNGKIAVEEKLDGYNIRIVKMHDEII
2896 :     AITRGGKICPFTTKKVKKYLNTKFLDDFPELMLCGEMVGLNNPYVNHYYPEADRTYENLG
2897 :     FYIFDVRNKKTNLALSIYEKEKILDEYNIPYVKPIKIIDSNEIDELWNILDDLNENHREG
2898 :     VVLKDPEMIKNPIKYTTHSTQCGDLSIAFSYVYDLGIDFMFSRLVREGYQSFEKCESEEE
2899 :     RKKRAHELGESILLPMVETITEISKESVAKECFELYFDSEEEFIEFINYLKTMHINFAVE
2900 :     SREYIKKDIFKAKINRIYNSTSDKIKSHLDGNLW
2901 :     >45357940 isoleucyl-tRNA synthetase related [Methanococcus maripaludis S2]
2902 :     MIKIDMHVHTNTSRCSMNFLEMLKKMCSRKHILPIITDHNAMTKVDFGIPGEEISTEKGE
2903 :     FCGIFLTEEIQEKNIFEAVDKVKEQGGLIYLPHPFDWRRRRSLCKYGELENPEFIKNVDI
2904 :     VEVYNSRCVEQRPNDEAYSFAESKNLLMGVGSDAHFPWEVGNAYLNVEDFDLDNPKEFLK
2905 :     VLKKADKNGFYCKRSHPSNMLVCSKLSKRIKKLI
2906 :     >45357941 amidohydrolase [Methanococcus maripaludis S2]
2907 :     MILIKNVSYYIDNNLNVHENCDILIEKVENSEIKLTTGKNLLEKLNLNQNDLKIISGEKK
2908 :     CAIPGLYNAHTHVPMTLLRGIADDMILQDWLNQKIWPNEAKLNKNDVYYGSLLGCLEMLR
2909 :     FGVTSFNEMYFFSEEILKATKEIGLNAQVSYPIIDFGTPEEQSIDKLLTSAESFVKNNVG
2910 :     EKNIKVGIAPHAPYTCSEETYQKCSEISNDYNVNMHTHVSETRYEVVELENKIGMRPVEY
2911 :     LEKIGVLNEKLHAAHCVWITKDEAKKLAKNNAKVLHCPTSNMKLASGGVMPLFELLEYGA
2912 :     DISVGTDGPASNNNLDILKEMKMTSLLHKAHRWDPTVAGIDTVLKMGINSESIEIKNNDI
2913 :     ILIDLDSAHLRPFNNIKSNIVYSAFGNDVDTVIVGGNILLENKKYKFSETFISNIYKNIQ
2914 :     KITEKFE
2915 :     >45357942 hypothetical protein MMP0379 [Methanococcus maripaludis S2]
2916 :     MDYFNIFAYGELMKDEILFELINRVPEKNLGKIYNFEKFFDEKIGYYGIKPKENSSISGI
2917 :     ILFNINSTELEIFDDYEDEGTYYSKNKTICYDLNGKGYESYVYVRLE
2918 :     >45357943 DNA polymerase family B protein [Methanococcus maripaludis S2]
2919 :     MESLIDLDYNSDDLCIYLYLINSIIKEKDFKPYFYVNSTDKEQILEFLKDYEKKHKLDSE
2920 :     ISKMIENIETVKKIVFDENYQEKELSKVTVKYPNNVKTVREILMEFERLYEYDIPFVRRY
2921 :     LIDNSVIPTSTWDFENNKKIDNKIPDFKTVSFDIEVYCNKEPNPKKDPIIMASFSSKDFN
2922 :     TVVSTKKFDHEKLEYVKDEKELIKRIIEILKEYDIIYTYNGDNFDFPYLKKRAESFGLEL
2923 :     KLGKNDEKIKITKGGMNSKSYIPGRVHIDLYPIARRLLNLTKYRLENVTEALFDVKKVDV
2924 :     GHENIPKMWDNLDETLVEYSHQDAYYTQRIGEQFLPLEIMFSRVVNQSLYDINRMSSSQM
2925 :     VEYLLLKNSYKMGVIAPNRPSGKEYQKRIRSSYEGGYVKEPLKGIHEDIVSMDFLSLYPS
2926 :     IIMSHNLSPETIDCTCCSDEENGENEEILGHKFCKKSIGIIPKTLMDLINRRKKVKKVLR
2927 :     EKAEKGEFDEEYQILDYEQRSIKVLANSHYGYLAFPMARWYSRDCAEITTHLGRQYIQKT
2928 :     IEEAENFGFKVIYADTDGFYSKWADDKEKLSKYELLEKTREFLKNINNTLPGEMELEFEG
2929 :     YFKRGIFVTKKKYALIDENEKITVKGLEVVRRDWSNVSKNTQKNVLNALLKEGSVENAKK
2930 :     VIQDTIKELKDGKVNNEDLLIHTQLTKRIEDYKTTAPHVEVAKKILKSGNRVNTGDVISY
2931 :     IITSGNKSISERAEILENAKNYDTNYYIENQILPPVIRLMEALGITKDELKDSKKQYTLH
2932 :     HFLK
2933 :     >45357944 3-isopropylmalate dehydratase, small subunit [Methanococcus maripaludis S2]
2934 :     MKITGKVHLFGDDIDTDAIIPGAYLKTTDEYELASHCMAGIDENFPERVEDGDFLVAGEN
2935 :     FGCGSSREQAPIAIKYCGIKAIIVESFARIFYRNCINLGVFPIECKGISKHVKDGDVIEL
2936 :     DLEEKKVILKDTVLDCNLPTGTAKDIMDEGGLINYAKKQKN
2937 :     >45357945 putative ATPase RIL [Methanococcus maripaludis S2]
2938 :     MSRLAILDYDRCQPRRCSMECMKYCPGVRMEEETIVMDENLGKPIISEELCSGCGICTKR
2939 :     CPFGAIRIIGLPEELTDDRIVHSYGQNRFRLYGLITPRDGVTGLLGPNGVGKSTIIKALS
2940 :     GEMVLNLNDLTETPDMKKVLDYFSGTELQNYFEKLKNNGIKPIHKPQYVDVLPKVVKGKV
2941 :     GELLKKVDEKGEFEKIINALEISNILDRTFDQLSGGELQRVAIAAACLREGDIYYFDEPT
2942 :     SWLDVKQRFSAAKVIREVAEGKKVVAVEHDLIVLDYLSDYIHIMYGIPSAYGVVTHPRGT
2943 :     RVGINTYLDGFLKEENIRFRKSPIVFEKRPPQDSTNRPLLLDYTDISKKLGDFSLNVNGG
2944 :     QIYQGEVVGILGPNGIGKTTFVKALAGVISPDSGEVTGDVKVSYKPQYISSDFEGTVEDL
2945 :     LMSITAIHTSYYKSEIIKPLALENILDSSVKDLSGGELQRVSIAACLSQDADLYLIDEPS
2946 :     AFLDVEQRLTTSRVIRRMADEKEAAMFVVDHDILFQDYISDRFIVFSGIAGSSGTGSEPL
2947 :     QKRAGANKFLKEMGITFRRDPDTGRPRVNKEGSQRDVYQKEIGEYYYLDE
2948 :     >45357946 S-layer protein [Methanococcus maripaludis S2]
2949 :     MAMSMKKIGAIAVGGAMVASALATGAFAAEKVGDVDAFAADVVADGNANVDIVVGSNAAA
2950 :     LDVVSAANVAAKIGSLMFKEGTVEDGSAQITVSASAESDEIKDLWATAPAAIAGQDKALV
2951 :     ITAPDDDYTAVATGILGFADGVPAGTGLNLFGITTADAAVDLEDLQTLMIVEDADPSGWD
2952 :     FYGTGNDFEAAEVLVAVVNTETTVPASTFGVGTPDLEVLEDEVVYASLAFVEDQYGNAAG
2953 :     DYAALFPGMRIPLLGQEMVVVKLDTDDDLAIVGTEAYEGVIKQGDSYDVGNGYTVKIANV
2954 :     LKQSGTAYKVDVQLLKDGKVVASKFDTVDKPAAPAAATQLKLVYKDMGIVVNAAWTDVGD
2955 :     NYGYAELVIADNVVEMELGEEFIPDYEAYTVDLTAAGLTLSDKATAAGTIVGIALKYVGD
2956 :     DVDKISKDKTFTIADYAKLDFDEDSGKIALKFLMDESKDVNINIGEKVSVLNAEIKLADI
2957 :     EAEAKEAVVMTAPIAVLDSEASLDAADKGLILVGGPVVNALTAELADAGLVAIDNESPAT
2958 :     LAVAAGAANGNDVLVVAGGDRAATEEAAEALIDML
2959 :     >45357947 hypothetical protein MMP0384 [Methanococcus maripaludis S2]
2960 :     MEKHKHCINCGLSIPPEESFCSQKCKEEFVQKRKKMMRSQQIFFVAMLVILAVYAYTAFF
2961 :     >45357948 uridylate kinase [Methanococcus maripaludis S2]
2962 :     MDVVFALGGSVLMPKEGASTENIQNYAKAFKKLKEMGHRVSVVVGGGNTARQYISVAREF
2963 :     ANESFCDEIGILATRMNSMLLISALGKDAVKQVPENFKDAEIILNMDKILVMGGTHPAHT
2964 :     TDAVSATLAEFIDADLLVIATNVDGVYNKDPRCNENAVKLDKINTKELLEITGSSSMSAG
2965 :     SSGVVDPLASKIIDRAKLKTIVVKGIPEEILASVTGNHNGTTITP
2966 :     >45357949 histone A [Methanococcus maripaludis S2]
2967 :     MAELPVAPVVRILKKAGAERVSEDAAKMFVEALEEIAMDIAKEAADLSKHAGRKTVKVED
2968 :     IKMALKM
2969 :     >45357950 microsomal signal peptidase 21 KD subunit [Methanococcus maripaludis S2]
2970 :     MGGIINNKNILEWTVFLFVFLIVWTHVNVVVSDSMVPVMTRGDFVVVENSLFEFDPESVS
2971 :     VGDIIVYSAHWTNAGENKIINQDLSINGRNLNYYELNSRESMIYNLPIISSYSPTTPVIH
2972 :     RVIDTWTDSEGNKYYITKGDNNPTYDPELIRAEQVRQRVVELNDEPFIIPYLGHISIILK
2973 :     ENLIIFVILLVIWMYYDYRKEKVAKNN
2974 :     >45357951 geranylgeranyl reductase [Methanococcus maripaludis S2]
2975 :     MKALNDSYDVVVVGAGPAGSMASYNASKNGAKTLLIEKSQEIGTPVRCAEAVPRLEDFGI
2976 :     NPDPSFVKSYIRGGYLIAPNGKKIVVKGGKTDGYVVERKVFDKFLAIRSGQAGTQIAVKS
2977 :     RVTKIEKTDDGYNVFVNYLGDEYIVKSKIVIAADGVESNIAEYAGLKSKKNPKEICSCAE
2978 :     YEMTNVKLLNNEMMEFYFGDICPKGYIWLFPKGDTVNVGIGVIDSKKRAIDYLDEFLTHP
2979 :     LVEGRLDNAVPVEFKVGGDPVGGPIKKTVADNIMVVGDAAGHVSPLTGGGIGLSMDCGLM
2980 :     AGDVAAQSIKAENYSEEFLDLYEKKWKEKYYKLLMNDLKYKNILQKLSDDELNAIANSIP
2981 :     ENLEEVDVGKLAIKIVAKAPSLLRHFKELL
2982 :     >45357952 ferredoxin [Methanococcus maripaludis S2]
2983 :     MKVNYSKCGYCGACVGVCKSMAIELIENKLYIEEEKCNNCKLCTVVCPVNALEE
2984 :     >45357953 hypothetical protein MMP0390 [Methanococcus maripaludis S2]
2985 :     MFESRFCDICGKPAKTYQFGSLLCEDPECLKKAQKLRGGPAGHKLRVISVGSTNPVKVSA
2986 :     VEKAIEKTVGTMLVSSVDTKSGVSDQPQGFEETFKGAYNRAKGAFEKVNCVYGIGIEAGI
2987 :     VEIGEKKLDIHICVVYNGLDYSVGTSQAFQIPKDISDMINEGYECSKIAEETYRVKNIGQ
2988 :     KNGIIGVLTDNNILREQLCIDSVVMAMIPKYRRNSQIRF
2989 :     >45357954 aspartate aminotransferase [Methanococcus maripaludis S2]
2990 :     MKQMDTEKLLMIPGPTMVPSRVLNTMALPIIGHRTSDFGDLTGDTVDMMKKVFQTENDTY
2991 :     IITGSGTAVMDMAISNTLDKGDKVINITNGNFGERFYKISSVYKADTIKYEPEWGDLADP
2992 :     KKLRELLEENEGIKAVTVVHNETSTGAKNPIEDLGNVVKDFDAIYIVDTISSLGGDYVNV
2993 :     DKFNIDICVTGSQKCIAAPPGLAAITVGEKAWDVVSKTETKSFYLDLNAYKKSWDAKKET
2994 :     PYTPSVSLTYAMNEALEMVLEEGLENRFKRHDLLARATRAGLEAMGLELFAKERARSVTV
2995 :     TSAKYPEGIDDKKFRGLLAEKYNIRVAGGQSHLAGKIFRVGHMGSAKEYQVLGTLAAIEL
2996 :     AFKELGYNAEGGVAAAKKVLSN
2997 :     >45357955 phosphoribosylamine--glycine ligase [Methanococcus maripaludis S2]
2998 :     MKVLLIGGGAREHAIAMALKKNELVELYTLMKNKNPGIYALSEEVSFNSETDVPAIKEFA
2999 :     EKIKPEIAVIGPESPLGVGASDLLEEMGIPTVGPKKLPAQIETSKEFMRNLFKKYEIDGS
3000 :     LKYAAFNDYGTELEGFIDEMTSLGKDVVVKPAGLTGGKGVKVVGEQLKDNEEAKIYAKEV
3001 :     FDKSIGGGKIIIEEKLVGVEFTLHGFVDGENIVFMPAVQDHPHAYNNDEGPITGGMGSYS
3002 :     CPNHGLPFLSEEMLDKAEKIMEKTVNSINLEVGPYKGFLYGQFMLTADGPKIIEYNARFG
3003 :     DPEAMNLLPILKTDFLDVCFAIAEGKLDKINIEFENKATVCKYVVPNGYPIDPVRNKELA
3004 :     VDEKAIEDANAILFYASINEENGKLYITGSRSAAVVGISENIEEAEKIAQKAIENFKGEV
3005 :     YYRSDIGTLDLIKKRVERVKKLAK
3006 :     >45357956 phosphodiesterase [Methanococcus maripaludis S2]
3007 :     MKIGIMSDTHDYLPNIRKAIAVFNDEKVDMVVHCGDFVSLFVIKEFENLNSKIVGVFGNN
3008 :     DGEKTLLKEWLKEIDPDNELENYVSFETDGHKFFILHGTHAPILEAVIQSKEYDVVIHGH
3009 :     THERQFEEIDGVLVINPGECCGYLTGKPTVAILNTKDKEYQEIDLDEVSEI
3010 :     >45357957 uroporphyrinogen III synthase [Methanococcus maripaludis S2]
3011 :     MKVVITRPAEKGKDFSNLLEKNGFETVILPTLELVFKKAQINLENYSWIVFTSPRGVEGF
3012 :     FRNLKLEDAKKVLTKKIGAIGTETAKEFERTFGKAVDVIPKQYTAENLLEAIQKQVKNGE
3013 :     KVLVPTTPSTRDVLKEGLNADLVFVYSSEEPTDIPEKLKELEKQVISENSQDKKLILTFT
3014 :     SGLTAKNFFKHCSPEFLEILKKQYIVSIGPITKKNVDSFGFDSLMPEKNYTVEAMVPVIK
3015 :     ALNI
3016 :     >45357958 hypothetical protein MMP0395 [Methanococcus maripaludis S2]
3017 :     MKGTGNLITVDDKTIVNSMEKVFKEELEDMEKDLELLYKKYDVPNSRLLADKVSAGIYMG
3018 :     EEILRDLEDMEYFEENIEKLRAYIRDLNMKKI
3019 :     >45357959 enolase [Methanococcus maripaludis S2]
3020 :     MLRNMDDSFDIYEIKARQVLDSRGNPTVEAEVLTAGGGYGHTIVPSGASTGTFEAVELRD
3021 :     KKEKYGGKSVLNAVSNVNDIIAQELIGEDARNQRLIDQIMLNLDGTENKGNLGANAILAV
3022 :     SLAVAKAAADTASLPLYKYIGGSNAYVMPAPMMNVLNGGQHAGNALDFQEFMIMPVGADS
3023 :     FAEAVRMCSETYQSLKKVVAEKYGKDAVNVGDEGGFAPPVKTIDEALAVLLEGVKKAGYE
3024 :     DEIVFTIDSAASEFYDEKSGSYMIAGEKVSTDKLIDIYKEMVEQYPIVSIEDPLFEEDFE
3025 :     GFKTATKELKGIQIVGDDLFVTNTKRLKKGIEMGAANSLLLKVNQIGTLSESIDAANMAF
3026 :     RNGYSLVVSHRSGESEDSTIADLAVALNAGQIKTGAPARGERTAKYNQLMRIEEELQISK
3027 :     YAGKDFKIPF
3028 :     >45357960 alanyl-tRNA synthetase [Methanococcus maripaludis S2]
3029 :     MEINHDYRVKLFDELGFERKQCTECNQWFWTLDKDRTTCGDSPCDEYSFIGNPITSKKYT
3030 :     YNEMVKEFTNFFDEKGHTPVKRSPVVAKRWRDDILLTIASIAVFQPWVTSGLVKPVKNPL
3031 :     VIAQPCIRLNDIDNVGRTGRHLTCFTMGAHHAFNSKDDYKYWTDKTVEYCFELMQRLGID
3032 :     GKTITFIESWWEGGGNAGPCYEVITHGVELATLVFMQYKKIGNDYEEIPLKIVDTGYGIE
3033 :     RFAWASQGTPTVYESLFSEIIEKLKEDAGIPEVDEKIMAESATLAGLMDIENVGDLRVLR
3034 :     QKVAEKIGMDVDELDKLISPLEYIYAIADHTRCLSFMFGDGIVPSNVKEGYLARLVLRKT
3035 :     LRYMEKIGISMSIKDIISMQLENMKEIYPELSAMKEYIMDVLDAEEKKYIQTVNRGRGIV
3036 :     ERMAASKSEITLDDLIELYDSNGLPPEIVKDVVDDLNKKGKKTIAITVPDNFYTIVAERH
3037 :     EEEKPEEVVSTKKELPELEVSKTELLFFKHPTQVEFEAKVLKIVEKYVVLDKTLFYAEGG
3038 :     GQKYDIGQLNDIEVMDVQKKNGIVFHKVSDISKFKEGDTVKGAVNWDNRLKLMRNHTATH
3039 :     VINAAATRVLGKHVWQTGSNVDTEKGRLDITHYERISREQVKEIERIANEIVLSKMPVNS
3040 :     TFMDRNDAEQKYGFTIYQGGVVPGDTLRIIEIEGTDVEACGGTHCSNTSECGYIKVLKTE
3041 :     RIQDGVERLEYSTGMGSVSEIASLEDTLIDSAEILGIPNDQLPKTVKRFFEEWKEQKKTI
3042 :     EELQKKVGELVKYELADKFENVGNYEVLVEQVSGTPNELMSIADNLAVGNKLIVLMNEND
3043 :     YLLCKRGENVELSMKDLIRNIGKGGGKDNLAQGKYSENKEQITEKIIQILNK
3044 :     >45357961 hypothetical protein MMP0398 [Methanococcus maripaludis S2]
3045 :     MFIPSHITGFFKITRHENLLKTGSTGAGITLNRGVSTKLVEGPGNVYFNDEKIDLCPSKD
3046 :     VIHYLGLKNELKHDITYISDFPLGCGMGTSGCCALGAAYELSSTYNFKNMQNDIDRSNLY
3047 :     NKNESNISELIKIAHKAEVRCNTGLGDVIAQHTKGFVIRKSPGFPIGVESVDIKNMDEYN
3048 :     VLVDIFGKKETDTVINDPSWIEKINNTSDELLGKLLKKPTLENFMELSYYFAKNTGLASE
3049 :     EIIEICDDLRFTAGASQAMLGNAIFCICKDEELNDAVSILSNPVVCKIYK
3050 :     >45357962 M48 family peptidase [Methanococcus maripaludis S2]
3051 :     MMSTVKVLLLMALLTGMIYGICYMLGFPPIFAILLALIPNLISYFYSDKIVLTSYGAKIV
3052 :     DENEAPNLHRIVESIANRANIQKPKVAIINTDTPNAFATGRSPKNGVVAVTTGILQLLNE
3053 :     QELEGVLAHEIGHIKHRDILIGTIVATMAGAIMYIANFLQWGMLFGYGRDDDGNPLQIVA
3054 :     SLLFIILAPIAAMVVQFAISRQNEYNADENGAKYSNPIYLANALTKLEKGVKYHPLRNGS
3055 :     PATAHMFIVNPFKAGNVARLFSTHPSTEERVKRLMEMASNPKYLR
3056 :     >45357963 amino acid-binding ACT domain protein [Methanococcus maripaludis S2]
3057 :     MQLGLTVIAEDRVGILYRLTGIISELNANIVYTQQFIVGENTGLIYMELDGVGDEENLAG
3058 :     KLEKLEFVKKVETHKTMKKIFGKRVLIFGGGAQVAQVAMGAISEADRHNIRGERISVDTM
3059 :     AVVGEENLADAILAIKTLPRAGVLVLAGSLMGGAITKAVEEVKKDTNIPVICLNMFGSLP
3060 :     KLADLIVTDPLQAGVIAVMTVADTAKFDITKVRGRIL
3061 :     >45357964 methionine synthase [Methanococcus maripaludis S2]
3062 :     MIKTVVGSYPVVKGKPDSIPDKIKKFFGKYDKYEYSIKKALDDQLNVGIDILSDGQVRGD
3063 :     MVEIFVSNMYGFEGRRVVNRVEFVKPITLNDIKYSLKYISKKDPEKGVKGIITGACTLAS
3064 :     SIRVENYYSDNKDENLIYDLAGALNKEALSIQNHVKMIQFDEPILSTGLYDLEVAKKAMD
3065 :     IITSGINVPVAMHVCGDVSKIFYKLNEFNVDILDHEFASCRKNLEILNEITKKVGFGCIN
3066 :     TKLKSVDSVDEVKALISEGIEILKNNSKFEGSINDSVIIDPDCGMRLLPVDVAYSKLNNM
3067 :     VTAANEIEKDLI
3068 :     >45357965 hypothetical protein MMP0402 [Methanococcus maripaludis S2]
3069 :     MSKPILNKYKLYLLVALMFCSISAVDSYRFDEYSVIYSIDQNDNFYEEIDLKIYNNNSDD
3070 :     LYEISYTIPQETSNLTFNSSKEIDSYSITTDDAGSTEVSVRLTEPIGPWQTGDLLVSFTG
3071 :     EVSDIGGKKQVYIIVPAFDSTFKLSVQLPEGAAIVSPVKDVLSISPRDYTVGSNGKSIFV
