[Bio] / FigKernelPackages / Tpn_Int_Reps.pm Repository:
ViewVC logotype

View of /FigKernelPackages/Tpn_Int_Reps.pm

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.2 - (download) (as text) (annotate)
Thu Sep 18 16:27:47 2014 UTC (5 years, 6 months ago) by olson
Branch: MAIN
CVS Tags: HEAD
Changes since 1.1: +3 -0 lines
add sas tag

#
#   Tpn_Int_Reps
#

# This is a SAS Component

package Tpn_Int_Reps;
use strict;
use gjoseqlib;

# This perl module contains a collection of representative genes 
# annotated as "Transposase" and "Integrase" from the core-seed.  
#
our %Tpn_Data;


# %Tpn_Data will have the following structure and will be passed back to the user.
# $Tpn_Data{"tpns"} => @seqs ( gjo tuple )
#

#-------------------------------------------------------------
#             Transposase and Integrase Reps
#-------------------------------------------------------------

my  $tpn_reps = <<"End_of_Tpns";
>1001989.3:AFAT01000174_42154_42921__465_19
LKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGER
TMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLAR
LGRKSLSFSKSVELHDKVIGHYLNIKHYQ
>1005558.3:AMUG01000161_105726_104961__461_18
KKLAPKRITSSPVAHADVALICELDEQWSYVGSKARQHWLWYAYNTKTGGVLAYTFGPRT
DETCRELLALLTPFNIGMLTSDDWGSYGWVVPKDKHLTGKIFTQRIERNNLTLRTRIKRL
ARKTICFSRSVEIHEKVIGAFIEKHMFY
>1027360.4:AFJI01000034_9082_9845__438_19
AQHVEPGAEVVICCEADEQWSFVRCKSNPRWLFYAYDRIQKRVLAHVFGPRNALTLQRLL
ALVRKFNIVFYMTDAWPVYRTLLDPAHHVVSKKYTQRIGRHNLNLRTHLKRLTRRTICFS
NSEEMHDKVIGWYLTINHYH
>1038927.6:NODE_781_length_20285_cov_14.124624_17502_18269__465_19
LKKLRPQSVTSHIQPGSDVIVCAEMDEHWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGER
TLATLERLLSLMSAFEVVVWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLAR
LGRKLLPFSKSVELHDKVIGHYLNIKHYQ
>1046625.3:AFQY01000006_5639_6426__729_31
MQITLEIKCPTCLSDSIKKNGIKVDGKQNYQCKDCKRQFIGDHALSYLGCNSGITRKILQ
LMVRGSGIRDIAEVERISIGKVLRTLTESAYQIQPKQSHYESLEVDEFWTFVGNKNNKQW
LIYAYHRETGEIVAYVWGKRDLATVQRLKTKLKQLGIHYTRIASDHWDSFITAFKNCKQS
IGKLFTVGIEGNNCKIRHRIRRGFRRSCNFSKKLENHFKAFDLTFFYINNGFI
>1048265.3:AFRL01000019_79714_74642__4376_4915
PSCSATDGVVRNGKSTAGHQRYLCSHCRKNMATAVHLHRFSTRYAPENH*YGHEWRWMPG