3072 :     EWEKELTSEEKYFEVTINYVLTGVITPSTTGENNEDLYRAISIVLGVLVVALIFFIYRNY
3073 :     NKVKMINELQNEINGLNKGLEISHLNLQNKNKELQRLEELNEHVLKELDLSKNTLRDYEL
3074 :     KINELNEEILQCRAQVGNHTKLKEELNSKDAVIKSLNDYKKLSEELKLKINELTGLISEK
3075 :     EKCIIKLKEKIGDYESHKSETLMNILTDDEKQLIELIREHGSISQKEIVDITGLTKPKVS
3076 :     RMISDLEQRGMVRKVKIGRINKIALSDDLDGSI
3077 :     >45357966 hypothetical protein MMP0403 [Methanococcus maripaludis S2]
3078 :     MKILISICGEGFGHTTRCIAIGNELSKKHEVKYAAYGKSKDFVEMSGGDVFETYPEIRLS
3079 :     GKNGKFDVKKSIFNSDYHPARAIKKEMDIIKDYDPDLVISDCKYSSVVASKVLKKPYYII
3080 :     TNQNCTKTDKKEKYIVYPVMEILNVINKSAEKVIIPDFPLPYTVCEYNLKLLENLSFIGP
3081 :     LIRYDVVPEEISDEGYILCVIGGFEYRYKILELLNKISAKKGLKVKMVCGSYDVAEKLEK
3082 :     IKSKNVEVIPLTTNMDELLKKCSFVVCHGGHSTLMEASCFGKPVITIPDLDHPEQENNAK
3083 :     KISDMECGIALSYNTIDSNLEESIEKMVSTTKYYENSKKLMNLYLKNSGTDKVMDIVENG
3084 :     L
3085 :     >45357967 LPPG:FO 2-phospho-L-lactate transferase [Methanococcus maripaludis S2]
3086 :     MKITILSGGTGTPKLIQGFKEILPNEDISVIVNTGEDTYIGDIYLSPDIDTVLYTFSNLI
3087 :     NDETWYGLKGDTFFCHEQLKNFGFDEVLRIGDKDRALKMHKTSLLKKGVPMSEIVDIERK
3088 :     SLSINSKIYPMSDEKIESKVLIEENNEKILLKFHDFWVSRRGNAKVLDIFYENSNYAKAA
3089 :     DGVLKAIEESDFVIIGPSNPITSIGPILSISEIKDALKEKLVFAVSPIVGENPVSGPAGT
3090 :     LMHAKGYPVNAVGVYEYYKDIVDVLVLDNSDINKKKEMNCEVLYANTIMKTIDDKITLAR
3091 :     NILDYYKSR
3092 :     >45357968 GTP cyclohydrolase III [Methanococcus maripaludis S2]
3093 :     MIQITVVQIDNYGPWTVTPNPRRESDLQALQSRLYCDMNLQFGAHKGLAFYTRFDNIIAI
3094 :     TNGIDLETHKRIQNSVKNRYPFTVSMAVASAETAYEAQKLATKTIQEYGSAQDDVRKEVL
3095 :     DVANEFVSNGYVQLAHVDINDITGKLTDLETAYDTYLSVQKTKLKLMEELKKYDSLGFFI
3096 :     GGDNFMCPCNGMNEKDFLCMFEDIKDSCGIELKAGIGIGKTAEDASNLADIGLEVIREGK
3097 :     TDSQVYTLKQEIDEQKNVPYNYMCPI
3098 :     >45357969 putative TIM-barrel protein [Methanococcus maripaludis S2]
3099 :     MKKLDKIYTIPKKIVLAPMAGITDGDFCLKYTDTFGIVCLGAFNLDFDTDLASKKICNRG
3100 :     RKEFIYDLIEIDQKISSEIEKAKKSNSLVSVNIRFNDFSKAKSHIVEISKNADILELNCH
3101 :     CRQPEITYLNLGQNLLKFENESKLINFLENIQKLNLEIPIFLKLRANFLKAEELIKSLDK
3102 :     VRGYFDGIHIDCFNPGKNHADLEYLKKIRENFPEKIIIGNNSVNSVESAKEMLEYADFVS
3103 :     VARCVLSNNIEWINKM
3104 :     >45357970 hypothetical protein MMP0407 [Methanococcus maripaludis S2]
3105 :     MEKIKEIIVKNIMSSDVVSVSPESGVVEAFEALLKNKISCLPVVNQNNETIGIVTTTDIG
3106 :     YNLIIDEYTLETTIADVMTKKVVTIKQDESAVDALKKMDLYGDGREIINQLPVINSENKL
3107 :     VGILSDGDILRAISKLC
3108 :     >45357971 H+-transporting two-sector ATPase, A subunit [Methanococcus maripaludis S2]
3109 :     MKRANLSHHDKVANGIRLFGNTLIDELNYDTFIWTKEILGPDDVKIWKETIEEEIKKGNN
3110 :     IYNMARLCRVGENDYLKELASKYNVKYYDSSDPKKYDELRVFAKTGLEGINTKVMTIMGT
3111 :     SRQSGKFTTCMILKKELEKRINIGIVGTEPQSLICGIDEMVVPQTIETCHCASTIFGAVK
3112 :     KLDTKNRDLIIVSSQTGIFADTLEVGTGRGGGLISIAVLFGSKPDFTILASDSQDLEIIK
3113 :     KNISAIELLSGKPVIAVTLNSRCMNEENLEESIEKMSKELAIPVVDVLKGINLDKLINEI
3114 :     LLKLKN
3115 :     >45357972 glucose-methanol-choline oxidoreductase [Methanococcus maripaludis S2]
3116 :     MEDIIVIGSGVGGSTVFKELKEAFPNQNIRLIESGSDPFYVSEGENVEVIYANSFGGTGV
3117 :     YSVANAVRIDLKEFNISKKDSIYKKIEKELSISDVPDDYLGKNSKKLLESGFSKTPKFIN
3118 :     FELCKNCGLCAHDPCDAKWIPCDFLRKYSDDIVTDTIVMKLAKQDGIFSIVALDKKSGEI
3119 :     KIYRSKQVIVSAGAINSPRILKTILNNEEIGKNLYIDTFVTVGGILKGSNLKSEVSMAIN
3120 :     KKYDEFILATHYSELLHKRISEFENVNKNDIFSLMVKIKDENTGEVFENSVKKEMSMNDT
3121 :     RNLCEGVSKASKYLYDLGVENIYSTVPRGSHPGGTCAVGKVVDKNLETEIEGLYVCDASV
3122 :     IPKAPGAPPILGIMAISEKFVENLKK
3123 :     >45357973 ribose-phosphate pyrophosphokinase [Methanococcus maripaludis S2]
3124 :     MIIIPGLNSQNLAKEVAKLTNSELARVESKQFPDGEIYVRVHNELKGKDAVIIQTQNTQN
3125 :     DSIVEAILMCEALRDEGVKSITLVAPYLAYARQDKKFNAGEPISIKALAKVYSNICDRII
3126 :     TINPHETHIKEFFDIPFIYGDAIPKLAEHAGVKLVKPLVLSPDKGAVALAKRAAEELNCE
3127 :     CDYLEKTRISPTEIKIAPKNLDVSGKDVLIVDDIISTGGTMATAISMLIEQGARTVIAAC
3128 :     VHPVLIGDALNKLHLGGASEIVGTNTYPSEVSKVCVSTIIADILNGE
3129 :     >45357974 sulfopyruvate decarboxylase subunit alpha [Methanococcus maripaludis S2]
3130 :     MNASEAVYKAILDSGVDFVTSVPCANLKTVLNYLNDDKDIQHIPVTREEEGIGVCTGAYL
3131 :     GGRKTALLMQNSGLGNSINAIGSLVKVYKIPILIIISHRGDLKEKISAQIPMGQWTKKLL
3132 :     ETVEIPYFSPKTPDEAYKLIKDASELSINMEYPVAILLDALYWEHDK
3133 :     >45357975 MiaB-like tRNA modifying protein [Methanococcus maripaludis S2]
3134 :     MKIYIEGYGCTLNTADTQIIKNSVNEFEDFELTDNVDDSDIIVINTCIVRQETEHRMISR
3135 :     IEYFKSLDKKVVVAGCMAKALSKKIENLADVLIMPREAQHSGNILKDKLLKDFSEKNNES
3136 :     TQNLNFEDKLNEKIKKVSSQGLITALPICEGCLGSCTYCIVKRARGNLASYDRDLIVKKA
3137 :     EELVKSGTKCLLVTAQDTACYGLDNNDSLPNLINDISEIPEKFAMRIGMMHAKFAEPILD
3138 :     ELIESFKSEKVVKFLHLPIQSGDDQVLKDMNRNYTVDEYISVLNEFKSKIKNLNFTTDVI
3139 :     VGFPTETEEAFENTLEIVKKIKPDFTHAAKYSQRKYTKAAILKQVDTKIRKERSEILNEL
3140 :     RRELSYENNKRHIGETFEILVTKDNMGVTDNCKNVIFEEPAKIGEFKRVKITGAKTFGLS
3141 :     GKLIN
3142 :     >45357976 hypothetical protein MMP0413 [Methanococcus maripaludis S2]
3143 :     MKLGTKKIGTKLLIFSIITVIIPIAILGIVSNNTITQDMKEQSADKLESSNEMANTIMDS
3144 :     RFTELCTLAEYASYTQGVKTSIKTGNVDDLELRAETLKSASNADLVIFTGNGGSTIASSS
3145 :     GEGITLDSTILKVSKSSEKSGFEKIPEQTALKFSDADVTGTDSALSIVVAYPIYDDAGTL
3146 :     GYVAFIDVLNNDHTLVDSIKASTGDESTLFLENYRISTSVVSGNSRAVGTTASDVVYNTV
3147 :     VKENTEFMGSANVVGQSFLTKYVPLKDSNGATIGMVFVGTPEAQFTQLVNNARNNTIIIA
3148 :     LFGLLIAVVISLVSSRSITKPINQLEDGVHKFGSGDYDHTINVKTGDELEELANSFNKMA
3149 :     KDIKELHSMLDADKLSLAKTLKEIFDIMDHLAEGDFSVRADENRHKNKLQKTINHAIENV
3150 :     SKMMENLKSEITVLSDELEDVGEGLKRAKETSEQVTDAANQVATAAADQSAKLQDTSDEL
3151 :     EKTAKAADMVYNDAEQSVDSAIEVKDNSETGVKKVENAIDTMQKITNVIDELGKSIQELG
3152 :     EESKKINEVTVLIKDVAEQTGLLALNASIEAARAGDAGKGFAVVASEIKSLAEEIKKSVE
3153 :     DINRTINGINKKVETTIDLGLAGRDEVDRGVVAIDEVNSAFMKIKESVETSAKMIAQIKD
3154 :     NAKNASNNTQEALRNVQDIASISEEFAATAEELTASSEEQNRAVEEIDASAEKMMEISRK
3155 :     LAEDADEFKTK
3156 :     >45357977 threonyl-tRNA synthetase [Methanococcus maripaludis S2]
3157 :     MKTLLIHSDYLEFEAKEKTKVAEKTDVLNGKMDECLTVFIAVEKDDESDPNAVVKNAVEE
3158 :     IIKTADNLKVKNVVVYPYAHLSSDLGSPATAKEILAEIESELSNNYEVLRAPFGWYKSFK
3159 :     ISCKGHPLSELSRKITTDRKEEVKKEKVVSKFYIIDGESQNLTEVNDEIIAKMEDKRLLA
3160 :     LLKHELEIKEEATERGEPPHVKYIKEKEICDYEPSSDAGHFRWYPKGKLIRDLLSDYVYN
3161 :     LVVERGGMPVETPVMYDLQNNAIREHADKFGERQYRFTQGGKDLMLRFAACFGQFMMKKD
3162 :     MYLLPKHLPLRLYELSTYSFRYEQRGELVGLKRLRAFTMPDMHTVCMDMKQAMEAFEDQL
3163 :     WMGLKTGDDFKTPYAIIFRFTQDFFDENKEWFFAMAKEYKQKYGKDAILEILSGRKHYWV
3164 :     GKVDMAVVDSFGRPIENPTVQIDVESAERFGIVVHDGDKKVHPIILHCSPTGSVERVLCG
3165 :     LLENAYLNTLENKPPALPTWLTPIQARVIPVGDKHEEYALEVVNKLRSSGIRADFDDREE
3166 :     SMGKKIRNAGTDWVNYVVVIGDSEMESGKLTVTVREESELKKPKKESLSVEELIEKISSE
3167 :     TIGAPKRPLPLPMKCSMQPIFR
3168 :     >45357978 O-sialoglycoprotein endopeptidase/protein kinase [Methanococcus maripaludis S2]
3169 :     MDNSKDDLICIGFEGTAEKSGVGIITSKGEVLFNKTIIYTPPVQGIHPREAADHHAETFV
3170 :     KLLKEALNEVPLEKIDLVSFSLGPGLGPSLRVTATTARALSLSINKPIIGVNHCIGHVEI
3171 :     GKLTTDAVDPLTLYVSGGNTQVLAYTGKKYRVIGETLDIAIGNCLDQFARHCNLPHPGGV
3172 :     YVEKFAKDGNKFIKLPYTVKGMDLSLSGLLTSAMKKYDSKERIEDVCYSLQETSFSMLTE
3173 :     ITERALAHTNKAEVMLVGGVAANNRLKEMLKVMCEEQNVDFYVPEKQFCGDNGAMIAWLG
3174 :     ILQYLNGKRMDLKDTKPISNYRSDMVEVNWIHDESKNLNDGNIKSRKIPKHLIGKGAEAD
3175 :     ISKGRYLEFESITKERVKKGYRILKLDELIRTRRTVKEARFLAAVKECGIHAPSIYDIDK
3176 :     ENKKIIMGYIHGKIAKDEIEEGNIEFCKSLGETIGKMHGSGIVHNDLTTSNFIISKNPYI
3177 :     IDFGLGKYSDLIEDKAIDLIVLKKSIMSIHYDKFDLVWNKIIDGYKTYELAESVLECIKE
3178 :     VEKRARYL
3179 :     >45357979 hypothetical protein MMP0416 [Methanococcus maripaludis S2]
3180 :     MKRLNHSRCRINDCAYVVAISLGLNILGSQAVTYLQLPAFLDSTGTILAAVLLGPLFGSL
3181 :     VGLLTNLIEGFFIYSGLYYFAIVNILIGLVTGVIFKKYPFNVKYVVITTIILALIGTIVG
3182 :     NIIAYYLFGGITGSPIDDITIYLVSSGMSVYNAVFVSGFIINLFDKIISFVLVFVIIGFF
3183 :     QKYVDKCYLNIKFDDKTN
3184 :     >45357980 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)me thylideneamino)imidazole-4-carboxamide isomerase [Methanococcus maripaludis S2]
3185 :     MLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVNEGAEMLHLVDLDGALDGKR
3186 :     VNDEFIEEIIKKSGVPVQIGGGIRSIEDAEYLVEKGAKKVIIGTIAVENPEIIKELSKRI
3187 :     GSEKIMVSLDAKDGKVVIKGWKEKTKYTPVQIGKILEEMGAGSILFTNVDSEGLLNGINI
3188 :     EPTKELVDNLKIPIVASGGVTTIDDLLKLKEIGVYGVVVGSAIYKNMINLKDAIEAVNKS
3189 :     N
3190 :     >45357981 carbohydrate kinase, PfkB [Methanococcus maripaludis S2]
3191 :     MDKIGKITAVGHIALDYIFNVDKFPELNTSMQIPTAKKYYGGAACNVAAEIANLGVKSEI
3192 :     LSCVGTDFKASGYGEYLEKLGVSTKNVYVSEEEETPKAWIFTDPQNNQITYFLWGAAKHY
3193 :     PEIEVPEFDSEIVHLATGDPNYNLKCAQKASSKGIFVSFDPGQDLTLYSKENMENIIENV
3194 :     DFLFMNNHEFQRTLDLLNISEKELISRVKVLIVTYGKQGSIIYSEDEAIKVPAILTQAKD
3195 :     PTGAGDSYRAGFLTAYLKGHDLKNCGLAGSCVASFVVEQVGCQTNLPSWEMVIERLNENN
3196 :     LL
3197 :     >45357982 sodium:neurotransmitter symporter [Methanococcus maripaludis S2]
3198 :     MAREQWASKMGFILAAVGSAVGLGNIWRFPYMAYENGGGAFLIPYFVALLFVGIMVMVLE
3199 :     LALGHSTKGSAPLALRRLGKNFEWIGWLAIATAFIITTYYTAIIAWALVYLVKLFMVGFP
3200 :     TDFGGFFFSDILALSSGHGDLGGFNLPILVGLALIWGVNYIVVNSGVRKGLEKANEILMP
3201 :     VLFFLILALVVRSITLPGGLMGIEYYLTPNFAVLLTPKVWIDAFSQIFFTLSLGFGIMVA
3202 :     YSSYLPKKSDLTASAFTISLMNCGFSFLAGFAVFGTLGYMAMTQGVPISEVVTQSIGLAF
3203 :     VAFPQALSLMPGGIILAAIFFIALFVAGISSSVSLVESTASAVIDKFNLPRHKAASAVIA
3204 :     TSFFASLIYATNAGLYWLDSVDHYINWFTIPLVAVLEIIVSIWIFKGSKLEKYIDNLSEY
3205 :     NLGSFWKFFAGIFSPLFLIYMILNGAWTELTLGYEGYAPIFLLLSLGIPVFGLVVSLIMP
3206 :     MIPWIDKGREIEEWDEFVKKDEE
3207 :     >45357983 CBS domain-containing protein [Methanococcus maripaludis S2]
3208 :     MLFRKLSTIERVYNIGMEHDSINYVFNYITNFIKESERDLVKLYDLKVLDKIVINDIMTK
3209 :     DLVILDEEESIDELGKLIKQYRHMGYPVFNSNKELVGIVTFDDLRTKKSSMSRLKKLKIK
3210 :     DIMTKKDEIVSISPYSSASEAQKIMVEYDIGRVLVVDDGKLKGIVTKGDIVRTSEIYNPE
3211 :     PKINKCSHITNIYFYGDNPKKVEELAEEIIVLMGARGYIISEKEDFIEISDREWEPIAKI
3212 :     MKRNGKIDHISIDTKLINILELNIIKEVLKLIEKPKFEEVIITDHITLVDEKSAIQRIIT
3213 :     DVTMFEKSMKTFGTITVRIDF
3214 :     >45357984 hypothetical protein MMP0421 [Methanococcus maripaludis S2]
3215 :     MYQIIRYEGGVYKNNILKEWIEDVGGFIIQEHVMQLDVYMTIAIPQNEIENFKEEAKKYK
3216 :     GKIVETPLAGIEIAIVSPSLSRHHLPHIACDVSEYVRKFGAKPNMIGLAHGAGKNISEIR
3217 :     EKEKRLIQEHDIAIYVMGNFESCILDKTHLFKVDIPLVVTGGPETLDIPYTYVGNLGRRA
3218 :     QRLRKGEEIRALRQMIDEVTKKINDKRMELSYDPPIIPPVVLKDEIEKRIDEVRGILAPM
3219 :     PIVTQLDGLRIKMDYDRNHEEIENVKIGKYLLKDIAYVTRSEMKNYILIKLKSTSELKTD
3220 :     ENKA
3221 :     >45357985 hypothetical protein MMP0422 [Methanococcus maripaludis S2]
3222 :     MEIDRTTENETEIENEESEQIIEVPLPPGLPQSVIGRLSCVCDIGYEIKKDEMMDKEYPI
3223 :     IRGTQEQIDYVKDYIFLFTELKLALREISRLARRFKTDVKLFTEDDELQYVLGFAVQDVS
3224 :     GRDRFEVLMEKPEGEGEKIVILEREFYVYL
3225 :     >45357986 hypothetical protein MMP0423 [Methanococcus maripaludis S2]
3226 :     MIKGGEMDFEIEINSVSELLDYLKDLDELSKLIRFEYIGHPEDYDKSIKYLMEAQDLKLR
3227 :     IIRIQKKIKQDEKELPSHELQKSEILINSIEKNKNSTNGYANELLENNKKALKFLITEIE
3228 :     DKLLKWLSNNQDSIFLKSSPYNYLMEQGFDIKTAEEGYKNILLSNLITLILHERSIQNEG
3229 :     LKIIEDNLKKLENELILFKPKKDILVYRGQKNSKWGLCPSVFRKKDDFEDRLMYPKCEHE
3230 :     FYKSVLEHNLPEFEKQKCIFDRLALMQHYQIPTRLLDWTKNPLVALYFAVEEHQEKGNLL
3231 :     DGRLFVYCPNRIYSSTDFEVKLFCELFEKNSEVCEVSKLKDIEFEGKTLINRYKFNEEGT
3232 :     NAYFKMLLSRILLIKPVITNNRLRVQQGFFSMHGFKLEKLTEDLEIIKFNEITDYTLKND
3233 :     EEILATFIIPSDKKKEIREELERLGIHDGTMFPELDKYGEYLKKKYSN
3234 :     >45357987 hypothetical protein MMP0424 [Methanococcus maripaludis S2]
3235 :     MKLFCFESTRVKQYLNLEKIQAIRLHPENDNFTLSVYSDSEVITYTLTYEEYIKFVTDLE
3236 :     KIDGLKGSKSS
3237 :     >45357988 hypothetical protein MMP0425 [Methanococcus maripaludis S2]
3238 :     MQEVHKWHNDLTGKKLVENLKKNLFDAYYFEDGSEVSKYIMNYVGTGTKIGFGGSVTVQS
3239 :     LNIAEQAMEKGAVILDHNDASLTQEEKMDIMRQQLTSDIFISSTNAITASGELVNIDGVG
3240 :     NRVSAIVFGPKKVIIVVGLNKLCKDVETAFERIKMQAAPKNMKRLGFLNPCIKTGYCVNC
3241 :     DAETRACRIYSVIKRRPMLTDMTVLVVGKSLGF
3242 :     >45357989 nitroreductase family protein [Methanococcus maripaludis S2]
3243 :     MNQVLETIKNRRSVRKFKKEQLKDSEIEAILEAAIYAPTALNEQPWHFTVIQNKELLDEI
3244 :     NTVSKKTLAENPESMKNMPESLINAMSNPKYNILYEAPTLIVVSGNKNAHAAIVDCSAAI
3245 :     QNMLLAAESMNIGSVWLGLVRPYFTTENVKKLNIPEEFESFYGVAFGYKLIEKSKTAPER
3246 :     KKDVVNYIK
3247 :     >45357990 replication factor C small subunit [Methanococcus maripaludis S2]
3248 :     MQKPWVEKYRPETLSEVVGHHEIIKRLTNYVEKKSMPHLLFSGSPGVGKTTAALALAKDL
3249 :     YGDTWRENFLELNSSDERGIDVIRTKVKDFARTKPIGDAPFKVIFLDESDALTSDAQNAL
3250 :     RRTMEKYSDICRFILSCNYPSKIIPPIQSRCAIFRFSPLKTEDLVENLKDISEKENLNLE
3251 :     KGGIDAIIYVSEGDMRKAINVLQTAAAVSDEITEEIVYKVASKARPDEIKKMTQLALNGK
3252 :     FVEAREQLYNLMIDWGMSGEDILIQVFREVPNLDISEKEKVHLVEAIGECDFRIVEGSNE
3253 :     RIQLSALLAKMGILE
3254 :     >45357991 vanadium nitrogenase-associated related protein N [Methanococcus maripaludis S2]
3255 :     MILHPRPSPIAAAMYQLRDIGVDAIILHGPSGCCFRTARLLEIDGIRVFTSAMGENDFIF
3256 :     GAMDKLRDVIAEVLEYLKKETPKSEKYKIGIVGTCASMIIGEDLESLIDDFDDIIIPVDI
3257 :     HSGLVDNTVGAIRAMDGALNAGLIDYSEYERQKKMLVCATDVEKKRGMAKNRYLKPTYED
3258 :     DLEKFMNILKETDSKRKQGKDVKIACVLNAKKETAYLFSDPLLELNKHFECTNIANLDEN
3259 :     IGFDKVRADAKNILEEFSKCGFKIDYITGGLDEYPITGEKALDYLKEINPDIVVVSGVPH
3260 :     ALLIENLKEINPDVITVGISDGPRLYHPIKEVYSYGIIELDAHAKVLGKKNIVKSRFGEI
3261 :     LSFMKF
3262 :     >45357992 hypothetical protein MMP0429 [Methanococcus maripaludis S2]
3263 :     MTKLRRMVLDVLKTHEPKLTDLAVKLCSVDGIDGVNVTVYEIDKSTENIKITIEGFNLDY
3264 :     DAIKAIIESMNGVIHSIDEVAAGKKIIDEVKTPQDRY
3265 :     >45357993 ribonuclease P [Methanococcus maripaludis S2]
3266 :     MLEGIFDINHVFDEEGIKTLKRFGWDGSVAVQNHNEYSEEKINTAVEYGENCEFKVYSGV
3267 :     KISTKNQNEMEKAVKKYRNKVDILLVEGGDVKINRRVLEMNDVDILSTPELNRMDNGLDH
3268 :     ILARLGSTNRVAVELNFGNLLKSKNYDRSKILWAFQRNLKLSKKYDTPVVISSGANDIYG
3269 :     IKAPGDLRGFLNTVADPLYSKKIIETTSKIIDYRLYLKNKNVLMPGLEIVEE
3270 :     >45357994 rhodopsin-like GPCR superfamily protein [Methanococcus maripaludis S2]
3271 :     MELYFRGGASEVGRSCVELKTEKSTVLFDCGVKLSHEESEYPILDNLNADCVFASHAHLD
3272 :     HTGGIPLLIRKGMVPAIYATEVTKAISKELLRDSIKIAGAEGQDIPYDKADVNKSLNLFR
3273 :     KARYNHPKDFKDFEFEFFNAGHIPGSSTISLNYGGKRVVYTGDTKVSDTDLVKGADLSYT
3274 :     KEDIACLIVESTYGDKNQENREDAEKNFINKIKETLERGGIPLVPVFAVDRSQEILMILN
3275 :     KHDFGVPVYFDGMGRKITRIMLQYPKFLNHPDDLKAAFLNVIEVESKDRPKIIKDIKQNG
3276 :     GIIVSTAGMLEGGPIIPYIHEFMEDPKNSLIFTGYQVEETAGRKLLETGKIEIGEFDIEP
3277 :     KLEIASYQFSAHGEMDELREIVKKANPEVLVIQHGEEEVVKIFKDWAVSQGFNENSVFTP
3278 :     KIGDKIKLTEFLK
3279 :     >45357995 TatD-related deoxyribonuclease [Methanococcus maripaludis S2]
3280 :     MIDSHVHADTRPYEDFELMATVFDCVITHAHDPLKMRSFDVALDYFDKILGNEIAKARKN
3281 :     GLNMKACIGIHPRAIPPKIDYDVLKEYLKKENVVGVGEIGLEKCSKEEIEVFENQITIAR
3282 :     EMDLPAVVHTPRTNKEAVTKNIVEVLESMDLPIDFKKKIVIEHVTKETVPIIWENDYKLG
3283 :     ITVQPQKLTPNDAVEILGEYCEKRFLLNSDSSSAPSDILGVPKTVLKLKMAGFDEKVIRA
3284 :     VSHNNAADLFKIN
3285 :     >45357996 putative flavodoxin [Methanococcus maripaludis S2]
3286 :     MDEKKLVIYYSLFENTEYVANLISENTGADLLKIETVAEIPKKGLAMFLELGRFLLFRKM
3287 :     PEIKEISVNLDEYDTIFIGTPVWAGNMAAPLKTFFSKYKFDGKKVAVFCTAGKTIGNTLE
3288 :     NMKKELIDNELIGGTVFLDVLNHKEETENYVKEWLTTMYRSKED
3289 :     >45357997 hypothetical protein MMP0434 [Methanococcus maripaludis S2]
3290 :     MEGEHHIEKRPSIVSRTHSRKDALDWVSIVLVIIGGLNWGLVGAFNIDLIQAVFGSFPSV
3291 :     ARILYILVGLSAIYMIYYASKT
3292 :     >45357998 hypothetical protein MMP0435 [Methanococcus maripaludis S2]
3293 :     MNKMSHTTIKDGIDCVISKDYFYKTESYYKLISKEISGKNKVFPSSNDVLDAYIVPVALK
3294 :     RAELAGIPILQWEISSGEVPNPSIVYSVNYFSDPSTYYIVKNREESRKISKHVTNCGKYP
3295 :     LCYQKVPENFEMVNFSIFFGQVCTENENIKQIANKIYQTFKIPLINALFVIIDDKIYLSS
3296 :     LSPVNVSKLSKEEKLMIEKTLLVD
3297 :     >45357999 RimK domain protein ATP-grasp [Methanococcus maripaludis S2]
3298 :     MGKFGVFVDRQTLSSSNQLQSLIRFRDIAESMGHEFYFLFPNEIHKIKTLNGLFIRSKTD
3299 :     PMNISYVASRIAELNGVKVIDDSKSIQICADKINMYLHMMKNNVPLPKTKFLRKSENNFE
3300 :     NLKSIVEEIGLPLILKEPSTSFSMRVEKVNSLEEFSKVASRFLRLSDVLVAQEFIETRFD
3301 :     WRVGILNGEVIYACKYLIPKDTFKIQDCVDGHRVYCMVESVMYDEVPKEVIKTALKAANA
3302 :     VGTGLYGVDLKEKDGSIYVIEVNDNPSLETTEDEFYPEAYSKIVSYIMDDSRQKYSGGKM
3303 :     KFSEVIDPDGVANDRN
3304 :     >45358000 hypothetical protein MMP0437 [Methanococcus maripaludis S2]
3305 :     MIGTEHEYSINNPDLKAMPVSDLIIEEISGKIQNEFSFETVGISKELQKHVIEFKPLNPS
3306 :     ESISNLENQIFNGLKGFYEKTNNKYKLLGLGMHPTLNLSETSFWNHDEREVFDTYDRVFN
3307 :     LRQHGWMNIQALQVNVEYSTEEDLVRKHNKLRTLLPYLVAVTASSPIVEGNVTGYMDNRL
3308 :     LYYKKNQKEIPEICGNLIPEKLEKSSDYEKLLEKMYVELRKKDAEVLCEEWVNSRALIVR
3309 :     RERKCVEIKIMDEQESIYADMAVSAFINCLLRVNDLKVAEDDETILELTDIAIKSGKKKL
3310 :     KAELESLYKKAVSVATEEEKSYLIHIQNRIQNGNLSEVILKKYNSEKDISKILNEAESCL
3311 :     RENKTMF
3312 :     >45358001 hypothetical protein MMP0438 [Methanococcus maripaludis S2]
3313 :     MENLIENLIIEFVKNYSKEHDTKTKWLTPIVGFADSCDPEFLELKQVIAEKHLTPKEVLS
3314 :     ESESVICYFLPFEKEINLGNVKKGLASKDWAISYVETNNMIEKLNDYLSEKLGEMNHTCS
3315 :     KIPPTHNFDKEKLISYWSHRHVAKIAGLGTFGINNMLITEKGCNGRFGSLITSAKLKPSE
3316 :     KPDYEYCLYKYHGSCKLCIEKCEKEALKINEFDRKECYKVCLTNQKVYEKYGVADVCAKC
3317 :     LCNVPCSFKNPAKNLNDKLKSENKS
3318 :     >45358002 dihydroorotate dehydrogenase 1B [Methanococcus maripaludis S2]
3319 :     MLKTKLWDIEFKNPVFLAAGVMGETGSALKRMAKNGAGAVCTKSVGIEKKPGHNNPTMVE
3320 :     VEGGFLNAMGLPNPGADEYAGEIERIKDEMKRMNVKIIGSIYGKNDSEFQKAAEIIGNYV
3321 :     DVLELNISCPHAGGGYGSSIGQDPYLCKNVVSAVKDVSDIPVIAKLTPNVTDIKEIANAV
3322 :     VNAGADGIVAINTLGPGMVIDIESGVPILGNRVGGMSGKAVKPIAVKNVYDICSAVDVPV
3323 :     IGVGGITTGADAIEFMMAGASAVQVGTGVYYRGYDIFQKINNEIEEYLLKKDLKMSDIIG
3324 :     IAQK
3325 :     >45358003 DNA-directed RNA polymerase subunit E' [Methanococcus maripaludis S2]
3326 :     MYKILKISDTVRIPPKMFGNPLSENVKRVLMEKYEGILDKDIGFILSIVDVDNVSDGSII
3327 :     YGDGAAYHETEFNVLTYVPELQEVVDGEIVDVVEFGAFVRLGPLDGLIHISQIMDDFVSF
3328 :     DPKREAIIGKETGKVLEKGDKVRARIVAVSLREEKKRGSKIALTMRQNGLGRLEWLEDEN
3329 :     ETLSEEN
3330 :     >45358004 DNA-directed RNA polymerase subunit E [Methanococcus maripaludis S2]
3331 :     MNACLRCKYITKEDTCPICGFDTSDNVRGLLIVLDPHNSEVAKKAGIDIKGKYALSVK
3332 :     >45358005 hypothetical protein MMP0442 [Methanococcus maripaludis S2]
3333 :     MYLLNDKVAHELKKPFGKVYKELPSIEGKVVSIGDVTTKHLLSNGIIPDLSILDFKTKRN
3334 :     IPVDIPHKFKTIFEVENPQGCISDEAIERIKYLSTIHDRDMALIIKGEEDLLTIPVIKYF
3335 :     PEDTSVIYGQPDEGMVLLKITDELKQKIEKLLKEMEER
3336 :     >45358006 30S ribosomal protein S24e [Methanococcus maripaludis S2]
3337 :     MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFG
3338 :     KLEAEGYAKIYNDEKAMATIETKSVLEKNKIEEEAEAEVAEE
3339 :     >45358007 30S ribosomal protein S27ae [Methanococcus maripaludis S2]
3340 :     MAAKKGAKTSTKKSDYYKVEGNTVERLKKVCPKCGAGVFMAEHLNRFACGKCGYMEYKKN
3341 :     EKTESEE
3342 :     >45358008 hypothetical protein MMP0445 [Methanococcus maripaludis S2]
3343 :     MELINVICHWAMYEDAIDLKKPPNWILEYFNHKYPEESLEFSMDFLCILGKFQKYPETKV
3344 :     YVPIKNVGKIADVFGLLD
3345 :     >45358009 nitrogen fixation-related protein [Methanococcus maripaludis S2]
3346 :     MKIAVPVFENKICEHFGKTALFLIFELDETCEVVNILRVQNTPCDGNGGGSPAEKLLLEN
3347 :     PDVIIYNTMGKKRIETLKGRVNLYHTKTQDIKSALKECIDNILKTNNK
3348 :     >45358010 nitrogenase related protein [Methanococcus maripaludis S2]
3349 :     MKIAIPILDEKTVCSHFGKTPFFMIFEVNENNEIIGSKKVGNSPCHGAAHETEQGHGGQG
3350 :     PGSTVQTLLSEGVNAVVFVNMGQRSVNALASVVELYQTSLEDVDAVLKEVLSGNLTKLN
3351 :     >45358011 hypothetical protein MMP0448 [Methanococcus maripaludis S2]
3352 :     MDYRLHRNCICRKLLGTTEYVGLGIRRFFRMGLTNEEIKNIIKRETGNDISDEEVTNLSK
3353 :     GISEEDVIDARGRRNFFGAGRGGRMGRGMGRGRF
3354 :     >45358012 ferredoxin [Methanococcus maripaludis S2]
3355 :     MKQIVIISGKGGTGKTTISSSFSELMDKRNIADCDVEAPNLHLMFENEIINTKEYIGSQT
3356 :     ASIDTEKCIKCEKCLQCRFGAITPEIKVNPLKCEGCGLCEYVCPADAVKMVDNVTGHIYS
3357 :     CKIKDGYLSYAKLNIGAEGAGKVVTEVRKNSLENQGFENLLIDGSPGIGCVVIASLTGCD
3358 :     YAVVVTEPTTSGLDDLSRVLELTQFFDIQSYVIINKYDINEEKTSEIIDYCKKSGFEILG
3359 :     KVPFDNTVNKAIQNECPIVNYDCPAGNEIKRIWDDFYDKLK
3360 :     >45358013 ferredoxin [Methanococcus maripaludis S2]
3361 :     MNISILSGKGGTGKTTISTNLSILLSENHENVSYFDFDVEEPNGFIFLKPEIEIENKVFK
3362 :     KVPKIDKELCTNCGECSKLCKFNAISITPNNSTVFEKLCHDCGLCYIACPVQAISEILRE
3363 :     IGKIESGKSKDIPNLNAFRGVLNIGEPSGVPVISALKKFLDVNSINILDAPPGSSCSVIN
3364 :     TVEDSDYSILVTEPTKFGLHDLKIAVEVLRYLNIPFGVLINKSDEFDCIIENYCENEKID
3365 :     ILGKIPFSRNIANKYSKGDILINSDAEFTENLQNIASELEKRSIL
3366 :     >45358014 hypothetical protein MMP0451 [Methanococcus maripaludis S2]
3367 :     MKLCITSTGNTLESTFEQRFGRCPYFIIYDTDSKEFDAIENTNGDSAHGAGIGSAQEVVS
3368 :     KNIDVVISGNMGPNAKQVLDGENIKVYKGTGSTVLENIELFEKNELSEITQAGKPHQGM
3369 :     >45358015 hypothetical protein MMP0452 [Methanococcus maripaludis S2]
3370 :     MKSDEQMLRDLQKITISFGVMFIVITAYLELTKNWDSMLLILPTSGFLLIIAGLHKQIHE
3371 :     NDDFRSYFLLGITLLIIAVAVLFILLLYFA
3372 :     >45358016 neutral zinc metallopeptidase [Methanococcus maripaludis S2]
3373 :     MGIPIELHITFILLLIVVFYFWGIEGLILYMFLFTSVVLHELGHSYVAKKYGVKIEKILL
3374 :     LPIGGMAMMSEISKEGEFKIAIAGPLVSLALGTVLLGISTVTDYTLAEYPLFQTVGGLNI
3375 :     LLGIFNLLPAFPMDGGRVFRALLSKLTSMSYIKATKLASTVGQYFALALLIFGLINFNVI
3376 :     LVLIAIFIYFGASQEYRALVADTLFQDVPAKDIMSKNIVYVNSEDTVDDVLNLMLENRFL
3377 :     GYPVLENGNIIGTITMNEISSTTAKTAKVKEIMSPPVMVSPEAALNELIKGMANTDRVYV
3378 :     VDNGNILGIISKTDIVRTLSILGIKNNR
3379 :     >45358017 hypothetical protein MMP0454 [Methanococcus maripaludis S2]
3380 :     MSEKYKTYHTSKYLSKEDVENLIKEGVDEVTMPKSIYEYMEKKNKGALNRLLIFGVDVSI
3381 :     TDQVGRPKKVEGDIKKKIIEEIINGKSIRKVAEEYDLKKSTIWDNIKDDMAKIKQEKFRK
3382 :     MIYDYKELLIEKERYTEYIETLFCELDMNISNDNLKEAEKILLKIIEYSKRKD
3383 :     >45358018 amino-acid ABC transporter [Methanococcus maripaludis S2]
3384 :     MKKICFLMAIVLILAISACISLPSEQITIKTGTLSVGVFKHAPPAVYGQNGELIGFEVEL
3385 :     VSEIAKRMNLNVEFKEYMFSNLLNAVANNEIDCAISDISISPEREKIVSFTRAYSHTELV
3386 :     VLVRKESGIRTITDLNGKKIGVVDDTIHETKAKSLQKSMDFEIIEYETPIELYNDLNNGK
3387 :     IDATISEMDNFKVSSYMDQLELIDTLEILYSGIAVNKNNKELLHEMDRVLLELETEGYIE
3388 :     ELKQKWSN
3389 :     >45358019 Phage integrase [Methanococcus maripaludis S2]
3390 :     MTRHYCKDWLTKDELKLFIDTVDSKEHKLFFKMLYGMALRVSELLTIEVKNINLNEGVCK
3391 :     LLDTKTENFQICVIPEWLNEDIFGHIVDNNLKDDDRLFKFKNRTYAWELVKKYTKDAKIH
3392 :     KEFSTHTFRRSRALHLLNDGVPLEKVSKYLRHKSINTTMHYLKITVDDIKKELVKIGDWY
3393 :     DL
3394 :     >45358020 DEAD/DEAH box helicase domain protein [Methanococcus maripaludis S2]
3395 :     MESFKNLGLSDEILEALEKKGFTNPTPIQEQAIPILIEGKRDIVGQAQTGTGKTAAFGIP
3396 :     ILETIDEHSRNTQALILAPTRELAIQVAEEIDSIKGSKRLNVFPVYGGQSIDRQIRELRR
3397 :     GVQIVVGTPGRILDHISRRTIKLENVSYVVLDEADEMLNMGFIDDVEEILKSVSTDKRML
3398 :     LFSATLPDSIMKLAKNYMREYDIIKVKRQQLTTTLTDQSFYEIHSRDKFELLSRIIDTEK
3399 :     EFYGLIFCKTKADVDEVANRLNEKGYAAEGLHGDMTQAQREKTLDKFKGKKINVLVATDV
3400 :     AARGIDINDLTHVVNFDIPQNPESYVHRIGRTGRAGKQGYAITFVEPSEFRKFKYIQKIA
3401 :     KTEIKREEVPDVKDIISAKKIKIISGIKEVLESGKYADCEKMASDLLEDADPQEVLSAVL
3402 :     KYALKDELSESNYKKIGRGSQRSERSGRNDSRGRRSFAPGENVRLFVALGKLDKMNPKKL
3403 :     VDHISRKSDVKGRDIDDVKVFEKFSFVTVSSSDAEIILDSFKNERRGRRSIIEVASGN
3404 :     >45358021 hypothetical protein MMP0458 [Methanococcus maripaludis S2]
3405 :     MDAYDFDINLQKVFYSYFKDIKSSNWKKWLDISSVEEYEDAIFKNSGLSNDIITDTYSKK
3406 :     TDPKEFSLNPKTFLKENLEKDDINNLFSKDTAIVTHTSGTSGGDITKLKWFLISDDFLKR
3407 :     VWVPGMQAIFESSGLSKNRSAVIFVPSRIKVDGLSKVDDLNLIRLYTSEFSQRVVLSHIR
3408 :     PSSYLIDEYKNALNLLTISKILTLDDISVISAPAATIIKWADIDKLRTGLEKSINSIDWE
3409 :     TIKEENREAFELKKLYDRIGLKNFAEEIQNRLSEALKDSTLIFSITSLSKDEWAKIRKFM
3410 :     GWKVGEEKFTNLYVGSEIGPFAGGINKEDNYRMYAFPLTYPVIERKGKKEFISKTKDKYG
3411 :     VLLVSRPGSNPLINIDTGDVITILNQEGIPKISGEILRSGFKLKLEMKLEGFPENTEFFA
3412 :     GDYFDIGGIEVFNPRKMVSCMGQKFGLETDNPVLLVSSDSYKMVLPLENNKNVLIDKIKE
3413 :     EMPNCSIGEDIEKALKNEKISLEMGNTNVKTAIDHTELLEKVKMGDLPKGVLKKWPFYIL
3414 :     NVPDNAKI
3415 :     >45358022 hypothetical protein MMP0459 [Methanococcus maripaludis S2]
3416 :     MIRICPKCLNAVVHYKKEYLTGKVRPVFVDTENKCCGYLQTESVFNTAKCSKMQLLKTQA
3417 :     GKISKQLNLSDELKYEFFENLKRFKRTHNEWKDYRVLEEALNSGLSTLNTKLQNDQAILK
3418 :     KKVKI
3419 :     >45358023 hypothetical protein MMP0460 [Methanococcus maripaludis S2]
3420 :     MTKLTKKQVTDLINTGEGYTLEFKESLNASLAKEICAFANSDGGHILLGVTDSGDITGYP
3421 :     LSNQDDARITDIARNMDPSFSVNLEKVDNVVVITVPKGENKPYSTGGLYYVRNGSQSQKL
3422 :     KREEVIELFKYNGLISFEEIPNKEFDLKKDLNNSALNNFITASGITNKLKKEDLLNNLYL
3423 :     LKDGFLKNAGVLYFCNNSTKFFRNAHITCVLYEGTSKSNILDRKDFSKDIYSNFNDSFDY
3424 :     ICSKLNTEYIIGKERVERLELPKEAIREALVNSIAHRDYFSSGHIQVDIFQDKLEISNPG
3425 :     GLVLGLSYSELGKRSIPRNPLLADLMLRSKLVERVGSGIIRIRESMESYGLNCEFNVSEN
3426 :     YFSTVLGRKKGFKFPVSFSSTNAVSRSDKIIALIMENPEITILEISKLLNLSHSTVRNEI
3427 :     KVLKENGIVKRVGPTKGGHWEVVDTKK
3428 :     >45358024 hypothetical protein MMP0461 [Methanococcus maripaludis S2]
3429 :     MVKKFLQNSGNSRALILSITERDHLEVIGVDSEEVELRYDKINGIPCIVLYGSGNYKKMI