NSPHYGRWPQPRFFRHLKNSGRSR*TSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLFYA
YDRLRKTVDAHVFR*THYGDAGASL*ACCHPLTW*YG*RMAGRCMNPRLKGKLHVISKRY
>1076135.3:AGVO01000006_28087_27334__449_21
KTRPKAVTSEKVVLDDVALICELDDQWAYVGNKNNRHWRWDTKRKRVVAYTFGPRNDEKC
RKLLSLLAPFQFGFITSDNWDSYAREVPCKIHLTGKIFTQRIERNNLTLRTRLKRLARKT
ICFSGSVELHDKVIGAFIDNHHF
>1084226.3:AGJS01000011_2468_1682__475_32
KKLSPQRVTTLPLDNLQIQLICEVDEMWSFVGNKKQQRWLWYAWESRLKRIIAHVFGRRS
KKTFRQLLGLLSGFNIVFWCTDNFSAYEMLPDEKHIRSKLYTQRIERENLNIRNRLKRLN
RKTLGDSKSAEMHDRIIGTFIEREHYLV
>1121377.3:ARLS01000046_18078_17332__424_17
EELMVELDELWTFVGQKKQPRWLWIARERRTQKVLACVLGDRSEATAFQL*DRLPLSPEQ
RLKGTCCTDLWRAYDEPLLGIKRLTLRGETNPVERLNCTLRQRLGRLVRNSLSFSTSDEL
LKASLTLAFHRYNLSR
>1148.1:NC_000911_1385747_1386548__418_44
FSSGQKNKLWLWKAYDRVTGRLIDWELGNRDSQTLSRLLERLAKWKVTVSCTDDWRPYQQ
LLDEHPDAFHGISKRETVGIERNNSDNRHWLARFHRPTKVISRSAHMVNITMAIFAKFRV
NGNIE
>1217675.3:APPI01000007_39221_38472__692_12
IQITLEIKCPTCLSDSIKKNGLKLYGKQKYQCKNCKRQFISDYALSH*GCHSGITNKILH
LMVRGSGVRHIAGIE*IHLSNSS*AKIL*MS*S**VLDFCRD*ENK*LLIYAYHRETGEI
VT*FWDKEI*LQSND*RKSGSS*VFIIPEFQVINRIVLSLHLKIVRKVLVSFFTVGIEGN
NCKIRHQIRCCFRRSCNFQKSLKTTLKLST*PYFISIMASFNLSILF
>1235808.3:AOCI01000067_16111_15278__419_27
WLWTAVDHFKTGILGWVLGDHSAKTFADLWKVVGQWKCHFYVTDGWKVYPNFIPDGDQII
SKTYMTRVEGENTRLRHYLARLHRKTLCYSKSEQMLRHSIRLLIHYLKFEDVPVPYSNNR
SYFPLNARHFA
>192952.1:NC_003901_3222192_3222931__690_322
MDCPRCNSSTHKKNGIVDGRQRYKCHDCGYNYSVELKSTASPTSVKRQALQLYLEGLGFR
SIGRFLGVSHVSVQKWIKKFGRELEDLKSENEISIVEMDEMHTYIGNKKNIAGYGLLLIE
LGK
>196600.1:NC_005139_540916_540130__470_27
KKLSPRQVTSIPFDKANISLICEVDEQWSFVGKKKNRRWLWYAWEPRYKRIIAHAFGKRN
TDALRSLLTLLKPFDISFFFTDDFSVYAKELPKEKHVVGKRFTQRIERTNLTLRSRLKRL
VRRTIGFSRSEEMHDKVIGTFIEREFYF
>252305.3:ObatHTCC2597.contigs_11_393226_390629__1574_615
MSYVICEFKLTDMLDYSMDSTYIVSMNKLDTKTRSLIIRLLVEGNSIRATSRIADVSKNT
VNKLLIDVGKVCHSYHDGNVRDVKASVIQCDEIWSFTYAKQKNVAAAKAAPDGAGDTWTW
TALDSDSKLIVSYMVGGRDSEYAIGFMDDLCSRLANRVQLTTDGHKAYLEAVEGAFGGDV
DYAQLIKLYGEPTGQKGHERKYFPSECTGTKKRAVEGRPDMAKVSTSHVERQNLTMRMHM
RRFTRLTNGFSKKVENHAYAVALHFMYYNFCRQHQTLCVSPAMAAGLTDRLWDIADLVAL
VDAAEPAPKKRGPYKKRAVN
>278957.5:NZ_ABEA02000003_13860_9807__2755_1949
MNRLAHSKRVQMLSCLVDGCSMEATARIVHVAPNTVAKFLVDLGKACTRYQARVFENIFC