3430 :     ENRE
3431 :     >45358025 hypothetical protein MMP0462 [Methanococcus maripaludis S2]
3432 :     MFNYLKLLSECGINSEFISFEDLKIKRKSLNSFSSSKESQFKLKINDGNNTNIQANTVHL
3433 :     HIHINKQKTPGEKKSKLFKKYLLENIFLKDQFETIKRDSEYKNEPDYKVILKEFKKEFYV
3434 :     KCNFRSYLYNGFYDWGRIDQLNEFKRFFKSSEIPTYFAFGLSGTPEDPGNLYLVPGENVS
3435 :     PKMKIEDLEKWEISSFKDVMRVILD
3436 :     >45358026 hypothetical protein MMP0463 [Methanococcus maripaludis S2]
3437 :     MYILLFEGGNMEPEILDKITPKQSRIYEGLSLIGNEIASFYLDAILLLNDPKYSTRCNII
3438 :     AHLGREISTGLMDIFDKDKKIIKHTNEESINYSLNSEYEELAKKWDKYSKKLPKYAHRHG
3439 :     AWKEPRNLEEILGYWNEFENVLYELVGHSYIIRDRIDRLCDYDVPSKNIINTLKNITKED
3440 :     TLNHYFFNKLTHSQWLNLLTIHGFFNPEFNQKPVINEKGYYYCELWPALIYLKKISEQAE
3441 :     SEELIYELLDTINPIVDYSLANNINNYKNNPIIVQIISNIPIGYLNSNHINFINNEIQSN
3442 :     DILSIDTELTNKIIPNLINENNIEIFSQILEKIIDFKILDENSYNIKLNIDEYYLTEILD
3443 :     KIKKELPNSFFENTFKIIINAIKKHPNELFLCSLNTSDFDKYSNYENAIFGILKHILINS
3444 :     DVKLINKLLEISCTEEGIFFKKLTYYLLDVRYDDINEFFWDLENPLLDGFCMPEIYQLLK
3445 :     NNSSKFTRTQLETCIKWVENIDESNNEPLTEAYHKKVWLSALLPSKSALIFKNNAYYNII
3446 :     NPAKLDHPGELVWVSDNVYSGPYSKEYLDKLSDEEIVKLIQKLENENNKYELYNLGFTSF
3447 :     VSENIQKISNNIFKYLELDIKYQVGILNGIFSKIANNKSKPEFNIENVLNYIIQLLTQQN
3448 :     LEGYESKSLNSLFTNILWVLGRIHNNYSEKYDEKILEIMYLLSAQICEKSLDNGTMGYLN
3449 :     ITWKFECYQLIISIAFNRYNKLNVLDNDIKDFLSSEIDNNSSWELFQAIGMYYSQFLKID
3450 :     DFWAYQNFDKIFFDEKFWINSFEGYLYSSKSTKLYGLMVNKGVYSKALTSELDKKLQNEL
3451 :     MKQSILYYIRGYDDLDDKNGILCKILSLNWTLDPQSIWRIKTFEEYTDENKQRIKNLWTL
3452 :     LNKKCLEEPTEHNRKILANLAKLLPIFDKLDDEIIKLSILDIPSMESSHTYSLIKELLQY
3453 :     VDDQPSEVGIILNEIVKNENTYSNNPKILELVEKLYINGHNKIADEICHNSGRNGGMILR
3454 :     EAYSKYHSN
3455 :     >45358027 hypothetical protein MMP0464 [Methanococcus maripaludis S2]
3456 :     MSEDLLKTHTFKLNEDDSDQFSKIVENSGYSSKVEYLRNHIRKEYPKIPEKIDIRKKIRL
3457 :     IERYGTICFYYDYDENYTYPRIVKNYPELSIDDLDESDLLKEEFKKDYEDVMYAIKDYFL
3458 :     QGRIYSDLNWIEILSKGQDSDEIVLQIDRLQKSIENFEIETYSDEPRGIWIWYIVFFLMY
3459 :     NDIGSGARCCDYALKFSDLFKISKKVRYELLNEDETDPKKILTYPEYEEYVKIRKEATIK
3460 :     H
3461 :     >45358028 hypothetical protein MMP0465 [Methanococcus maripaludis S2]
3462 :     MILKLLAKKYVREILEMIEENEELYFSEIMNNLDTHQGSVGRLLSEMVEYDLLSKREDEE
3463 :     GKKLNKTYYSITEHGKLALKIYEYSDKLENIRESKFKMEIKGGKNTNIQTEHLDLKIEYK
3464 :     >45358029 hypothetical protein MMP0466 [Methanococcus maripaludis S2]
3465 :     MRKVGKIDKGEIIQKSEDRLLVCYNAVVKPQGRGGRIWPNPLPEHVGKVAKVFIFDKDAL
3466 :     EDPERLVIQIQNQLKAVNYGIKI
3467 :     >45358030 hypothetical protein MMP0467 [Methanococcus maripaludis S2]
3468 :     MGRKQELSNHHGVHMNLEQQDMEKLQEIQKAWKKPNGRPLEAVNCFRRMIRNTHKNIDLL
3469 :     GQIEHLKESIQLLKNQYREELNTKDHLIEELREKLFEKELRENPVRDPIEDDFKMILGWR
3470 :     DPKDWIKAPSGVKTHIRPIIVKRSSEISEILNTVLKNTETNSKEKIEEKIKT
3471 :     >45358031 hypothetical protein MMP0468 [Methanococcus maripaludis S2]
3472 :     MVLIEVRKQAWKKSRSALPTFIGKVTEHGNSANVDPTLPREYLGKTVLITVIEDDEVLSE
3473 :     ILLRSNDEGENERV
3474 :     >45358032 hypothetical protein MMP0469 [Methanococcus maripaludis S2]
3475 :     MKSVNYRDMDVNEKIIFDLIRLGIRAVGEVSSDMLLGKGENRVYIDAKVMERLCNDGLDV
3476 :     IYREIIPIKAIRESNFNPKSMNLEVKQYLTGKVIPEDQVHEALKNGLEVRYSQDIGEFYS
3477 :     INCSEGL
3478 :     >45358033 MCE family-like protein [Methanococcus maripaludis S2]
3479 :     MDDKKIADLRPKITDYLKENYSEDMLKESERVAVDLNGMYHYGMFEFIEFIESDPKEAIN
3480 :     LLKECYYDAYHVYKGERADCTVTIKNLPLMINKNSRGNERTIEDIKGKTHGKLVEIEGII
3481 :     VMATKIKLALKEAVHICTACGEKRRTKIERPFQANFDPVCPKCAQNMTLLEDESEYVDFQ
3482 :     ELKIQQPLDLMEDPEEPPKFISVLLEDTQGIYCGRVKVTGIPIKNQKNKNIPLHDLLILG
3483 :     YNCEPISEKLDVSFNDEEIEQFETLAKNKDVLKILSRRIAPQIKGNDIIKQSIVLQQVRG
3484 :     VKKGRKRADSHILLITDPGTGKSDVLRFISGIPGNVYSSISTASGVGLTAGVVQERTEIG
3485 :     DSTWVIKPGVLVKANGGTACLDELTVERSVLSYILEAMESQTIHISKGGLNTKLPAGCSI
3486 :     LAACNPKYGRYNEHVAVIEQINIPAPLLSRFDLIFPIKDTPNRNRDSDIAYHILDTHIAL
3487 :     MDKSKNEEIGLFSETIGELKVDFDFFCKYIAYARQKTPKFTKESKEVIHDFYLNLRKTSV
3488 :     QITARQLEALVRLSEAHAKVRLKSEVEPEDAKFAIYLMIESLKEVAYDHETDSFDIDKIF
3489 :     GTSRNERSKLNIIFDIIRRSSKVAYGGTVSRGDLLTEAQLEGIPELEVIDLIGKLKVIGD
3490 :     IYEPKIGFYKDARA
3491 :     >45358034 hypothetical protein MMP0471 [Methanococcus maripaludis S2]
3492 :     MNEKLHLNLIEEIDAIAVRYFLHQIQNLESVDVEKLGKASKLPKKCSRTLKLSEEEQKII
3493 :     KKAGKLTGHLVNYVILTERENQGVDYGCSQ
3494 :     >45358035 integrase/recombinase [Methanococcus maripaludis S2]
3495 :     MDVVSKFLVGAGKRDAVTKTPAMNKWISVFREEREFDGIKENTIIGDLTKLGVFLEFAQQ
3496 :     RLEKEPDELYKTDFIKFFNYLEKERKISKNTQNRYFNLLKVFYRAFKLDNFMDFRDESNE
3497 :     RKRFSSSRIEVKHYDAITEQDLNLVIAKIFENQSSTKIRDLVVIRMLWDTGARVSEVLNL
3498 :     KYEDCDFENGEFRLRNTKSHEERKVVCSSDTLELLKCLASYNFKKEPKDYLFQSTNQENL
3499 :     GKIADRNQITRTFGRAVDKLKEEEKIQQNKRYVVHSLRHGRAVDLLNKGVPIDVVKEILG
3500 :     HRSLETTLYYSHSRQRKEQMLQDIKKLL
3501 :     >45358036 hypothetical protein MMP0473 [Methanococcus maripaludis S2]
3502 :     MDKKENNYLLTVLWSYKYPTFVFLIVIAFAAVIFKFGLYTPYKDIFSIIEHVGTFAAAIF
3503 :     ALVVISKMTDQLDEMRKQRKELELQREEITKPELIVTLVPDEKHFGILHIYLENIGQGIA
3504 :     KNVEVRFAKDGNCGIKDDITHQNIAEYPIFNRTINFLAPNQKKLLFTINAYENKDIWEKV
3505 :     FKFNLNCEGYPKDFELDMCELKAYTGTSNQNSVENQLSNIKLKLSDLNDNLSDISANVGC
3506 :     LNQDFKMDDQSIELFENAGSVLANINKICKKKSEDVLKAEDITKLMPNDNEKLNNTLLFL
3507 :     EKLGYLKLVYDVSNEKLPVFILILKRKYGKTD
3508 :     >45358037 hypothetical protein MMP0474 [Methanococcus maripaludis S2]
3509 :     MSELTKDQVELLKNEISKTESDIRHYKENIEMYIKYNFFTYGALLSIVLVKFDLVFNMLY
3510 :     QNSSALTASENGLIGINALLITIIIFFAVSLSSFCMWLVISNMVQLNKLLVKQNHIKSKI
3511 :     KEYDLITSIEQDSENLDNNGIFEAIFTLAFDKKIHGEVFPLVGIFLIAFSVTNMSLLKFS
3512 :     NFFHNMSLVAMGHNSYSMGDIPILAVNALIILVQIYFLTVSVLNVGYFTRWMSGEDYINE
3513 :     ISRKKSKTDIVVGLIIVGVFLINFYIIQ
3514 :     >45358038 hypothetical protein MMP0475 [Methanococcus maripaludis S2]
3515 :     MGFNEYLKELNENIKELPNSYRYTYLIFGLFSIIFSIIAYSMFMTSADNMRYFFSTLAQS
3516 :     QAALGGIIISLTLVAIQMASQSYSLKVMDLFLKNKSFWVLFSSYAISIIYNTIILITIPK
3517 :     TDITTNLALFSILGVGLAVFTTLYTFSYLRETMTILKPEKIYEKMIESISSEEIKHNTDS
3518 :     DENIYECFKDIKMDTLKALTTLVNKLIELKEYDAAKNCIELTSGKSFEKLYDKYFKENSN
3519 :     FFKKYVSNLENMSYLYSQDPSIPFSVITSISKITIYDISKNMILYKPNPHTASSIPFNPI
3520 :     ENLQSIAFNYSTIDDTEKSQIIFYILKKIENIQSVLFEKLQNCTDPKKSKLYLEYILVGI
3521 :     RCFRRIYFKTGVMKNIPLFGNYLESGHWTIEELEMASEVRKYIKSKKCNPDYLKIIIQEL
3522 :     MDFVWVEFKNLDLRWPGTEVYILFFLNSIVSIINDLDEKEYYEQLFLILEKISNVYVEKD
3523 :     STYQTLKSYLNDLLNIENQIPDGRKEILEKFKNTEKIRAFMNLVMISPTTNTPTIRQELI
3524 :     KNSILFNNSSNVENIIIYSKTLAEHPLKMLNDCLNEIENLPENYFVNNKVFEKYSENLEK
3525 :     IKEIILEEIEKKK
3526 :     >45358039 hypothetical protein MMP0476 [Methanococcus maripaludis S2]
3527 :     MSDMKLAIRDKRVQKKLQKIFKKDKVHGDAIDSALDKILEYPNRGIPMTGELAGFRHLHV
3528 :     YDSFVILYFVDEVNNVIYIDNYGHHDEMYSWNDKMKKSKK
3529 :     >45358040 hypothetical protein MMP0477 [Methanococcus maripaludis S2]
3530 :     MVQVQVDLSDDSNRIIEIFKAQHSIPKKSIAIDMFISQFASYGKEALEYNPAFVKETLEH
3531 :     SKGTEFIDITDKKSRRKHLGLE
3532 :     >45358041 hypothetical protein MMP0478 [Methanococcus maripaludis S2]
3533 :     MRDRFSFSYDPFLDLLYLRFFSTSIYEQTLDLSGVLIDISKNQDLRGIEILDASKVFDVE
3534 :     KSDLKEIKSLNVLFKITEENIDLNLTLNVSKNDKICPLSLKLSEINDYDLFKKTVEFSAS
3535 :     YRFSE
3536 :     >45358042 hypothetical protein MMP0479 [Methanococcus maripaludis S2]
3537 :     MQEIEEKLINSLEKQKTLIEKYEMVLTARIASGIEAMAELRQVKTIFCSDNIEKKPDELE
3538 :     STEDDDILINRFQRISIGDLTGSAKEVLNSEKIYLNQSLTGRLIKESDVIKELKSGNDVH
3539 :     YSKKYNVFYRIIVEEV
3540 :     >45358043 hypothetical protein MMP0480 [Methanococcus maripaludis S2]
3541 :     MVLKIISKRNVDKVLLLLNNTGEMYFNEIQKELNLNAGTLTRIVSDLMEYKFIYKRVEDE
3542 :     SKHLSKTYYGITDLGKKAIEIYKIKHEIEEELN
3543 :     >45358044 hypothetical protein MMP0481 [Methanococcus maripaludis S2]
3544 :     MLNADFYKVIDTELEKIIADPKNAEHFEKLKQPNQKKSHAFLIWFLNFYGEYYSVKNLIT
3545 :     DGPNDNSCDIIFPRKNSFGEDVYYVVQSKWNTIGKIHEKNDSSDVKKALADFSTILEDGI
3546 :     TKFPNNKFKDQYRKLMKHIRNNKEVRFIFLSLSEYNDDVNDVVSGFKTGNGTDILFLDIN
3547 :     NIKKDYIEREYKDNSLNNPLEYYYDPYESEITLNIERFGNHDCIDLNDLDLHSYVFIITP
3548 :     KTIHELFKKYRTGLFNKNVRNPLKNSEHNQKIEETLKTCPNRFWYYNNGITAITKNAGKL
3549 :     NNKISQLITLNGLQVINGAQTVYSIYDAYDKANKSRREVLDKNVKILFRLIESSDEPLNL
3550 :     EITRYTNSQNKILSSDFMANDEIQIRLQNESFNGTFWYERKRGEFVNNPEGVRIIDSRLI
3551 :     ARDYITFHLQKLQDALYNYNNVFKSHKEDKNGIYEKIFNENTTFKDILISYLVSVLVRGS
3552 :     LFRTYLKNTMNKTDQELLNLKDSDLNMTDRDIQELNHMLIPIIGLINPILIDYLSKKGKI
3553 :     TNKNVSNYLLDLYEKDKHKFTDLILLSVVISLDRIYGDRETGKIHVNMDKIMNKECLYYF
3554 :     TEKENIEKIGLTEKEISILDNPKKTEPNLDNILNKNESNDQDSGVPKSEL
3555 :     >45358045 hypothetical protein MMP0482 [Methanococcus maripaludis S2]
3556 :     MSRDRISGTFEYDGLLDVLYVRCRPELEYDQTLDIGNVLVDLNNTPAIKRIEILDASKLF
3557 :     GASVFELKNILKMDIDLVVSKDRIDVALKLEVLKRSRPVPMSYESYILNDYGLSENTINV
3558 :     SAVPASA
3559 :     >45358046 hypothetical protein MMP0483 [Methanococcus maripaludis S2]
3560 :     MNIPEFLKILNETQKEEIEKTIHIEEQLKDRNIEYTHVLELLEKDSVGILKQNDNTFKLY
3561 :     YEDTDSKDMVIIISYRSEKLHLVTLFPHDIKRRVRHV
3562 :     >45358047 sodium/hydrogen exchanger [Methanococcus maripaludis S2]
3563 :     MVPDVFIEVSLVIFIAFFISLVMRMLKQPLIIGYILTGILVSPYFLNIVRFEESISTLGH
3564 :     YGVTILLFMVGISLNPGYFKEIGKISLITGLGQILFTFSIGFLISVFLGYSLIESMYISI
3565 :     ALTFSSTIIIMKLISDKGDIDKLYGKISIGFLIVQDIVAMAILVLISAFNVQSGAGELLF
3566 :     LIISKIVLILTAIYIFTKYALSNFISYASKNQEFLFLFSLMWCFTLASLFHLLGFSSEIG
3567 :     ALIAGIVLAIFPERYEIASKVRPLRDFFLILFFVVLGVQMTFETSGNFIIPAIILSIFVL
3568 :     FGNPIIVMILMGAFGYTKKTGFLAGLTVAQISEFSLIIASLGLRNGHISQEIVSMITLIG
3569 :     IMTIAGSSYFITYSERIYALLSNYLSIFEKKTKISEKDFKNKNTGEIILFGADRTGKNIL
3570 :     NVIENSKERFLIIDYNPKIIKNLSKRGYNSVYGDASNLELLNELNFKESKMLISTISDIE
3571 :     TDILLIKTILKSNKNAIIIVIAHKIEDAIKLYEEGASYVIMPHFLGSIHASLMIQKYGLN
3572 :     IEEFLKEKSNHIESLKKSQELFRHTK
3573 :     >45358048 hypothetical protein MMP0485 [Methanococcus maripaludis S2]
3574 :     MISSYKYNPKLYFLSTFVVTYILWFTGAYLSFSSTYSGIYMLIMLPGLMAPFIISTILIA
3575 :     KSKNNELKKDFINRLFNLKLINLKTIPVVFLLMPAVILLSILLSIPFGGSISQFQFSGGF
3576 :     SFSTDFVPVLFLLLLAATFEELGWRGYAFDSLQSRYSLFKASILFGIFWSLWHFPLIFVN
3577 :     NSYQYEIFNQSIWYGLNFFLSILPMGIIITWMCLKNRKSIILAIIFHFLINLNQELLAIT
3578 :     QDTKIIETGVLFLVAAAIILYDKKMFFEKLG
3579 :     >45358049 hypothetical protein MMP0486 [Methanococcus maripaludis S2]
3580 :     MKYNTKEEFEKVNMFGEGVPNEMFAQYFIGNSYLNPLVKPGEAPLFLANVTFEPGCRNNW
3581 :     HIHHATKGGGQMLICTAGEGWYQEDGKEPVSLKEGSFVYIPANVKHWHGAKADSWFSHIS
3582 :     VEVPGEGGSNEWLEPVSAEEYNKLK
3583 :     >45358050 hypothetical protein MMP0487 [Methanococcus maripaludis S2]
3584 :     MKISFKKIGTKLLIFMILCAIIPLMVVGGVSTNKITEEMQIQGDNSVNDNLNIFQESIEN
3585 :     VIVEFETTTSYTASLDTFSELLVNDDKEVLYDFAEKMKKSSEVDLVAFTDKNGNIISSSD
3586 :     NVQTNLKPVISKLLSNEVQSSFEIISGSEASKYSDYKVNNINDALAICVVAPVYHSGELV
3587 :     GTVTLVDIVNNDDYWVDSLKERTGNEATIFLKNVRISTTVQTNGQDATGTKCSDEVYNII
3588 :     TNHQDYVGTANVLGSEYITKYSPIEDKDGNVVGIIFTGIPKAPFVAVITDTRNEIIIISL
3589 :     LGLLLSILIALYTGRKITKPIEELKKGTEEFGNGNYDYKTTVKTGDELQELSDSFNKMAE
3590 :     NVKNLMKTMDMDKVELATLLTNVSDVMNRVAKGDFTARADESRENNNLEKAINTAVSNVA
3591 :     DLIKELREEVELLNIQIQKVEDELKGAEETATQVAEAATQVAEAASDQSAKLQESSEELE
3592 :     NTYEGAKEVYSAAEETVKSSEEIKENSETGVEKVENAISRMQSITNVIDELGKSIKMLGE
3593 :     DGKKINEVTGLIKDIAEQTGLLALNASIEAARAGDAGKGFAVVASEIKSLAEEIKKSVED
3594 :     INHTIEGVNKRIDDTIDLGLKGKDEVDKGVIAIDEVNDALLKIKESVNESAVKINGIKHG
3595 :     AQNASENTEGALKNAQEIAALSEEFTATAEEVTASTEELNSIIEEIRGIAEEVTQVAERV
3596 :     TKKSSQFKI
3597 :     >45358051 low molecular weight phosphotyrosine protein phosphatase [Methanococcus maripaludis S2]
3598 :     MDKSSKISNEKIAFVCIHNKRRSVMAESFARSFGLNAYSAGVEKTEEIDEKIVEVMTELG
3599 :     LKVKERPETILELTKKIGNIDILVTMGCIGSCPIVPAKKYIAWNIKDPAGKKIEVYRKIR
3600 :     DEIKIKVEELLKSEIY
3601 :     >45358052 hypothetical protein MMP0489 [Methanococcus maripaludis S2]
3602 :     MVETPKCTCGNHGVMNKKEKIIFACSGASNVGELSNAAAVRLTKEGFGNKACTASLAIKT
3603 :     PSVMERVENAGEIVVIDGCPVSCAKRIADNSGVKVDQYIIITELGINKISDMDILDEDIT
3604 :     KTVSAVKDGKSVCLDRKRENHKGSGCNCGCESK
3605 :     >45358053 hypothetical protein MMP0490 [Methanococcus maripaludis S2]
3606 :     MLRRKNKKRFSKNEEDPMAGSANLVDAMLVLSVGFLVFLVMSWNMQSVVFSDSTQEEKME
3607 :     IMQAMKQVAEIKMAKEITDMPEITDGSGSGFMEMGTVYQDPNTGRYIMIETD
3608 :     >45358054 MotA/TolQ/ExbB proton channel [Methanococcus maripaludis S2]
3609 :     MVAIPGSELLSTTLHIISQSLLLPVVAFLLLFMAYAVINFGEFMAEYSGRVRVNSKDLKN
3610 :     IINTLPDKNAQEISSLISKMRLNRAHIEIIKELCEEECKDLKMVESHARNLIEREELRLE
3611 :     KTLEKTDFVTRLGPTLGLMGTLIPMGPGLAALGAGDIHSLANAIIIAFDTTVVGLAAGGI
3612 :     CYVISKVRRRWYEEQMSTLDVLMESVLEALKKC
3613 :     >45358055 hypothetical protein MMP0492 [Methanococcus maripaludis S2]
3614 :     MMDELWQLGLMSAIIIFGIKIGLSLGFSGLSKKVSGTIVLLYGLGTLLLSKLASGYVDII
3615 :     QKVIYEYNFVIFIVMSLMILYAGFHTIKEWKVNQKNSVASCSLAMIAPCPCCFGAVIASI
3616 :     VLISPTLGISTFEIGKYASLILMITIGAVYLLSDAISRVLRAPRPVLMGNFMIFAGFYFL
3617 :     ISALVIPNIVAGMSIQMSPMQYPEFSSLTHVFALTFGLLILGYVKNRKRMNFTDKMRSI
3618 :     >161621700 cobaltochelatase [Methanococcus maripaludis S2]
3619 :     MGGMWLTNVQEIEIENGIPVGNLSMAMRSNSSNDAEAILRMLNRTCISGATVSKTGDPKV
3620 :     GTKLVLTKKMVSYIPGEVSKLNVAIVTGYSNYEKQLSTSTDRINTDSDLNIVASYYTTSN
3621 :     LSADIDLSQMDIIYIVMVTQSAEPIENTIQDAIDNGAVVIGSNTYLPESNYSIPEEHADI
3622 :     ESFKKYLSEYWSGGASDDENFDNLIFYLAREYYNRTDLTVKEPTGLQRAIYHPNMTSTPI
3623 :     EFFTGDAGEYFAWYSNRTDGHSFDENAPTVGIAFYTSYYPNEMDPIDKLIAGFESKGVNV
3624 :     IACYGDADNQLDGFFNYNNNTKVDAVISFLYRGTYFNMEELGVPVIDGVLNGYMNTSEWI
3625 :     ETSNPLPVTNMLRIYRPESEGLIDPIMIGAEETVLEDNDTISKYMGHDTQIEWLINRTIA
3626 :     QCNLGIDPENEKKVAIIYYNHEGGKNNIGASYLEVAPSIVNLLNAMDSDGYNINESIIPN
3627 :     KTELVDLILLQGRNIGSWAPGELESLVETGEVELIPEETYISWFNELPEERRNEVVETWG
3628 :     EAPGELMVYEYSNGSKYIVIPKISMSDNVIVAPQPSRGWMDSYDTLYHDTELPPNHQYIA
3629 :     FYLWLQKEFDADVMVNMGRHGTVEWLPGKEFCLLSDEWPALMVGDIPVVYPYVMDGTGEG
3630 :     MQAKRRGSAIIIDHLIPPVVSAGLYGNYSLLNSEIASYQTSVTESESLKQAQFEEIVNLT
3631 :     FELGLENRVNMSLSENNGTIDEFLDELDDVLRDLRTLSMPYGLHVLGEAPDDDELVGMVN
3632 :     SMLGSSYSEKVAAYNSSDSAANDLLTKVLLENITIDDAQMQVLGTTSEDIETDLQLAITY
3633 :     SELLLEADDEIEQVLKAMNGEYIEPGLGGDPILRPETLPSGSNFYAFDEQLVPTKQAWEE
3634 :     GKALVDEWLSQYYDENGEYPTKVAYILWAGESTRHQGIMEAQILYMLGVKPVWNENNGKV
3635 :     TDVEIINSSELNRPRIDVVVQISGLYRDSFPMKVQLIDKAVRLAYEEDEPDNYVRINTDE
3636 :     LKDVLNEHLQNESLSLDIAQFRLFGPADGNYGTGMANAVSSSETWNDTDALAELYISRMS
3637 :     YIYGQNIWGQTISEYIELQTGQNVEINNTIIFENNINDVSDIFHSRSSNTYGSLDTNDFF
3638 :     QYVGGLINAITYESGESPDAHVVNLQNADDQKIESLQTYLENELYSRYYNPTWITGMQES
3639 :     GFEGATEMEKFVENLWGWEALTSDIISDGMWNKVYDTYVTDSELSAWLNENNPYAYQSMT
3640 :     ARMLETARKGCWDASGETLKNLANEFIQSVAEYGVTCCHHTCGNLELNDWALEHSSLDEK
3641 :     TLKEYEKLYEEATQEDIEVPSQENKDTYTDSSSEPDSYSRVYSEEESKQEVLSNETVKTN
3642 :     TTTKEDSAASAGSDGADSNSGSSSTDSSDAPNSQKAYEIEVNEPENSGSSGTTMFAILGA
3643 :     VGMTGLIGFGYFRQNPNFLKFLRRK
3644 :     >45358057 helicase family protein [Methanococcus maripaludis S2]
3645 :     MVNLNNSKITNFLSKLSTDSVHKSNIELIKEIPPKNAEYNENNLDLPDNFEEYLLKKNKK
3646 :     LYTHQYSALENVRIGKNILLTTSTASGKTLSFNLPILETLQNDKDATALYIYPTKALTND
3647 :     QLNNLKNLENELNITLKPEIYDGDTPNSKRKSIREKSRIILTNPHELHQVLQYNPKWMSF
3648 :     FKNLKYIVIDEAHTYRGIFGSNISFLIRRLRRICEDYGSYPQFILASATLANAKEFSEKL
3649 :     VGLDFRVIDKDGSPKNKKYFVFYNTLKNEISESSWYSSAINILELCMKYGLQTIGFTLSR
3650 :     KMAELITIWTKKSLGNNILSRKISSYRSGFTPEERRDIESRLKNGDLRAVTSTNALEVGI
3651 :     DIGSLDSVIMYGYPGTLMSLWQQAGRAGRAGYDSVVTLLSRESPLDQYIIKHPETVFGKT
3652 :     TENAVIDLENPQIIVGQLLCATAELPITLNDKPYFGENIEEYLNQLCDCGLLEKTDRGWV
3653 :     YVNTVRAVELVSLDSIFSSEFKVVDEKGNLIEILDEMHAYPEAHVGAVLLHNSENYIIKE
3654 :     MDLESKVCTAVKKDVEYYTKARGSTNVEIINELDRKDFGSVSIHFGEVIVSKTYIMYDVM
3655 :     KFGKRMSQELLNLPPITFQTTALWYTFEDEFFNDFENLKEKDFGDGLHGTEHAMINIFPI
3656 :     HIMCDSHDIGGLSTNMHYGTRKPSIFIYDGFEGGIGLSKKAYEMPEKIAKTALNLIKDCT
3657 :     CEEGCPACLYSPNCGNDNQNLDKQYTLAILEKIVGIFEK
3658 :     >45358058 hypothetical protein MMP0495 [Methanococcus maripaludis S2]
3659 :     MKINLNLKDKISGIAQAFKKKSEDTTASKPVVDSVESTYGSNQVFRSPFFDEERQRALEL
3660 :     QSKLLKKYSGVHLDDYFKGRVIKSEYGSSYCIEDEFKCKIKRNDIEKVKNCILSDLQLIR
3661 :     GIGEKTELSLKNSGYNTICDLTKHNRYGSCAKEILTSLENNGVSGLLDSIPNNYPKSHPT
3662 :     IMEASKMHKLEDFVFYDIETMGLFGSPIILFGMSFVADNKINTKQFLLRNINEEPSSLYH
3663 :     TISELKTRKALVTFNGKSFDMPFTQDRLGYYRMNNSGIPQIHYDLLHFSRRAWGNNLENC
3664 :     KLQTIEKELLGESRKDDVPSSMVPEFYRNYLRSGNIGPLVPIVEHNKIDVVTSAKILNLL
3665 :     WEEW
3666 :     >45358059 glutamate synthase subunit-related [Methanococcus maripaludis S2]
3667 :     MAKYRCNVCNVFEYDESRGDSVTNIKPGTKIKDFPNNWKCPICGSDSTHLIQIAETNISK
3668 :     KLKGTFECPECKSKSEIEISMPIKMDSSYLGEWKREYDDMEEHMFDIHKISVTGESIIEP
3669 :     MRTKKPVISWESIFIKGAQLAKFPLNNDEEVITKTIIGPKAKHPLIIETPIFITHMSYGA
3670 :     LSKNVKIALSKGSAAVKTAMCSGEGGMLEESFENAYKYILEYVPNQYSITDENLKKVDAV
3671 :     EIKIGQSSKPGMGGHLPAEKVSEEIAKLRGFKVGQDIVSPSKFHDINNKDDLKNKVSNLR
3672 :     EKSGGKPIGIKIAAGDIEADLEVATYAKPDFITIDGRPGATAASPKFIKDSTSVPTIFAL
3673 :     YRAREFFNKNGITDISLVITGGLRISSDFAKAIAIGADAIAIGTAALMATACQQYRICDT
3674 :     GECPVGVTTQKPELKDRLKIELSAKKLSNYLRVSTEELKTFARLTGNKNIHDLSVDDLCT
3675 :     SDSEISNFTSIKHV
3676 :     >45358060 hypothetical protein MMP0497 [Methanococcus maripaludis S2]
3677 :     MFKNEDYVLENKGIYYTYKNGKQRKYKSWLSGAFSFLYDPLMSKSVFPKTLGASMEKHEL
3678 :     FLKNELNFIHNKEILELGTGSGNLSQILPNDNKYSGIDISKGLLKIARKKFYKAGFNKNF
3679 :     KLFLCSAEELPFKDNFYDVCIFNLSLNFFNDLDSVISELKRVLKPDAKFICSVPIKDRNT
3680 :     DKKTIRGNIYSENELKDIFESKGFSFRPYPFKNGSLLYFSAILEN
3681 :     >45358061 hypothetical protein MMP0498 [Methanococcus maripaludis S2]
3682 :     MAFGVALSVKANLGISPISCVPYVYSLKIPLTLGQLTIFFNLVLVLLQIVVLRRNYRLVY
3683 :     LAQLPAVFLLGLFIDMAMNILSNLYISSYVGQMALCIFSCIAIAFGVFLEVKAKIIYLPG
3684 :     EGLAMAISNTFKKEFGKTKIGVDVSMVAVGILSSFIFLHQVQGIREGTIFAAVLVGSIVK
3685 :     VFNKTLL
3686 :     >45358062 hypothetical protein MMP0499 [Methanococcus maripaludis S2]
3687 :     MENVSVNSDDMKEIKEELSKLNIRLNQFIEKSNQQHVELVIDEIKKKYSDVFYNDILNES
3688 :     KFCLENNMISDCELKSSCYETLLGILNNSAKNLKENKISQDKIITIRKNLENLKEKLPYE
3689 :     KCSVCYSETVKLFEKQIDLMKNLGIYSENYEKNELNVSEKEIITSLLEPISNKHRLLILK
3690 :     SLMAETKTFSDISKITGLKAGNLLFHLKKLQDSEMIMQRSDRGDYMITKRGIDILNGILG
3691 :     IYGKVF
3692 :     >45358063 Iron-sulfur flavoprotein-related [Methanococcus maripaludis S2]
3693 :     MKVIAINGSPKKQGNTALLINKILDGAKSNGAEVIKYDIDKMNINGCKGCMHCRSEFKCA
3694 :     QKDDMAEILENLKEADVLVIGSPIYMWQITGQAKIFLDRLYPVVNADFSPRLSNIKTATV
3695 :     YVQANPDESAFAPYIENTNSMLNFLGLNVAESIVKGGVGAPGDVLNHEDTLEQAFNIGKK
3696 :     LTE
3697 :     >45358064 hypothetical protein MMP0501 [Methanococcus maripaludis S2]
3698 :     MKKSALVIALIMVLAPLAFVPSAAAATEDEIEASIDAGVEWLASQQNETGYWGDCGDDLP
3699 :     AITGFALVKLVDRARELGVDPFDPEEYEYARNVTAGYNWLESQKNVQFGINDSQTNNNGQ
3700 :     AIFFSSTSGHQTYNTAIALMAFANLNGYDEYNETLVQDMVDWFVDTQNDDGAWRYGASGI
3701 :     SDNSNTGYAVIGLAYAENAGADIPDSLKTGLSGWIDVIQDPVNGGSWYTTETAWVNSLKT
3702 :     GNLILEMGFVGDDTTSGRLNDAVDYLVAHWNDVGSGTLMTGWKPHNYQAMYCIMKGLEYM
3703 :     QIEEIDGIDWYGDFSDYIVANQNETGFWSGDPWAIYGNQNQILSTEWALLTLEKATVIKE
3704 :     IPVGFDVKPGSCPNPINIKSKGVQPMAIAGSEEFDVYDIDPATLKIGICVNGEFTEFEGV
3705 :     APLRWVYDDVTENYIPEEGEPCCIRTKPDGITDLSMKYDTQELVEAGLGDYEKNDELCLC
3706 :     IKGTTYDGEQFVGRDCIIIK
3707 :     >45358065 hypothetical protein MMP0502 [Methanococcus maripaludis S2]
3708 :     MKKFLVGFILFSMVVSVIPGAVVDDDTKCIWCTEWEPYGLYAGQNELVGNVSVRVCGDNL
3709 :     EYKYEITEPGWCISEIHLMALNESPNDTSSSWYTKYVTKKGNPKVGQFEINEEGLCVKEY
3710 :     SGTLNLGEFNPCTDKLYIAAHAVVCECECECIFTGCGYKAIDEAEGWVIDTSNYIEGSKG
3711 :     DNDPKRYNESHCLGPYDSQDKDYYTFTSLGQGGSIELYFENNICGDGDPCTPDLEIYETT
3712 :     WGHTSTWTESICVEAYYNGSYNELGCVTNTAGSKDIRNIFVNYIYNLPDCVCIEKIRIND
3713 :     TSYVNANYDYDIDAVKANYWCVPEYEYICNCTGECETAWGNGTSFPGNNWAMYFEYSNCM
3714 :     CD
3715 :     >45358066 hypothetical protein MMP0503 [Methanococcus maripaludis S2]
3716 :     MVIDNEKHQKIRENIKKLVTNVLNSDEEFKTLLGHAYANLTSKNHKCTNKVLNRLKERYG
3717 :     VDLTGDVDNLRTNYVNKKSEVKTNDDLKNYTNNNAETKIDS
3718 :     >45358067 molybdenum ABC transporter ATP-binding protein [Methanococcus maripaludis S2]
3719 :     MLVIENLRKNLSNFELYIEKLEVKNSDYFVFLGLSGSGKTTILEMIAGFIKPDSGKIMLN
3720 :     GVDITNKPINERKIVLCNGKYLFPHLTIQKNIEYGIKHLKKPEKKEKVDNISKLLNITHL
3721 :     LNRKPERLSSGEQQRVALAMALVMEPEIILLDEPLSSLDRLLHEKLMYDLKEVHKSSNVT
3722 :     FIHVTHDFSEAAVLSNKMAILRNGKIEHIGTLQNVLKHPQNEFVAKFVGIKNILYGNCIE
3723 :     KDGNYIIQLLGFEIPVKEANYGEITLGIFPKDIIVSKKSEKDSKIYAGKIKSIVPSGPFD
3724 :     SKAVIEFNNIELISEISNSDLLKNPLKKGDSVEFYIDSISMIG
3725 :     >45358068 hypothetical protein MMP0505 [Methanococcus maripaludis S2]
3726 :     MIDFKSELEKIATENNLLDETIEIKPVNVNLESKTIDDYPLMQGKEFLLRAFFKGDVGDA
3727 :     FTNNLVEFNGKLSEVIASGSNQMMIAALNSVMKHLKMVEKSEHCIKGEPEVCAKELSEFL
3728 :     MEEYGKEIKIGVIGYHPAIIRQMVTTFGKDNVIATDMDLDTIGRLRQGIVIMHGSMNEHL
3729 :     IENSDIVLSTGSTAANGSLEEILSYTKKYDKRIIFYGTTVACAAKMLNLERFCALGK
3730 :     >45358069 NifC-like ABC-type porter [Methanococcus maripaludis S2]
3731 :     MKNNDFLKFFSLFALSVFILFILMIVMSIVTNISFETFYDSLFSKEIQFAIKLSLETASI
3732 :     ATILGTLLGVPAAYALARYNFKGKDIVDSIVELPVILPPLITGFALLVFFGNTVFGKFIT
3733 :     ENIIEILFTYKGTIVAQFFVATPFIIRTSKSVFECIDEKYELIAQSLGSKKYESFLDVVI
3734 :     PMAKNGIIAGAILAWARSIGEFGATMMLAGATKMKTETLPIAVFLNISLGDLEKALAVSL
3735 :     IFLLVATLVLVIIRSVLKIGENNDRL
3736 :     >45358070 molybdenum ABC transporter periplasmic molybdate-binding protein [Methanococcus maripaludis S2]
3737 :     MKKLLLGIISILSLTLLFSGCVDNTGAEQQEVLHAYVGAGMQMPMDEIAVEFEKKYGIKV
3738 :     EYDYSGSGALLSKIVASNQGDIFMPGDCSYVYQLEDKEMIKECSNVTKHIPVIAVQKGNP
3739 :     KNITGLSDLGQNGLELALGDDSISLGKLFKKILAKAETKGLNITKAVDTNTVVTGATVKQ
3740 :     VLLYVTEKNVDAAVVWKADAYENPDRVDIVPIESEYNIVKTVPISILSTTENYENSKLFY
3741 :     DFVNNEGKEIFEKHGFVALE
3742 :     >45358071 molybdenum containing formylmethanofuran dehydrogenase, subunit E [Methanococcus maripaludis S2]
3743 :     MHKAQEILDLVEDPNLLSQFERVVEFHGFPTAGAFIGIQMYNFSKELLNFSNDDRIYVVS
3744 :     ETYNCLPDAFQILGNATTGNKGLRIEDHGKMAARINPWAPAGDNIKGVRIILDPKKTVNY
3745 :     PLLHAWYMNTAKVSHKDAVSELLKAGNDVYSYEFIGVVAPSKPKKKVELCEVCKEPFIQQ
3746 :     NGEKKCLACSK
3747 :     >45358072 formylmethanofuran dehydrogenase, subunit A [Methanococcus maripaludis S2]
3748 :     MTKMVIKGGTVYDPLNGIDGEVMDIFIKDGKIVENLSDGELKDAKILDVKGKVVMPGGVD
3749 :     SHTHVAGPKVNTGRVMCPEDHYKSPLKKTHNTHCGSGEIVPSTYAQGYKYSSMGYTTLFE
3750 :     AAVPPMLARHTHEEFKVMPIVDKAGYLLLGSNWFVMKYLKEGNVEKAAAYVAWALETTKT
3751 :     FGIKLVNPAGVESWAWGKNVHSLEEENIHFGISSGEVIRGLGAVNEMLGLPMSIHLHANN
3752 :     LGHPGNWEFTIDTMDVAKNIKPAVNKQGYDNGVKTKYSHEREQSLYMTHMQFHSFGGTSW
3753 :     KDFESKAEDISNYVNKSDHVVMDSGSVAFGKAICMTGDGPGLYDLAVMNGQKWANVDVEL
3754 :     ECGSGVVPFVYSMKNKVHSVQWAMGIELLLLTDPRKVIMTTDNPNAGPFTKYPQLITWLM
3755 :     SKKAREDTMKLCHKWAGERSGLAGNDKELSLYDLATVTRATPAKAIGMGHRKGHLSPGAD
3756 :     ADITVYDISPDYNSSDYAAIEKAFTTALFTIKDGEVITKDGRIIETPKGRTYYVDAKFNE
3757 :     EIQKEIIADVQDWFRRYYSIGFSNYPVPDLYLTKPTPLNINVR
3758 :     >45358073 molybdenum containing formylmethanofuran dehydrogenase subunit C [Methanococcus maripaludis S2]
3759 :     MGEIILKPKYNGTIPVECDVITPDTFEGKSKEEISALKTFIGPEEHLLSDIFEISGDFTS
3760 :     QKEDMVIKIAGDAGNVKLIGFQMTAGKIIVEGDAGFHVGCEMKGGEILVKGDVKPWAGRE
3761 :     MEGGTLHIFGNAGDHLGGCYRGRWEGMLGGTIIVEGDAGNNVGDGMVDGKIVVNGNVRAF
3762 :     CGIRLNGGVLYVGGNAIRAVGVEMKKGTIIVAGKIKNFAPGFISTGVVSDYETGLSGLAL
3763 :     PGKLIGFNGDQAFFNKPKGKLYVSLSENYDLLNDELPAKERPIEFKGNALKVILNTGSTI
3764 :     EQGRIIKGGNKYSHEYLDVCAVCNMHPEDYILLGKPEKVKVSSENGKYSVLVRAEPNEDV
3765 :     LRRNVFIPRSVWANVIVDAYSVSTGSPIYKGGTVYVEPSEGEILEAEYIIDNIYR
3766 :     >45358074 molybdenum containing formylmethanofuran dehydrogenase, subunit B [Methanococcus maripaludis S2]
3767 :     MASQTFKDIVCPVCGGACDDIEIVWDEEKRDLTVRNACKLGAAKFKEIISHHRIMSPQIR
3768 :     KNGVLVDVSWEEALEKAAEILANSKRPLLYMGAETSCEAMTTGLHMGEYLGGIVDSCSTV
3769 :     UHGPSLMGVQEAGKAGSTAGETKNRADVVIYWGTNPMDSMPRHLSRYGVFPRGYFVEKGR
3770 :     NSRTVITIDPRKSATAKASDIHLQLNPSTDYELFSAFMMASRGKRPHPSIEKVTGIPVDT
3771 :     IMETVELIKNAKFASIYGGLGLASSFGKQRNIECVMTLVKELQRYTKVTIGLIRGHCNVA
3772 :     GFNVLASYLYGFPFGLDFAKGYPRYNPGEFTANDVLREKEVDCAFIMASDVGAHYPQDSV
3773 :     SHLKNIPVITLDIAPCPSTSVADVVLPGVIDALECDGTFYRFDEIPIYYKPFAKSPFDFT
3774 :     KSNEDTMEQLFELVKEIKERNGQ
3775 :     >45358075 molybdenum containing formylmethanofuran dehydrogenase, subunit B [Methanococcus maripaludis S2]
3776 :     MVAETFKDIVCPVCGGTCDDIEVEYDKEKRDIVVRNACKMGAAKFREIVSNHRITSPKIR
3777 :     INGKLEDSKWEDAIEKAAEILVNAKRPLFFMGSETSCEAMTVGLHMGEYLGGIVDSNSTI
3778 :     CHGPSLMGVQEAGKAGATAGETKNRADVVIYWGVNPMCSMPRHMSRYAVFPRGYFVQKGR
3779 :     KERKVITVDPRVSETAKGSDIHLQLKPSTDYELFSALMLAVKGKPIHPSIEQVTGISVEK
3780 :     ILEVAQIMKNAKFGSIYGGLGLASSFGKHRNLECVLTLNKELQKYAKFQIGLIRGHCNVA
3781 :     GFNVLASYLYGFPFGVDFSRGYPRYNPGEHTTTDVLREKEVDAVFVMCADLGAHLAQDSV
3782 :     RYMHDIPVICLDIAPCPSTSVANVVLPGVIDALECDGTFYRFDEIPIYYKPFTQSPFDFT
3783 :     KSNEDTMEQLFEKVKELKELKKNRK
3784 :     >45358076 molybdopterin biosynthesis moeA protein [Methanococcus maripaludis S2]
3785 :     MISVPEAENILKKFKFEKTENVDLFNSYGRIIARDIVSKQNIPDFRKSNMDGYAVTSPCL
3786 :     ESYVLIDEVHAGDFRDLKIEGNECVWVATGGKVPEEAHCVIPVENTIIENKIMGIIEIPD
3787 :     NTYVVEKGSDISNGDLVLKKGSLINERNIGLIASLGISELKVYKTPKVAIISTGDELEKI
3788 :     SDVNSKSIAGIVKKAGCEPVFLGISKDDKTELRNKLIKALNYDVIVTSGGVSAGKRDFTS
3789 :     EIIEELGTVLFHGVMMRPGKPVLGGEIDGIPIICMPGKVTSCIICSYLFLYPLLCRYSNS
3790 :     KKCKKIVNAKIMGEFKKEADKRFYLPVVYDNGFVKPVFKDSSHITSIAYSNAIVELKEGI
3791 :     SVADGEVEVWIYD
3792 :     >45358077 molybdenum ABC transporter periplasmic molybdate-binding protein [Methanococcus maripaludis S2]
3793 :     MKKQIAIAGLLAIILLFSGCVSESPEETTTTITVSAASSLTDAMNDIAAAFEKDNPNVKV
3794 :     ELNYAASGALRQQIEGGAPVDVFASASQKHVDLLQGQNLIENASRVTFAKNSLVLIVQAG
3795 :     NPLGIASADDLTNENVVKVSIGNPETAPVGRYAKESLETMGLWGNLEGKTVYGENVRQVL
3796 :     TYLETGDVDAGFVYMTDAKIAKDNTIEVITTIPTVTEISYPVCVLKASEHNDEAQMFVNY
3797 :     LTGETGKQILTDYGFTAE
3798 :     >45358078 molybdenum ABC transporter permease [Methanococcus maripaludis S2]
3799 :     MDSILFPVLLTLKISFLSTFFVFFIGIFISYILAKVEFRGRNMLEIIVTLPMVLPPTVLG
3800 :     YLLALQLGKNGVIGSLFYKLTGSGILFTWEAGVIASFVVSLPLMVKTTTAAISAVDKELE
3801 :     HVSYTLGNTKLGTALLITLPLSKKGIIAGIVLSFARSVGEFGATLMVAGNMPGKTNTMSL
3802 :     SIYQAFQTGQYDLANILVITLILMSFLSIYITGKMADKLNS
3803 :     >45358079 quinolinate phosphoribosyl transferase [Methanococcus maripaludis S2]
3804 :     MSFYIPDYELEKIIEEDINPLDLTSQIMKLDRFNAKLAYKARHDMVLCCTEEAERICKIL
3805 :     GLEVISYKRTGSYVKEGEVFFEAKGRADNVHLAWKSVLRLLEGYCGMATRTYEFVTLARK
3806 :     YNENTNVVTTRKNLAGTKKPTIKAIVAGGAYPHRLGLSETILIFDEHLAFVDGDEELKCV
3807 :     LKEMKANALEKKIGIEVDNFETGIKYVKMGFDYIQLDKVDSKTVEKFVKAAKEINPNITI
3808 :     VAAGGITIQNIEEYAKTGAEVIVTSALYFGKAADIKTIIEKID
3809 :     >45358080 hypothetical protein MMP0517 [Methanococcus maripaludis S2]
3810 :     MLDLVYKGILKFNEEKTKILEVASSVTFIETKKNKIVVDTSAKSKTEDLKIYFKNKKINM
3811 :     DEINYVINTHDHFDHVSNNDLFKNAKIINQSNFKELNDPEIEIMETPGHTFDSISVIYGD
3812 :     YLISGDASPLKNNILKERAPGVFVDLELALNSIRKIKSLNKNIVTGHDGILYKNEY
3813 :     >45358081 hypothetical protein MMP0518 [Methanococcus maripaludis S2]
3814 :     MENRTLPIGKADDFFEVFVVDLMITRECDCAFKIDIFEDGHFIEKEGDALRRVESSIHRG
3815 :     SLIITPKNAKKMLNALKKAIEITTEEYGK
3816 :     >45358082 hypothetical protein MMP0519 [Methanococcus maripaludis S2]
3817 :     MNYLKCGFFGLLTWLVPFFLSFLFYSESEGLLIDIFLFKSIMIVVSGLIGVSLLIIYFKD
3818 :     IKKDYLIEGIFVGVSWLIINLILDILILIPMSGMTCLTYFSQIGLRYLIIPTISISMGLL
3819 :     LKLKL
3820 :     >45358083 ATPase, P-type (transporting), HAD superfamily, subfamily IC [Methanococcus maripaludis S2]
3821 :     MTFFKGFKEDYFGLTDLEVKQYRETYGKNELLQKKKKTLLSRILKILTEPMFVLLFIAAF
3822 :     IYFFLGEPRDGSIMVISVIFICAIEFFQEWRTDRTLQALKELSSPKSTVIRNGKMMTIDS
3823 :     TELIVNDLLILKEGEKIAADGIIVENYGLGVNESTLTGESDVVWKKIDLKEDETLEHWKK
3824 :     NICYAGTSVTQGRAVVKVIHIGSETEYGKIGKDIFSVESMPTPLEKQTEKLVKYSAIAAF
3825 :     FMLLLIVLVNFYYRGSVTDSILSGVTVAMAIIPEEFPVILTVFLAMGAWRLANKNSLIRR
3826 :     IPAVETLGSISLLCVDKTGTLTKNQMEVKETYFDSKFNETELMTYACLASETEAYDPMEK
3827 :     AIMIYSKSIRINIDELCTGCLLHEYPFSSETRMMGNVWNKDNKKFIALKGSFENIINLCD
3828 :     LKESEKVNLEKKSIEMAKKGYRVIAVAKKMDVVTINQHLDEYTFEFVGLIGLMDPPREGV
3829 :     SKAMKICNNAGIRVVMLTGDNGTTAKSIAKTIGLKNSENVLTGNEIDSMGDEELLEKINV
3830 :     TNIFSRVIPKHKLRIIKAFKKLGEIVAMTGDGVNDAPALKYADIGVAMGKRGTEVAKEAS
3831 :     DMILLDDNFETIVETIHDGRRIYDNIKKAIGYVFVIHIPVFLTALFAPLLKLPLLLLPIN
3832 :     VVLMEFIIDPTCSIVFERQPAEKNIMLRKPRMPTEPLLDYSLIFKAIIQGVTIFAFAFGS
3833 :     YVYLLYQGLEVNTARTFAFVILIAANFFLVYVNQSEIESVFSAFKKFKNDMLLWLVNIGI
3834 :     FGGILIMLYVPSATEIAKTVPLTEKQLLSAILISGVSTLWWEVVKLLKRIKMKK
3835 :     >45358084 hypothetical protein MMP0521 [Methanococcus maripaludis S2]
3836 :     MKPLKLFNMASKMVKSSKLRSWITILGIVIGIASVIAIISAGDYLSTSVSDQLNDMLSDE
3837 :     ITLTASAAQGSDDDEDPELTDMDVLILNGISDIEYVDVRVSTRNEVRFAGGRETATITGV
3838 :     DPAVWSQMTDEELSAGRLLQASDSNAVIISYYTATEAFDREIGINQMITIGNKQFKVVGI
3839 :     LEEDETQGFGQMGGMSSNTVYMPYEAVYTLELDDDASYSISEKEEGVYDEIIFTLYEDVN
3840 :     QTTALENIQKKLMMSRHVNEDNMDFTIRSPTVFEGPEQIISMLTTFLSFIAGISLIVGVT
3841 :     GISNTMFTTVLEKTREIGIMKAIGAKNKDIMLLFVFNSAIIGLVGGFLGLVLGTILSQII
3842 :     VWFIAQSMDSSYQFVLSIKSVVIAIGCSLAAGIIAGIIPAYNASKLKPVEALRSE
3843 :     >45358085 hypothetical protein MMP0522 [Methanococcus maripaludis S2]
3844 :     MRFMSDIMYKKSLKIGSIMLIMLFSIMGNYAYTFYEDVDDYVILNINKVNQDPDPAIAGD
3845 :     VFDLRVSIENDGGNGEGDFIVEVEPSYPFEEIEGEDLIQDIGIINGYEDGNDAIIAKFKL
3846 :     RVSEDATEGDYPIEVHIYKKGEDASSGYTKEITVTVGNEESAEVSLDADELVAGDKTNVT
3847 :     FTIENTGSAPIKNLEFSWESENNAILPLGSGNLKTISYIGVGSSVDVTYTVLASTDVDPG
3848 :     IYELTMDLTYDDSLNNTKEEVEHLAGILVLGKTDFEVSYSGEDSGEYTLTVMNVGKSDVN
3849 :     SVIVSIPEQDAWSVSGVSTSIIGNLDGGDYTFSNFELSTTQSDSPLIVEITYTSPEGDRV
3850 :     TIQKEVEMPSETTVMSMSSDDSSAPQDFASGPGGNRNPLSTIQNSITSAIPYVIGGLVAL
3851 :     AAIAVFVYRIIKRKKLAKQNKNKTE
3852 :     >45358086 ABC transporter ATP-binding protein [Methanococcus maripaludis S2]
3853 :     MYKIISLEDVWKIYQMGEVEVQALKGVSLDVNKGDFVAIVGSSGSGKSTMMNMIGCLDVP
3854 :     TKGEVYLKSKNISNMNESELSELRGKTIGFVFQQYNLIPNMTALENVLLPLQIQEVNDST
3855 :     AERSAERALKQVGLEDRMNNKPSQLSGGQQQRVSIARALACDPEIILADEPTGALDSATG
3856 :     KEIINLFTALWESGKTIIMITHDQKLAKYAKTIVELKDGKIINIIDNKPNAVHE
3857 :     >45358087 hypothetical protein MMP0524 [Methanococcus maripaludis S2]
3858 :     MQIVRKIILGILMVLGLVSISFAASEFKDMGKEGPGIVCPIDFQNMTTEEIQEQLQLRLA
3859 :     NLEDEYASCEDEQLRTRIQERIEMTQGLIDDPEKLEEMITNMPEEMPERKGNGFKIDFQN
3860 :     MTTEEIQEQLQLRLANLEDEYASCEDEQLRTRIQERIEMTQGLIDDPEKLEEMITNMPED
3861 :     TPERKGECQKANFE
3862 :     >45358088 hypothetical protein MMP0525 [Methanococcus maripaludis S2]
3863 :     MNKNLKKTTGAILMVITLVPYCMAMDEQTSENSSGIFNNILSWLKSALGTNNQIEPETVE
3864 :     FENNSSKNLPMMPELNNSEMNNSTPEIINNTPENITNKTRNTPNNMPENFNEYVPEQRNM
3865 :     SGMPENVNNTKYPPQIPENFENNTPIEINSNNE
3866 :     >45358089 hypothetical protein MMP0526 [Methanococcus maripaludis S2]
3867 :     MVGIMKRILIIFLVLTIIGIAIGVMKPFDSVLVEDDIFIAHGFEDKPNTTEFNPYPQGNP
3868 :     ALSDDQNRAIEIAVSNETVLGYLSEGYWLAPGTMLLKEDFEGYGENFKGVLLAKNETVIY
3869 :     VIVNVKENKVKMIQNYTTFEFKAKTMVVEQNGEYSEIKATGFTDTDVKTVREILSNDQKT
3870 :     AQIIKDKNYNITIQDMVYLSNKNIQNATYAMVLLDIEDGSKYVVMVDITERKVFKMGRPV
3871 :     N
3872 :     >45358090 hypothetical protein MMP0527 [Methanococcus maripaludis S2]
3873 :     MSSKVKIAIYMLIFIVSVIVLTSKFIYPPTVQVIVQGDTTYVQEVPNVYTLYDCMLMVLA
3874 :     SFSLCLSTTLIYFTVRDLELSEKNNVNKIDLSDLNEHIGKIVSSKVDDKINGNTDEISNF
3875 :     EVENELKTTENEEKLRMDNFIKILKGNEKTIVKILMDHGEMTQSELFERTKIPKSTLSRT
3876 :     LSDLEVRGIVLRYEHGISKKVKLNKL
3877 :     >45358091 hypothetical protein MMP0528 [Methanococcus maripaludis S2]
3878 :     MLKKLYSKKGQVSMEMGILVASAVAVAAIASYFYAVNVKYSDTHAGETAKNTSNALINVT
3879 :     ENVCGNISEITIP
3880 :     >45358092 sulfate transporter family protein [Methanococcus maripaludis S2]
3881 :     MKINNNLNYENLKNDLFAGFTIAIVALPLAMAFAIASGVSPEKGLFTAIIAGFLISVFGG
3882 :     SKYQIGGPTGAFVVILYGIIASYGYEGLVIATLMAGVILIIMGLLKLGNIIKFIPYPVTM
3883 :     GFTSGIALIIFSTQVKDFFGLSITNVPATFLGQWITYATNIQLLNPYALLISILSLVILT
3884 :     KSKKVFSKIPSPIIAIIVGIVLVYAFNLPVETIESKFGQIPNSIPFPSLPELNFQKMELL
3885 :     FPSALSIAFLGAIESLMCAVVADGMTGYKHNSNKELIGQGIANIGSVLFGGIPATGALAR
3886 :     TATNIKAGATSRLSGIIHSVMLFLFMLLLSPLILKIPLATLSAILVVVAWNMAEVKHFKS
3887 :     ILFKSPKRDRIVLLVTFLLTIFVNLNTAIQIGMLLAVIVFMQRLIEVSEISNLKTVPQEE
3888 :     DPDSITLKDVPPCIEVYEINGPFFFGIADKFKSTLNVVAKRKPSAIILRMRNVPIIDSTG
3889 :     IKNLEEFIESSKIQNISLIISGADYKLRAKFEKYGLTDKIGNENICENIDLALVRAREII
3890 :     KIKHPETGLCPK
3891 :     >45358093 hypothetical protein MMP0530 [Methanococcus maripaludis S2]
3892 :     MNALDKLYRAYYTKSENKLYFSELKELTGLSNSSLQNALKKLESEKQILKLKEKSNAYYI
3893 :     LKNTKKTVFKFSEIDDERFWKLHRNVRAPILDFLENFPKEIDFMILFGSASRKKETEGSD
3894 :     IDLMVVIHSFEDPDLQKRYREEINQKLEYAKAKAECRSIYPLSIVAVEIDYFLNSNDHMV
3895 :     EQVKLTGFPVFGHQNYHEVILNVKR
3896 :     >45358094 hypothetical protein MMP0531 [Methanococcus maripaludis S2]
3897 :     MLNVEEYFKNKEKLEGAYDFHTYKKNLEKERHAKSLVYAHLDKAKHNLAFVNQNIKSGNF
3898 :     QDWSIVGLYYAVYHAALALVAKKGFISRSHNATMIFLIKNYTNEFRDEELQLIDDLAITK
3899 :     KDATFYTDLKSERQKASYSTDAMFNESKVLELQKKSIDFVNKVEDIIED
3900 :     >45358095 hypothetical protein MMP0532 [Methanococcus maripaludis S2]
3901 :     MGLWSKIKDTSLNIATVGLYGLGKKIGNAANTAEEAAAEAAIALASIGITVQEVGEQLES
3902 :     LLHETEKLIVIKRLIPRETDDLWDEEKERLEELRAELLEIEEKMQNLGVDSSDYNFGSNF
3903 :     YDFFNFDRIHEIMDLVLRRYRLKKEIYEILYTEPGIISESIYNINESIERFNTLEQPRIE
3904 :     NIMDSVDENLLKTEELLEEIKKLFVVNKKEEELKLKLPWYNYKIEKLKSDKEYFSERFGK
3905 :     KELQIQKFEERLKPNFEIDIEVVNPPDVILKTDTQKEDLINLNEKAIEKTETLKNINVQK
3906 :     TSKTNVMVQNVPKVISASTYENVVNLGKKFSCDSNSFKTNSDASRVKSCIRSKEETIQRA
3907 :     KNLLKSQKDYFEREMYRLDRIVELNNIKTENEPGVIPKTLDEVYEILKGVREEEQPRIDK
3908 :     LLDSLNDTLDETKSTISEVKTTIEPIRGIIDSFSGLEKPLKIGLILFGALLVLDLLAAFI
3909 :     VLVKIAIWG
3910 :     >45358096 hypothetical protein MMP0533 [Methanococcus maripaludis S2]
3911 :     MWEKDRIYADSQRKIHESFPKIIVNLAVAFIIWLLAVLVFQPLGDFLGNPFIFGLIGMKA
3912 :     IISGVVIIALVIILLKILKNILMLTDGISDMVAVKFMKDDLNEEKLQHYRSGFRGLGYVL
3913 :     LAIIAYMFFLPLLAGIFAALAGIVLVLLIIWAIFVVIRVGNIFSEDIERKAAEITKKFEK
3914 :     TENKESEEE
3915 :     >45358097 MscS mechanosensitive ion channel [Methanococcus maripaludis S2]
3916 :     MIPELLEYLQNSFFYGLSYYSGLKLILVVVIGLFVSYFIEKRVKKISETTKQTWILNEET
3917 :     AGLISTFVLAIFVVLALNVIESFVTYQLFGFDLKILTYSLLIIYFTYRISNRSKRYLLLK
3918 :     GSQEGKFAEYRLKATVFHYSAMIIAFGIVFQMLGLTSKLGTLLVAGGITGIILGFASQTV
3919 :     VANFISGIFLYFDKPLKIGDSVQIGTNSGIVNDIKMMSTRIRTWDGVLVRIPNEKVFNSE
3920 :     IVNNKKYPARRVDIVVGIAYKEDAQRAMDIISKILENMTYVLVEPEFQIFVNDLGNSSVD
3921 :     ISVKAWTPSEKWYDVKMELVKNIKKEFDKEKVEIPFPQRTVWFPQDLKVKIEKETGEKSE
3922 :     >45358098 hypothetical protein MMP0535 [Methanococcus maripaludis S2]
3923 :     MFGYRPLIPEKFQIENQEIEIEEKDGMLRYTRGNTSKLIKKSSYSLKIVPRPAFGYGVHY
3924 :     LTINFKEPVIVPPKDTFRGYVESPCDIELKLGDMELDLIKLGKEKYTIYGTVDIGDISRY
3925 :     HLSEVYTKEPDSPCVTKFILSNGSNYWKTFEKLVFPIWETIMYYSEDKAYYPTIINITKN
3926 :     GTVELLNTAKTPKNGLTGTKNVTPVSNFLRRI
3927 :     >45358099 hypothetical protein MMP0536 [Methanococcus maripaludis S2]
3928 :     MKTKYVVIIQCDMAKNRCSGMRCTNAFYEKTDAFENYAKDTKYISFTCGGCSGKVVSSKL
3929 :     ANFSRWLKKYDCIKKDEVTIHLSSCMSTDNSHYDRCPNIDYIKQIINKKGYTNIVEGSIF
3930 :     SKKSEKLRDEGIYKKYQ
3931 :     >45358100 endonuclease III homologue [Methanococcus maripaludis S2]
3932 :     MNDFDTTFIKFLDILDEKLKKDAVVDKISKNSDKNERAFKILISTVISARTKDETTAKVS
3933 :     KELFKKVKNPKDLVQIPIDELEKLVHPAGFYKTKAKNLKKLGEILIDKYNSNVPNSIEEL
3934 :     VTLPGVGRKTANLVMTLAFDDYAICVDTHVHRITNRWYYADTESPENTEMDLRKKLPKNY
3935 :     WKKINNLLVVFGQETCSPIPKCDKCFSEIKKICPHYNSLKEIEKIYADFNFKKTPKTKIP
3936 :     KDKGTYVLKIKMNSPKTILVGKREIKFKKGDYFYIGSAMGDSMNLYNRISRHLSDSKKKR
3937 :     WHIDYLLEFSNVKEVNVTLGRFECDVSQRFNLVLDSIESFGCSDCKCKSHLYYIKP
3938 :     >45358101 hypothetical protein MMP0538 [Methanococcus maripaludis S2]
3939 :     MFNLIIKELGEHMPFTALGAIFGMVLLIIFNGISFSESYSIFYTLHPIHVFLSAFTTTSM
3940 :     YLLHKKGSINGYKGFLTLFLIGYVGSLFIATISDSLIPYIGEIILDLPNRGAHIGFIEEF
3941 :     WLVNLLAIFGIVLAYFKPFTKIPHSGHVFLSTAASLFHIIMALGTGLSFLMYFEIFIFLF
3942 :     IAVWIPCCTSDIIFPLIFVKEKD
3943 :     >45358102 3-isopropylmalate dehydrogenase [Methanococcus maripaludis S2]
3944 :     MHKICVIEGDGIGKEVVPAAVEVLKATGVEFEFNHALAGDEVFEKTGVALPEETIAAAKA
3945 :     ADAILFGAAGETAADVIVKLRKILDTYANIRPVKSYNGINCLKTGIDYIIVRENTEGLYK
3946 :     GIEAEIADGVTVATRVITKDASERIFKHAFEMAKDRKKQGTAGKVTCAHKANVLKITDGL
3947 :     FKKTFYEVSNDYKDIQTEDFYVDAMNMFIISRPETFDIVVTSNLFGDILSDGAVGMVGGL
3948 :     GMAPSGNVGDKYGLFEPIHGSAPDIAGKGLANPTATILTAVMMLRYLKENEAAEKVEKAL
3949 :     EEVLSLGLTTPDLGGTLSTSEMGQEVAKRV
3950 :     >45358103 phosphoribosylaminoimidazole-succinocarboxamide synthase [Methanococcus maripaludis S2]
3951 :     MSEYDISKILANEPIYAGKAKSIYKIEENEKEVLVEFRDDITAGNGAKHDVKSGKGYLNT
3952 :     LISTELFNVLEKNNVPTHLIEYIEPNIMIAKNVKIIPLEVIVRNIAAGSLCKKYPFEQGQ
3953 :     VLKTAVTQYDYKNDDYGDPMLNNEIAIELGLATEEELVEIKKLALKVNDVLKGFFDEKGI
3954 :     MLVDFKIEVGKTADGQIVVADEISPDTMRLWDKETKDVLDKDVFRKDLGDVLEKYKIVAE
3955 :     RIGCLK
3956 :     >45358104 phosphoserine phosphatase SerB [Methanococcus maripaludis S2]
3957 :     MTDNLVKKLILFDLDSTLADCEVIDEIAKFAGVESEIKKITNEAMKGNINFEESLRRRVR
3958 :     LLKGIPVEKLNKFAETIPVMNGAPELILELKKQGYVTAVVSGGFDFGAEHVKKVLGLDYS
3959 :     YANTLLSENGILTGEVIGPVMSETAKGDILEKIAANENISLKNTVVVGDGANDISMFEKA
3960 :     GFKIAFCAKEILRSKADICIDKKDLKEILNHIN
3961 :     >45358105 hypothetical protein MMP0542 [Methanococcus maripaludis S2]
3962 :     MLNGGSVLKMDYNTIKIKLDEINTQIKELYENAKELKEIRDRANDDVKKYKDLREDININ
3963 :     VKDQIEEIRLLKQKRADMLAEFKSMKISKSYLAQKIEQLETTLETKPMSMDQEKDMIREI
3964 :     ESHRKLYERAVELEDLNETIKTMSDGISVLVNQSSEEHKKVLENARVSAEKHQELLRTYA
3965 :     EINDLKAKATELYDKLKEMKIKEIVEEEL
3966 :     >45358106 hypothetical protein MMP0543 [Methanococcus maripaludis S2]
3967 :     MDDRYLKPHIVIGDLSKIHGLKNEEKILLGTDGSITNLLEILFGEEVVVETLYQEIIDNV
3968 :     NYRAVLLGVNGIPLIYATSETPLNLIDEIHIREKIKKDLLSADIPIGKILKIHNLETRRE
3969 :     IVEIAVKEVPDVVKNKLNPKRIKIPQRTYNIIHKNKVLMTITEMFNLEDHL
3970 :     >45358107 MoaA/nifB/pqqE family protein [Methanococcus maripaludis S2]
3971 :     MLKEALFYENLENCKVKCNLCPKHCVISSGRRGICGGRENIDCKLYAVNYGKICATAVDP
3972 :     IEKKPLFNYKPGTSVFSIATAGCNFRCKHCQNWEISQSLPEDVPFSELTPEDVVDLAKNY
3973 :     LCEGIAYTYTEPTIFYEFMQETAKIAKNNDLFNVMVTNGYIEKEPLKKLSIDAMNIDIKG
3974 :     NSEFYKKICFAELEPVLETCILAKKLGIHVEITNLIVPTYNDNQKDIEFIINFVKDELGV
3975 :     DTPLHFTAFYPHYKLTSVPSTSIDVIKKARDMALNAGLNYVYAGNVPFSAGYDTYCPDCK
3976 :     SIVVDRFGYQKPKLHLDTSSKTPKCPKCGRKIDMIL
3977 :     >45358108 molybdenum cofactor biosynthesis protein MoeA [Methanococcus maripaludis S2]
3978 :     MRYLELCTIDHAKEVVRTLLNELSTEEVSLFELPGKMLAEDIVSSVDVPPFDRSRMDGYA
3979 :     VRAKDTYEAEEDKPVTLEIIDKIRAGGNSDLEILPGQCMEIATGAPLPKGADAVVMVEFA
3980 :     EIEGNSVKLYKAVSPHENIQPCGNDIMVGELIMRKNTVISPRDIGAISAVGKNKLKVFKN
3981 :     PSIGLLSTGNELISPDDKLEPYKIYDVNTYTIASSILEKGWNFNFYGIVQDNKEDLMEKL
3982 :     KKAMNEDVILLSGGTSAGVGDLTSTAIEELGGEILVHGIKIKPGKPTIIGRIGKKLVVGL
3983 :     PGYPTSCLTIFDVLFNEKGKTMRAQVYNRYMSAKGREEYLPVSIIRGNDGYGAYPVLKGS
3984 :     EAITSLTYADGYIIIPENKEIVEDEIFDVHMFGDIRIGLNIIGSHCVGIDRILRKGHILA
3985 :     RTVNTGSLGGIMAVKRKEADIAGIHLLDNNGEYNVSYLKKYNVSDAVLVRGYIREQGFMF
3986 :     KKELGIKSIDDLIEKIRDYRIINRNKGSGTRILFDKFLKENNVDKNSIDGYDIEAKTHSA
3987 :     VGTAVSMGKAQIGLGISTISDHYGLEFIPIADEYYDLLIPKEKLYDEDIIKFIETLKKEE
3988 :     LPFKKSKDTGKIIYEC
3989 :     >45358109 AMMECR1 domain protein [Methanococcus maripaludis S2]
3990 :     MKLTLEEGTSLVGYVRNVIKQYLKGEEPDIQKYPDKFNNVFGVFVSLHTHPEHDLRGCIG
3991 :     IPEPTMSLIDAIKETSISAAVHDPRFQPLKHSELKNTIIEVSVLTPPEDVEVEDSMEYLE
3992 :     KLEVGRDGLIIEFGPYRGLLLPQVATEYNWDTKQFLSNLCLKAGLPTTAWIEYDVKIKSF
3993 :     QAQVFEELIPNGPVVEKSTYTGC
3994 :     >45358110 RecJ related protein [Methanococcus maripaludis S2]
3995 :     MDILPIEDISKFNQITGKIKEKIENCDGLIRIVTHHDPDGLTAGSIMLKTLLRLNKNVQM
3996 :     TILEHLSKESVEELSKENDKMFIFCDMGSGQINLINHLQFNAVILDHHPPEVAETEIGNI
3997 :     LQLNPHLFGANGAKEISASGVCYLIARLFEYYDLATVAVVGAIGDMQHLPFIGLNKYILN
3998 :     EARKYRYLSVIKDIVYNCYNLPISRSIYYSTQPYIRELDGIDKIKEILEELSINPEKKGI
3999 :     TVAEKENLLEYFKRFNKNDDLIVDRYEINHKLNDAFYLSEVLNACGRKEMTSVGIGILLG
4000 :     DDECIRQGENLYKEYKDELIGELKNVKLTSMDNIEYFIGEKGKTGIISALMVKDKPVLGF
4001 :     NEQGEIYKVSSRGSKELVECGLNLSKAMVVSKEFGGDGGGHNIASGAAIQKNYLNEFLEK
4002 :     VNEIVGEQLKK
4003 :     >45358111 imidazoleglycerol-phosphate dehydratase [Methanococcus maripaludis S2]
4004 :     MRAFKVKRDTNETKIQLELNIDGTGKYSITTGIPFFDHVLSSFAKHGSFDLKLDVLGDLE
4005 :     IDDHHTVEDVGIVLGKAFENMEKKNIKRFGWAIIPMDEAKATVSIDIGGRPFVVGNYVPN
4006 :     TERIGSFSTENVVHFFESFSNNAKINLHFEVTGENEHHKVEALFKAFGVAMDMATQIDER
4007 :     KGIVSTKGVI
4008 :     >45358112 hypothetical protein MMP0549 [Methanococcus maripaludis S2]
4009 :     MKRNKKIALVSHCILNANSKVEGLSEYGGMLKDVMNYLMDEGYGIIQMPCPEMAIYGIKR
4010 :     WGHVKEQFDTPHFRKVSRKLFQPILEQVQDYIKNGYEVSLLIGIDKSPSCGINETCSSNE
4011 :     WGGYSSNGNMAEKSEKLEMIPEKGIFMDEILKILNENEIAIKCVAIDEENIENSLEYLKR
4012 :     FI
4013 :     >45358113 amino acid ABC transporter periplasmic protein [Methanococcus maripaludis S2]
4014 :     MNNKVLILIIGLIGAVLAFSGCVSNSEAQSTEDNSWKNVEESGVLKVGLCAAWPPFESRN
4015 :     EKTGEIEGFDVDLANALGEELGIEVEIVDAEWQALLGGLSKGDYDTLITCMSKKEASVEN
4016 :     VEMSEVYYELNDVIVVRNDNNEINNVSDLSGKIVGVQLGSGSEQAVDALSGIKEIKRYNY
4017 :     NPEAMIDLQNNRSDAVVVGYTYVLSEISKYPDLKVLDTPIASAEIVMVQKEGAKELTVKL
4018 :     NEALSKIKENGKYDEIQDKWLSLE
4019 :     >45358114 binding-protein dependent transport system inner membrane protein [Methanococcus maripaludis S2]
4020 :     MKFYIVFDNIPFIIDAVFVTLKITIMSFLLAVIIAVLVGSTRAMNFSKTLDLVLMAYVEV
4021 :     FRGTPLLIQLFFIYYGLPSIGITMSSTFAAVLGLSLNGGAYISEIIRAAIQSVPVGQFEA
4022 :     AESLGMGKIESMVYIVLPQAFRITIPPLVNSFSSILKESSLISVLAITELTRIGQLIYTR
4023 :     TSRPFEIYLTIGLIYLILVSIISIGSWKIEKKLNGAFER
4024 :     >45358115 hypothetical protein MMP0552 [Methanococcus maripaludis S2]
4025 :     MNKVKGTAYTIYSSVAFGIMPFLTKFAYDGGANAVTTLMFRFLIAGLILYVFLKFKKISL
4026 :     KISRHNFVEILFYGAFLYALNTVFLYEAYNYIPTGIATTLHFIYPVTVTLLMISIFKENL
4027 :     GINKVLALIFSFLGMYCLLGGNCAGFDIYGVLLAAGSGLVYAGYIVSAGKCKYSKIDSYV
4028 :     TIFYLSILSSVLLFIYGLFTNTLTLNMAFSSYASIGLISIFCTVLALIAFLEGIKLIGPS
4029 :     NTAILSTLEPIVSIILGILLLNEVLSFKIGLGSVLVLISVIIVTIEKSKVSDTVKN
4030 :     >45358116 ornithine carbamoyltransferase [Methanococcus maripaludis S2]
4031 :     MDLLTLWNLEREEVLKIIEDAEYFKKNRYGHEILKNKSIALIFESPSTRTRMSFDLAVNE
4032 :     LGGHSLMMNEGEIHLGKKESIADTARVMSRFVDAIVARVKNHKTLEDLAEYGSVPVINAL
4033 :     CDLAHPCQILADLLTMKENGKNFKGLKLAYFGDGNNVSNSLMIAGAILGMDVVIATPRSY
4034 :     EPNGLFVKKALEIIAKYGEGSLTLTDDPEIAAKDADVLYTDVWISMSDKNKQMDEILKIF
4035 :     PKFQINDEILSKAKKDAIVLHCLPANRGLEITDEVIDGKQSKVFDQAENRLHAQKAVLKY
4036 :     IFEH
4037 :     >45358117 SAM-binding motif-containing protein [Methanococcus maripaludis S2]
4038 :     MHYFSENPDSKHDESTISGMLRGKRFSFKTDSGVFSPKKIDKGTIILVEELELSKDDDVL
4039 :     DVGCGYGVIGISIADEVNSVTMTDLNNRSVGLTRKNIKLNGKSEKNIEVFQGDLFEKVNN
4040 :     KKYSVIISNPPIKAGKELIHKIISKGHNLLNENGSIWVVIQTKHGAKSLTKYMEEIFGNV
4041 :     ETVTISGGYRVLKSVNMGSE
4042 :     >45358118 preflagellin peptidase [Methanococcus maripaludis S2]
4043 :     MIEYIIGVIGLLLASVQDFRSREIEDYIWIVLAVFGILFAIYSAITLSNYSILINSISGF
4044 :     VICFILGYMMFLSGIGGGDGKILIGLGALVPKFQMPIYTSLGTLLNLNYIPNFPIMVFIN
4045 :     GIFFMVFLPFVILFRNILNGARPKTGKEVILMFFGEKMKVKVAKEQKRLIMGQNDKINFF
4046 :     PASDDEDFSKYGDEEEIWVTPQIPLIIPITLSYLVTPIIGDRILDLLIPF
4047 :     >45358119 TatD-related deoxyribonuclease [Methanococcus maripaludis S2]
4048 :     MDILKELPITDNHIHIDPVNGLGPEKVAKTFKNAGGKVMIIPNKPAFSTNLTKPMDEMLS
4049 :     IIEKVRENGIIAFGILGAHPAELTVMLRNGIELETAKKYMIDALDYAKKMVLENEFLIGI
4050 :     GEVGRPHFEVEEKIWDVSNEILTYSMEIAKDIDCAVQIHAENASREQFKEFSEMAKSVKL
4051 :     SPEKVIKHHSSDMVLEGEEFGIFPSIVASKPIDTAIEKSTRFLMETDYIDDLKRPGVVLG
4052 :     IKTVPRKTRQMLENEIIDEEICFKIHKENVENVYGIEIDF
4053 :     >45358120 hypothetical protein MMP0557 [Methanococcus maripaludis S2]
4054 :     MDTVFKYIDENYQNLKNNGLKIAELGIGFYFNNAKKLKDSGFDVIVIDINKNAVLDAKDN
4055 :     GLNAFYDDLFEPNFEIYKNVGLIYSFRPPRDLQPFILKIAKKLNCDLIIKALSGEEPIEE
4056 :     LKLVNYQGKPIYVWKRD
4057 :     >45358121 hypothetical protein MMP0558 [Methanococcus maripaludis S2]
4058 :     MSNNSVKVDYKKLIISIALDIVGMATYLIPGLGESGDFVWAPIYALIIRNLYHSSILGFF
4059 :     GGFEELLMGTDIIPSATILWVLETFGIIKNKEFQENYK
4060 :     >45358122 hypothetical protein MMP0559 [Methanococcus maripaludis S2]
4061 :     MVAIVMVIAPEKFRDEELFEPLQVFQSKNIATQVVSTTTGQHKGVLGRVMTTTKTIEGVN
4062 :     PDDFDAIVIVGGGGSRDYLWNNEKLLELLKEFNSMGKITAAICISPAVLAQAGLLTGKKA
4063 :     TVFPDDEAIAVLQQKGAIYLDEAVILDGTVITGRNPDAAKEFGLKIAEALGK
4064 :     >45358123 SAM-binding motif-containing protein [Methanococcus maripaludis S2]
4065 :     MDFKKIKYQKIGDILIVKKNLNDNEIDYLVNKTKCKTIVKYNTYITGDLRTPKIKILHGS
4066 :     ETETINKEHGCLFKIDVSKIMWSMGNLEERKRISTLSNSEEIVVDMFAGIGYFTIPIAKY
4067 :     SNPKTIYALELNPDSYYYLSENIKLNKLDNVVPILGDNRDFSLKNVADRISMGYVLKTHK
4068 :     FLDKAFEILKRDGGVIHYHETVHENILESRPIERLKYHSEKNGYKLDEYKINKIKKYSPG
4069 :     VWHIVVDAEFSKI
4070 :     >45358124 carboxymuconolactone decarboxylase [Methanococcus maripaludis S2]
4071 :     MNEKSSISDEKLCGLMEIVEKRYGKVPYIIEKMKNNPKLLESKINYDEAVVDEYKHIDPK
4072 :     TAELISIAVVSALGCEHCIEFHIEAAKKMGISEEQIMTAVLIAGSLSNAAVLSKSTRALQ
4073 :     KVNNILKYDENSLSCPECNISGIK
4074 :     >45358125 hypothetical protein MMP0562 [Methanococcus maripaludis S2]
4075 :     MGALSEYLELKNESYLISEEVSRVLNDRKRTNSEKREIVEKLQKKLRSKKQKIKILHDRV
4076 :     VEYYVFPGTLIILAYLAFQFSEYITETLIEILMKFI
4077 :     >45358126 hypothetical protein MMP0563 [Methanococcus maripaludis S2]
4078 :     MKTVNSGKCLSFFVGEFKLEVESKKAEKIVYLGSRGVCFSMAQLFGYSIRNTVKNQYFIP
4079 :     DAEIENSVEYELTDIGYRFFGLENKKNLDNPDILVILGGIATKHSKATIEEITGLIENLN
4080 :     PKIVIGVSICNVFDKSGWLGKINFDSLIDGTLEPVVLMKK
4081 :     >45358127 hypothetical protein MMP0564 [Methanococcus maripaludis S2]
4082 :     MNNKKIFLFEFTVGTGLVPDELLAEGKLMFDILLNQFLDENYTVKTVLCEKIAKKYPKYN
4083 :     EINNLEIIVSDNYINSFKEGLDDSDFALAIAPEEDLILYNLTELIEESGCLNLGCEKSGV
4084 :     KIAGDKFLTYEAIKNAVNTPKTFPVKKYVVKNRLGCDSTHDTFDENYIVQEFIEGEPYSV
4085 :     IFIAKNKKFYPVCMNKQYIEKRYCGGEINIEHTLKEKAIIECKKTLEKIEGINGYVGVDL
4086 :     MINGEEISILEVNPRITTSICGIKSKPSIGKLLIDNALEKDIKFEVESCLKFKRNDFGFE
4087 :     FL
4088 :     >45358128 hypothetical protein MMP0565 [Methanococcus maripaludis S2]
4089 :     MVKIMQYINKSKEEFLSEIYRIVAKIRLELELTTSEITISDFEFKMDSENSKNLILMIYT
4090 :     PTRTDKSLLIGPGGWVVGKLREKLNGSFKENLIIRVESYIDRKKELDAIENSISHLREKG
4091 :     LDISSKKDALVIIQCEYDLSSIDFINEYFNPIFITFDLGTALLPHKNRNRIEQVFKDKNL
4092 :     KYEFLSPYSLNGEQITDAISKNPCETICNNLISEMVNYAKNKNIEIVLFNHLNKDYEFRN
4093 :     GIHILNFLKMFPIKLNSLIHKGRSLDCPLLIQSCKRNKITKTFKIKQIVSGVYSGLVEPT
4094 :     EGAEEIIKYLK
4095 :     >45358129 acyl-CoA synthetase [Methanococcus maripaludis S2]
4096 :     MLFTNDTIGEFFEKQAQKDPDREFLVYPDRNLRFTYKEFDERTDLLAKGLLEIGIKKGDH
4097 :     IGIWARNVPDWLTFMFATAKIGVVLVTVNTAYKSHELAYVMKQSDMKALAIIDSFRDVNY
4098 :     LEILYELVPELKTSQRGKLNSEEFPYLKNVIYVGQEKHRGMYNTTELMLLGNYVSDEKLI
4099 :     EAKKGLDSDDVINMQYTSGTTGFPKGVMLTHKNILNNGYYIGEKQKFTEEERLCLPVPLF
4100 :     HCFGIVLGVLALLTHGGTLVMLEIFDPLLVLAAIQKEKCTAVYGVPTMFIAEFSHPMFEM
4101 :     FDLSSLRTGIMAGSTCPIEAMKKVMSDMYMREITISYGLTEASPVFTMTSVDDPFEKRVE
4102 :     SVGKAMPHCEVKIIDPETGETLAPGNVGEICCRGYNVMKGYYKMPEKTAEVIEKDGWLHS
4103 :     GDLAVEDEDGYYKIVGRIKDMIIRGGENIYPREIEEFLYTMPGINDAQVVGIPDEKYGEI
4104 :     VGAFVIPKEGYEIKEEDVRDFALEKIARYKVPKHVFVVEEFPMTASGKIQKFKLTELAVE
4105 :     LLKKKKEEL
4106 :     >45358130 hypothetical protein MMP0567 [Methanococcus maripaludis S2]
4107 :     MFKTTVTPRFGDVDGLKHVNNIVPAIWFEQARNPLFEIFVPDFDLSYEKWNLIMVRTEFD
4108 :     FVGQMYLGMDVEIRSYISKIGNSSFTMYQEAWQNGKLAVKGKAVAVHYDFVNQKSVPIPD
4109 :     SIREKLMEHFIEGID
4110 :     >45358131 transcriptional regulator related protein [Methanococcus maripaludis S2]
4111 :     MSIEELAQASNSSVKLIENLENGDLIPSLTPLFKIARALGVRLGTFLDDAPQNGPVLTRS
4112 :     GSSDSIVRFSGKLDGTKDSKLDFYALAAEKQDRHMEPFLIDVYPIESNEYKLSSHEGEEF
4113 :     IYVMDGEIEVMYGQEKYMLKKGDSIYYDSIVPHDLHAFGKDVAKILAVIYSPF
4114 :     >45358132 hypothetical protein MMP0569 [Methanococcus maripaludis S2]
4115 :     MKSILKKIGCILVGSTVLSASITAAYALEKYGNINDFIDDDLIKNGNPDVYIVVGENAAA
4116 :     LDVTSANKISAKIGTLTYSETIIEDESTVEYQIIGESESIDLLDGTDKLDSAGTEKSWIL
4117 :     VTSADDDYADHFDDEEGNSFSYSGFSEADQTKSLGHLGYLLEVGDIDPENHFESDDDATE
4118 :     IVFVRITDSNKNAGSQTFDIGKDMVYASIVYPNQVSAFKLTKDLKEGYEIPFLGKKYRIV
4119 :     QIDEDDGIIYLGTASYDGTLEQGNYISSGEYQVVIGEILESGDEYSVEISILRNGNIIKE
4120 :     HTEILRSDKSFSVIAGDLGVTVHDVWTNAAADTGYADITICRSLTELKLGEEYVNNWEVR
4121 :     AVTNTGGTIDFLKTYEDNTVGIALVYSGSDIEEINDGDRIKIADYVNLVFDDEDDLDKMV
4122 :     AEFKAERTVTTGSTGGTVISKSGEVPEIIMDSEIELDEADKNLILIGGPVANKLTKELQN
4123 :     EGKIDIGNESPATASLIEGAANGNNVLVIAGGDRYSTESAVLSLINLI
4124 :     >45358133 hypothetical protein MMP0570 [Methanococcus maripaludis S2]
4125 :     MYTRKGTILQALSEIMKNAEYFIKKLDLEKHPEGGYYRRIYQSDEMVNKSNLPERYDSDR
4126 :     FYSTSIYYLLNGNDVSKFHRLKSDEIWHYYFGSLVIIHIIDNFGNYTLEKLGPNLEENEN
4127 :     FQVIIPKNSYFAAEITEKNSFAIIGCTVSPGFDFEDFELASKNELLKKYPKHHKLIEKFS
4128 :     D
4129 :     >45358134 molybdenum cofactor biosynthesis protein A [Methanococcus maripaludis S2]
4130 :     MEDRYGRQIRSFRLSITPKCNLKCFYCHKEGRNEEHGKLMSADEIGKIVNSSLEFGVRKI
4131 :     KISGGEPLLRTDLPEIISYIKNEQIKDISLTTNGILLEKYAQKLKDAGLDRVNVSLDTLD
4132 :     PVQYKKITAGGNIESVKKGIEKAIEVGLTPLKVNFLAMDCTVNQLPAIMDYCRKIGAILQ
4133 :     IIEFIPMEPELKHHHVDVVPIEEEIAKNADNVFTRKFMQNRKKYVIDGLEVEFVRPMDNT
4134 :     EFCNHCTRIRLTYDGYLKPCLLRDDNLVDVANPLRNGEDIRKYFIKCIHEREPFCKP
4135 :     >45358135 peptidylprolyl isomerase, FKBP-type [Methanococcus maripaludis S2]
4136 :     MEKGKLVKISYEGYVDENLFDTTNEELAKEKGIFNPNMVYGPVTISAGEKMLIPGLDGAI
4137 :     MEMNVGEERELDLTAENAFGKRDPSQVKIVPMKEFKKHKVNPIPGMPVNIDNKIGKVVSA
4138 :     NGGRILVDFNHELAGKDLKYKLKIEEVVEAPEAIALEVAKLFIPRISEEDLKITIDGENV
4139 :     TLDLPENTAFMQNLQMVKMGISNELIKRLEAKKVSFIDNFVKKEEKTE
4140 :     >45358136 putative molybdopterin-guanine dinucleotide biosynthesis protein A [Methanococcus maripaludis S2]
4141 :     MISAIILSGGKAERMGGEKSFRKSGNKYLIENIADMLIEMEIPFVTVFKNPRFMEKPEEE
4142 :     IEKQLYYYKKYHQTITWDFVPGMGPLIGMLSGMLNTKSQWVFLVPCDMPFITEESIINLL
4143 :     SFIKEAELNGYDCIVPKHKNGFIEPLFSLYHISSVNVLGMVVEEMLEQNRSFPIRRLIDE
4144 :     LNPLYVDVDKIDKTCDIFINLNTLKELENACFDR
4145 :     >45358137 hypothetical protein MMP0574 [Methanococcus maripaludis S2]
4146 :     MERETIKRSSRRWKKKGQMRWKHYKKRIRRMKREKRENK
4147 :     >45358138 aspartyl/glutamyl-tRNA amidotransferase subunit C [Methanococcus maripaludis S2]
4148 :     MIDVEKIQKQADEIVAQLSEVLENFDLETEEEYHILETKNVLRDDDEALLDESFKIDALN
4149 :     VAPKVKDGSIVVEKSKWSQ
4150 :     >45358139 dihydrodipicolinate synthase [Methanococcus maripaludis S2]
4151 :     MQGVYPAIITPLKENKVDYDGLRNNIDFLIENGVSGVIPVGTTGESPTLTPLEHEKVVEK
4152 :     VVEFVDGRVEVIAGTGSNSTSEALEFSQYAEDVGVDGVLLITPYYNKPTQEGLKRHFGEI
4153 :     ANSINVPIVLYNVPSRTALNIEPETIKYLFNEYSNISAVKEANPNLSQVSEVLDSCDIDI
4154 :     LSGNDELTLPIISLGGKGVVSVIANIAPKEFVQMVDFANAGKFDKAKEIHYKLFPLMKLM
4155 :     FVETNPIPIKTAMNMLGMPSGELRLPLCEMAESNKLKLQNALNNLGLLK
4156 :     >45358140 30S ribosomal protein S17e [Methanococcus maripaludis S2]
4157 :     MGRIRQTFIKRTGEELIEKFADKFTSDFEENKKAVEEVAMISTKPLRNRIAGYVTAKVKK
4158 :     MNA
4159 :     >45358141 chorismate mutase [Methanococcus maripaludis S2]
4160 :     MSNSSEKRLEEIRKRINEIDEQLIELIAERTSFAPEIAALKKSLGTCVFDPKREDAICEK
4161 :     TRLMCEKHHIEPEVALKVMKILMTYNKEVQKDSIDG
4162 :     >45358142 hypothetical protein MMP0579 [Methanococcus maripaludis S2]
4163 :     MDLDSWECYYNQILDDFGYGSAEDLKSAEILEEMIKKFKNNVDLNEISKKIFGKKVYIFG
4164 :     AGPSLKKHVLKLKESIESNITIIAADGATKALLEEDIVPDIIVSDLDGDIDSILKSNDLG
4165 :     SIVVAHAHGDNIDKLEKYIKLLKNIVGSTQFPKKFEFLINYGGFTDGDRCCFLAEEFGAK
4166 :     KIILCGMDFGIYVTKYSRPNIEKDIELADEIKVKKLKYAEMFVNWLITNGKSPIEFMP
4167 :     >45358143 anaerobic ribonucleoside-triphosphate reductase activating protein [Methanococcus maripaludis S2]
4168 :     MKNHLKKYLNHLFLYIIGVTVLYKTHMGIGEILKISGIVELSTIDYPKHASAVVFLSGCN
4169 :     MKCGYCQNYEYITTNISEMTAEEVFNSMDLMFAEALVISGGEPTLQPEAVLELAKIAKGK
4170 :     GFPVKLDTNGTNPDLVEKLISNNLLNYIAIDVKAGFNNYEKITGYKKEIKENILKIIDLC
4171 :     KKEGIFVECRTTFIPELMDESDIEEIAKTVKNCNLYAIQQFDREHSYDKELCNVKRISED
4172 :     DLIALGKIAKKYIENVKIKTLSSEIPIN
4173 :     >45358144 hypothetical protein MMP0581 [Methanococcus maripaludis S2]
4174 :     MEIKILVDNTAKGKFLAQSGFSAIIKDEDSKILFDCGQNAHVFENNLKLMGEDDDFDAVI
4175 :     FSHGHYDHTDGFNYFIEKYGENLDVPIYIHKSAFVDRYHGERYIGIDENIKNFLKNYKNL
4176 :     KLIEDPFKISENLIISGTIPRTNFYERENFEMIENGQKVDDIIIDDMFVIVKDIIISGCT
4177 :     HSGLINCITHAKTLKEVNGIIGGFHMGTASENYINQVKNYLKTQNFRLVSPVHCTGFNAT
4178 :     KELSDISGFKFGHVGSVFEI
4179 :     >45358145 AzlC family protein [Methanococcus maripaludis S2]
4180 :     MKQLSFNKLYFEGIKDAIPISIGYLPIGMAFGVLAKSMGIPYEISILMSLIIFAGASQFV
4181 :     GVNLIAIGTSSFEIVLTTFILNLRHFLMSSSLSQRIDYTKSKKFLSLISFGVTDETFAVA
4182 :     SLKEELKLSPEFLFGLNFTAFFAWNFGTVLGIFLAESIPKEIQSSMGISLYVMFIGLLIP
4183 :     AVRRSTKVLKIFLVAVFISSALTWVPVFKFISTGWIIIITTIVASFIGAKFIHGDGDE
4184 :     >45358146 branched chain amino acid ABC transporter [Methanococcus maripaludis S2]
4185 :     MSREEMVLLVIFMAIVTYIPRMLPIVLFKDAKLPHFWRAFFSYIPYAALASLIFPGILYS
4186 :     TGNMYSSIFGAIISLILAYYRLNVIIVVFGGIIGAYIAQMLI
4187 :     >45358147 valyl-tRNA synthetase [Methanococcus maripaludis S2]
4188 :     MEIKEEYSIELEKKVQEKWEDEKTFKFLDDEKRPPYIIDTPPPYPTGRMHLGHGLNWTYM
4189 :     DIIARFKRMNGYDVLFPQGWDCHGLPTEVKVEELNNITKSDIDRHEFRRLCVELTDENVE
4190 :     KMRGQVRSLGISIDWDREYITMNPDYVRKSQTAFLKMYEKGLIYRGKHPVNWCPRCETAI
4191 :     AFAEVEYQGRTSKLNYIKFPYAENSGKYLEIATSRPELMAACVGIVVHPEDERYSDVVGK
4192 :     TVKVPLFDQEVNVYPDSDVEKEFGTGVVMVCTFGDKTDVTWVNRHKLEVKKAINEKGQLT
4193 :     EICGKYAGKKSDDARKEIISDLISENYMIKQEPLEQNVGSCWRCKTPIEIIVGDQWFVNV
4194 :     TKLLTEVENAANEISWVPEHMKARLMKWIEDMGWDWCISRQRLFATPIPVWYCKDCGEII
4195 :     VAKPEDLPIDPTKESPYTCKCGNSNLVAETDVLDTWMDSSITPLVIAGWLEDEEFFKKHY
4196 :     PVQLRPQGHDIIRTWAFYTMVRSLAITGEKPWDEIVINGMVFGEDGFKMSKSRGNVVEPG
4197 :     EITKTYGADALRLWASNSTIGKDVPFAWKEVEYGGRFLRKIWNACKFAKMNISDETISEL
4198 :     KSLNSISIENPVDLWILSKLNNLISKVSDDLGNYKINTVVEIQKFLWHEFCDNYIEMVKH
4199 :     RLYNKEESESAQQEKLMAQYTLYKVITESVKLLTPFTPHFAEIVGEIYEIDDLHTSWPVS
4200 :     DERLISLENEFVGEVVKNTVASIRRYKSNKGMPLNAELNKVEMYVSDEKDFNAVSKASED
4201 :     VKKSLKIKELEINLGKPSLEQKISEVTPNKSKIGPEFKKDAGKVMAFIKEADADTIEKML
4202 :     SEGIETEFGILNKEHIKEVKRAIYNKGEIVETADIDSLIDTIAIIQ
4203 :     >45358148 UspA domain-containing protein [Methanococcus maripaludis S2]
4204 :     MAYKKIIMPTDGSKISIEAAEQAIDLAKATEGRVYGIYVIDIVPFVGLPTEGLWESMKEV
4205 :     LEKEGHTALRTLTDIAREKGVEIKTEILEGTPSKEIVEYAEAKNADLIVMGTTGKTGLDK
4206 :     LLLGSVAERVLKKSHCPVLLVKSSE
4207 :     >45358149 uncharacterized endonuclease III related protein [Methanococcus maripaludis S2]
4208 :     MDNKETFQKIYDHLFNLYGPQGWWPLLEVNGCNPTKTGSINGYHPNNYEYPKTKNQCFEV
4209 :     CIGAILTQNTSWPSVEKSLKNLRKLIEITPENIINLDIEQLKEAIKPSGYYNQKSVRLKG
4210 :     FSEFFIKLNHVPTREELLKLNGVGPETADSMLLYAFKVPSFVVDAYTKRILINLNLIDGS
4211 :     EKYDKIKELFEENVEKNLEIYQEYHALIVEHAKNYYRKKENYITCPLLKIIK
4212 :     >45358150 sodium/hydrogen exchanger [Methanococcus maripaludis S2]
4213 :     MDTYFLFFIILTSIFIVPQILKRFNVPTITATMLAGILIGPFGLNIIQSSATLDTFAAFG
4214 :     VIFLMFLAGLEVDNETLKDEFKNSLVLSLFSMLIPSIGGYLIGQYFGLDFIGSLLYAVIF
4215 :     SSHSVGIVYALMDELGLIKSRFGTTVISASVVIDLISLIVISILIKMGGSGITSDIIPFV
4216 :     VLIAAYIIALLIIIPLISKLILKELKKFHVQKIHFILLIILISIIVGEHIGIHPIIGAFI
4217 :     IGIAVSEELTKEEHDQILNENLNAIGYGIFIPLFFLNLGMTTDISVIFNFDNISLILVSV
4218 :     VTLIGLKISSGYFSLRILDYGKLKSFCGGLLTVPSLTASLVGATLGRDLGILPEKFFVSV
4219 :     VVIALLTSTVAPIYVKSLVSKNYDKLKLN
4220 :     >45358151 diphthine synthase [Methanococcus maripaludis S2]
4221 :     MLVMAGLGLYDERDVTLKTLDFAKKVDKIYAEFYTAILTGTTMEKIEGTLQKPITVLDRE
4222 :     KVEYETNKLIDEAKDKDIMFLTAGDPMVATTHVDIAVEARKKGIEVVIINAPSIYSAIGI
4223 :     TGLQLYKFGKTTSIVFPEPNYFPETPYDVIKDNLKLGYHTLCLLDIQADKERFMTANEGL
4224 :     DALLKIEEKRKENVISEETEVAVVARAGSINPGLYYGKIKDLLNYDFKSPLHCVIIPGKL
4225 :     HFMEEDALKYLFENI
4226 :     >45358152 radical SAM domain protein [Methanococcus maripaludis S2]
4227 :     MHYNSNLNFKKGNFMKFLILDGYTDEPAGLGVPPYIGMYPRYAAGVLYKFKHDVDYITID
4228 :     KLREELKKGYDFNRYDVVIAICGFHTPGKYLNANPATLREFVSILYNFKGLKILGGPVAT
4229 :     KFGSSLEGGKIKDESNLKYFFDVISEGDLDAVLHDLLKNNFKPEKTDGTRLRTYDELDEF
4230 :     ARIGAKIVKLHPNYPNIIAEIETYRGCTRAFSGGCSFCTEPRRYGSPKFRNSRDIIEEVR
4231 :     NLYENGIKYFRIGRQPCMFSYMAKDVETTDVPVPNVLEIEKLFNGITSVSKPSVLHIDNA
4232 :     NPSVIARHEKEGREIAKILVRHCTSGNVAAFGVESFDEKVISKNCLLTEPEDVLKAVNIL
4233 :     NEIGGKRGENGMPYLLPGINLLSGLKGESNDTFEINYDYLKEIYDSGNILRRINIRQVVP
4234 :     FFGTDITVKDVEKARKRKNLFLKFKEKIRTEIDNPMLKRMLPTETILKNVIVEVKEKNDL
4235 :     YFGRQFGSYPILIGVAEKNVEIGKFVDIRVTGYGRRSITGKIVK
4236 :     >45358153 glycosyl transferase family protein [Methanococcus maripaludis S2]
4237 :     MMVAVIPAYNEEKNIISVLKDLSDINIDVIVVDDGSTDKTKTIINEFLEKNEFKNKIFPI
4238 :     FKEKNEGKSKALEDGTNYAINLNYDAIAYLDGDYQHKPSDIIPMYEKMKSENADAVFGIR
4239 :     KYKHIPFHRQFSNFLASVIMSITVSVFSGNFHIFRDIQCGFRIIKSEFLKNSYFGDGYSV
4240 :     EHLIALQLAKKNAKITEEYVTIDYHNDAISYITTKKILDVVKEVAKYVLSKH
4241 :     >45358154 hypothetical protein MMP0591 [Methanococcus maripaludis S2]
4242 :     MKKIHYLFFLSLLLIPAINAAELAPDAVMVNDSVYLVFDWTAPENIENLSLSIDADDNII
4243 :     FEEYEYNVSEVSANESIFKMFKGTATEIGNYKIKLLKRYFQNGTLIGSVEFFELSVVPDA
4244 :     GVRIVEKVVTPENYEPVKILETENDTKEEISNTSAENSTVISLEDKDVNTSEITDKNTTS
4245 :     TEALAENNKSLIGPGGIYYILGGLILGILLGAIIAYAKE
4246 :     >45358155 hypothetical protein MMP0592 [Methanococcus maripaludis S2]
4247 :     MNLDPGVLTVLVLISIVLNIFLFMKLVVLKGELEGIKQSTRLTNDEVNKLNERLKNIKLR
4248 :     >45358156 walker type ATPase [Methanococcus maripaludis S2]
4249 :     MAITIAVASGKGGTGKTTTCANLAVALSQFGKDVTVIDADIAMANLELIMGIEGKPITLN
4250 :     DVLSGNADIKSAIYEGPAGVKVVPAGVSLDSFKKARPERLLEVLSKLDEQSEVLLIDCPA
4251 :     GIGKEALTAISAAEHLLVVVNPEISSISDALKVVSIANRVETNVLGAIINRVTEDSSELS
4252 :     SRSIETILEIPIVGIVPEDTNVRRSSAFGVPIVLKHSDSPAAQSIMELGAKLVGKQYIPK
4253 :     EKTKDSFVKKFFKGIFGGKKK
4254 :     >45358157 hypothetical protein MMP0594 [Methanococcus maripaludis S2]
4255 :     MIGVSKMYSEIIDLLGIEDFKIVNPYNSDCNCEYILISKGYFDKVRKLNPDSKIIEINSA
4256 :     TFLDLIESLEKLKTENIGNIDIINQSIENLKKLDFKIKKDNFEFVKNFECNIDSDSKFIK
4257 :     KILDDLGFEHKNGSTIKIIPDYKLKEDLDLNDIIILKTHRYDLKLVERIENRYMSILNSL
4258 :     NNIILGKT
4259 :     >45358158 hypothetical protein MMP0595 [Methanococcus maripaludis S2]
4260 :     MLDFNIEGLIPKNMEKRGELVLNEYLKEIEDVFNHRKIPENGIDDEKIKLFLKFLSMMDT
4261 :     DKDPKSVRIGEREARTYSKIHEELSSGFCHGIGRSGNLVDPQPKASGASIMYALTNKILE
4262 :     SFFKQLGLNVHAIATPISTGMSISLCLSAARKKYGSNVVIYPYASHKSPIKAVSFVGMNM
4263 :     RLVETVLDGDRVYVPVEDIENAIKKEIELGNRPCVLSTLTFFPPRNSDDIVEIAKICENY
4264 :     DIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGGLVYSTDAEFIKEI
4265 :     SLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKTGGKFLDV
4266 :     ESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDYIVMNAAIGVR
4267 :     TEDIVNSVSKLEKILL
4268 :     >45358159 RNA 2'-O-methyl modification protein (NOP5/NOP56) [Methanococcus maripaludis S2]
4269 :     MLFIAFAPFGAFALEANSKNDGYSLDDIKYYKIFENEDIPKIMYALRQGDFEIIAELKNE
4270 :     WEIEEEDVSFEYTTSKNPLGELIRDNLYELGQKYEVFEDESDFVSKMNVWATAFTKSMMK
4271 :     KSSEQKDKLIVQTVNALDNLDETLNLFSERLREWYSLYFPEMDNIVKKHDIYVSLVSEYG
4272 :     DREEYTRTKLKKTMPSNVARTISLAAKESMGADVSEFDLKIMKNLADEIKSMYEYRESLQ
4273 :     EYLETSMNEIAPNLTKVAGASLGARLISLAGGIERLLRLPASTIQVIGAEKALFAHLRER
4274 :     ALPPKHGVIFQHPLIQGSPWWIHGKIARAISCKISIAIRADAFGNDISDMLIEDMNKKVA
4275 :     EIKEKFPEPTRKRRPRPDTRSFGNKGGQDRDRRSQGDRKPSGNRGDSKKGGKPFGKKPAG
4276 :     KDDRRDNRKGDRKPFGGKPKNSGNQPPKERSGEKRRDSTKKVKAERKVIGKTSSQN
4277 :     >45358160 fibrillarin [Methanococcus maripaludis S2]
4278 :     MEKIRVKEIFDNVYSVDFGDGLKRIATKSLVPGKRVYGEKLVYSDSIEYRIWNPNKSKLG
4279 :     AAIINGLKKMPIKKGEKVLYLGASAGTTPSHVADIAENSLVYALEFAPRIMREFIDSCNE
4280 :     RKNLIPVLGDANRPQDYSNIVEKVDVIFEDVAQPNQAEILVKNAKWFLKENGYAMISIKA
4281 :     RSVDVTKNPREIFAEQKKILIEGGFEIVDEVNIEPFEKDHMMMVGIWKGN
4282 :     >45358161 phosphoglycerate mutase-related [Methanococcus maripaludis S2]
4283 :     MKTIVLDFDGLLDDPYEILDNKTPLEYAKTPNFDKLVQKGSCGLLSPYKKGVPTYSVMDL
4284 :     FLMLGYSRDEFPGISVLRALGEDLELNDNAVYIECTFVSTIEDNYGHRVIDRASCDVTDK
4285 :     ELNQLMALIPTNFEGYEFNLKACADYGCVLTMTDKNGWISDKISDSDPYYPGRHINKISP
4286 :     VYELCDSPGECKRAKSTAEALNKFLLRCHKILENHEINIKRKRKGKYPINFLITRFPGKN
4287 :     IDISTFYEKYGLKALSISNCRLAKGFSRFVKVDYLLTKDLSESVNSSIKYLDNYDLIYVK
4288 :     CCRISEGQIKDPVEKAAVIEEMDACLDKLTDLEDVLIVITSKKLSKMMGAFVNSGNEYSL
4289 :     IVSGKNVRKDDISEFTEKNCYIGPLRIEHNEILNLILNYMDKALLYGLRPGGYLLDYIPD
4290 :     DEDIEHLK
4291 :     >45358162 precorrin-6x reductase CbiJ/CobK [Methanococcus maripaludis S2]
4292 :     MNIWIRGGTSDANTISKEIKRNFKDSFLILTTTTDFGGKIAENFADFVISEKMNYDNLKK
4293 :     TLVNKKIDVFIDATHPFATHASETGMKISKELNIPYIRYERPVEEFKDVFYVENFEEAAK
4294 :     LALKISKKNIFYMSGIKNLKTVSEIIPIEKLIVRILPTSVPEALKILPSKNIVAMQGVFS
4295 :     ENLNKDLITDYNCDVIITKDSGKSGGLYEKVSGAVLAGAKPIIIKRPEINYPLKFEKIDE
4296 :     LVNYLKNV
4297 :     >45358163 hypothetical protein MMP0600 [Methanococcus maripaludis S2]
4298 :     MAKFSKGQISIELILLMTAVLLAGILVSVNMTRFTFEGDILSDVREDAFQVFEISTDTPI
4299 :     IVYSLNFSNVKISPSTNLYNAWLQINDTGNDTYLWYYSDGTFKGLANTSDPDESITEENL
4300 :     VLLPHEGYASDIIFRSNVPTAMSWDSYEIDFNDIKKFEIIANDVENNPISYSLTHGDSPE
4301 :     TSNQAYLNIKANEVTIIVTKANDKVFEVIANTTSGTIELLPYTETSP
4302 :     >45358164 hypothetical protein MMP0601 [Methanococcus maripaludis S2]
4303 :     MLLNSKRGQVSIEMLILILAVLLSGTIFAAHMTKNTVSHDEISDVKKQTFKSFLGSVEGS
4304 :     TASSLPEKISEEDTSPEEDTIPEEDTSPEEDTIPEEDTIPEEDTSTEIPIGKNVKIYNLP
4305 :     IKEEKQNWFLDILNTALDRISAILDGFFSLFGLDLFNNDEIIPNILVKDFEGNRIPLSFD
4306 :     WERLSYTTDWFYAKEIEFTGDSSAKYSKLDLFRIFPIYSYSDTTFRITDLSYNLTYDVPP
4307 :     STAKKTITITSNIPEGIKCKVTYKIGGILTGDYYTLEIDEKTSSNKYNNVNIAFE
4308 :     >45358165 orotidine-5'-phosphate decarboxylase [Methanococcus maripaludis S2]
4309 :     MYGESLVKLMLALDVMDEKKAILIAKETSEYVDSIKIGYPLVLAT