KRIQCDEIWSFVGCKEKNVTNNGKRQGDTWTWIACDPDTKLVPCWFIGRRDSESAKKFMR
RLARHLSLGSTQITTDGLKAYINAIKEILWIETSYGMVEKKYDVSGDDHRTRYIGSEKTA
IFGNPDPDTMNTSIVERQNLTMRMSMRRFTRKTNGYSKKIANHRYAIALHFMYYNFARIH
STLNTTPAVAAGIANHVWSLDKILKLIER
>313612.3:NZ_AAVU01000021_102644_103624__462_28
KKKRGKLTIQADEMWSFVGNKKQKQWLWLAVDRNTKEIVGFDLGDCSEEGAKGLWRSLPK
VYRQCAVCYTDFWSAYEHIFPNKRHKSVGKETGLTNHIERLNNTLRQRVSRLVRKTLSFS
KKLENHIDAIWNFIHYYNSAIASQF
>313612.3:NZ_AAVU01000021_102644_103624__752_342
MNNSALTCPQCQSQKIVKNGSIHNKKPKYKCTECGRQFVEHPRKIYISEDTKNLIEKLLL
EKISLAGIARVTGVSRKWLQDYINAKYKEVSREINVSKKNEES*PFKPMKCGHLSGTKNR
SNGCGWL*IETPRKLLV
>314253.3:NitroNb311A.contigs_15_31129_34708__1769_738
MIRPMNRLDRKTRAQILHLLCEGQSIRAVTRLTGCSKNTVAKLLVEAGHACAAYQDKALR
NLSCKRVQMDEIWSFVYAKNANVKDAKAAPATAGDVWTWTAIDADSKLIVSWLLGARDMD
AALAFTADLRSRLSNRVQLTSDGHRPYLTAVDAVFGDDVDYAMLVKLYGADPQAEVRYSP
AKCIGAEKKPKIGSPDQKHISTSYVERSNLTMRMHMRRFTRLTNAFSKKVENHAAAIALH
TMYYNFVRIHQTLKVTPAMAAGVTDKLWEMEDLVAVLEQWELANFKPEYQFVVRRYAIGK
GHSVSVLWRGGEVDTIFGFDKEADALEWIRDKSRAWLLERPVRA
>376219.3:NZ_ADDH01000002_93391_95930__2499_2107
MDCPYCQSHKVVKNGHRHGKQSYLCRECGRQFR*NPCPGGYSSDVKELCVKISLNGMGFR
AIERVTGISHNTILNWVRVAETHIDEENYEIPEIAQIDELQTFVGSKKTIWVWTVVNTKL
PGILKFVIGDR
>391612.3:NZ_AAXW01000016_82658_83620__897_34
VKRVIKSGIIIYSLDRIFNNSAKKLIMDNDYSLTSRPPCPSCGSRQILKNGSTHHKKQKF
LCKECGRQFIEKPQKKQITLKEKKRVKKLLLERISLRGITRSLEISMTWLQKFVNSLYRS
VPLELKVRETSDLEIEVECDELWSYVNSKENPVYIWLAISKRSASRCARKTRRIVGFYLG
DRSRLSAREFWKTLPKTYQDNGKFYTDLWESYCDVLLSGAAALAERDRHYPSTKKSGETT
RIERLNNTLRHRCSRLVRKNLAFSKNFFNHEGAILYFIHHYNEEILST
>448385.11:NC_010162_2484536_2479936__4367_3321
MSLLSAEARARVVSQLVEGCSIASTCRLTGVSKPTVLALLLRIGAGCERLHNRIVRGVTC
HVAQCDEIWSYVQKKQSRVTASDPAEYGDAYTFVGMASASKLIISYRVGKRDEENTRAFV
KDLRARLTTIPQLYTDGWQPYIGAVGASFTGGVDYCQVVKNYSRRPRRDDEVRYEPPRDP
FITKTPIFGIPDVEHASTSHVERQNWTIRMHIRRFTRLCNGFSRKLANHRAAVALHVAWY
NLARIHESIRCTPAMEAGIARHVWSIPELVEAALAEPETEPPTPEPLKLRTPPAGTPTTP
ARALPNGRGFLRLVGAAPAAPVAPTPPEGPEPPPAPAPRRMVQLNLFNE
>6666666.5365:husec41_c66_305_1069__460_20
KKLSPRRITSSPVAHADVALICKLSQQWSFVGSKARQHWLWYVYNTKTGGVLAYTFGPRT
DETCRELRALLTLLPSAC*PLTNGVVTLESYRRRSI*LVRFLLSTLSVTI*P*EPESKRL
ARRTICFSRSVELHEKVIGAFIENICS
>7955.3:chromosome:ZFISH4:6:4868028:5864701:1_304733_305500__465_19
LKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGER
TMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLAR
LGRKSLSFSKSVELHDKVIGHYLNIKHYQ
>869676.4:AEZP01000090_11304_10549__453_19
LKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVAPALAVLRVWQSPEDGCCARIR*THYGD
AGASYEPAVTL*RGDMDDGWLAAV*IPLKGKLHVISKRYTQRIERHNLNLRQHLARLGRK
SLSFSKSVELHDKVIGHYLNIKHYQ
>1028802.3:AFQN01000020_734_1445__434_24
KTSRGAAGKVAVFGLLKRQGKVFAVVVENTKTGTLMPVIVRKIKPDSWVYTDTYRLYDAL
DVSKFHHERINHSELFAVKQNHINGIKNFWSQAKRILRKYNGIDRKNFPLFLKECEFRFN
FGAPKEQLKILRKWCGI
>1030841.3:AGAZ01000040_34565_35301__698_24
MKITHCKLKKSLQRKLLEYFVLEVTARSAADILAIQPNTAILFYRKIRLVISHHLALKAD
QVFESAIELDENYFGGKRTGKRGRGAAGKVVAFGILKRGGKVYTVLVNNAQRESLFPFPV
ITRKITPDSVVYTDCLSSYDVLDVSGFHHHRINHSKKFADRQNHINGIENFWNQAKRVLR
EYNGINRKSFPLFLSFPLFLKECEFRFNFGTPKQQLKTLRLWCDI
>1055328.3:AGRQ01000285_1_745__699_58
MKLKNKYQKFSKISEQKFREIIRCFALDLTASDTAKMTGISVRGINPIFLKIRHRIAALC
EQSSPLSGVVELDESYFGARRIRGKRGRGASGKTIVFGILKRNGVVYTEIVPDASKASLI
KVIRGHISADSEINTDGWKAYDGLVDMGYEKHYRVHHGSNEFARGKQHINGIESFWSYTK
GRLAKFHGISKEMFYLHLKETEFRFNHRHEDLGK
>1122243.3:ARBT01000009_11157_10446__582_103
DLLSVQYNSSALFYHKILTFIEYHLNQDAKERFDGKIELDESYFGGVRKGKRGRGAGGKT
AVFGLLKRNGNVYTVAVKDTKTNTLIPIIASKIKPDSVVYTDSYRSYNALDVSDFKHFRI
NHSKEFAQNHNHGVALKTAGRKPSVF*ENIMVLTRKTFIF
>1004153.3:AFET01000001_2186705_2185247__1228_35
MTESSDYESVQVFIGVDVGKDTHHAVAINRSGKRLFDKALPNDENKLRSLISDLKQHGQI
LLVVDQPATIGALPVAVARSEGVLVGYLPGLAMRRIADLHAGEAKTDARDAAIIAEAART
LPHALRTLKLADEQIAELSMLCGFDDDLAAQTTQASNRIRGLLTQIHPALERVLGPRLDH
PAVLDLLQRYPSPEKLASLGEKKLAAQLCKLAPRLGKRLAADIAQALAEQTVVVPGTNAA
AVVLPRLALQLITLRKQRDEVALAVEQRVLAHPLYPVLTSMPGVGVRTAARLLTEVACRA
FASVAHLAAYAGLAPVTRRSGSSIRGEHPSRRGNKALKRALFLSAFAALRDPLSRAYYTR
KMSQGKRHNQALIALARRRCDVLFAMMHDETFYTPQAS
>101510.15:NC_008271_121156_119718__1200_28
MDSNYAVYCGIDVGKGEHHAVGLTAAGKKIYDKALPNDEAKLRASHGSVLVVVDQPNTIG
ALPVTVARACSHEVGYLPGLAMRRIADLYPGQAKTDARDAFIIADTARTMPHTLRRVDTG
DEALAELEVLIGFDDDLAGEATRVSNRIRGLLTGIHPALERVLGPRIAHPAVLEILSRCG
GPAGIRKAGKRKLTAIAVKHAPRMGTRLVGEILAALEEQTVIVPGSTAAETILPKLADTL
KETLQQRKSVAEDVEGALDDHPLSRVLTSMPGIGFRTAARILIEVGDGSAFASAAHLAAY
AGIAPVTRKSGSSIRGEHPARSGNKKLKRALFLSAFSALHDPTSRAYYDKKRAEKKKHNA
ALICLARRRCDVLYAMLKNKELYRAPLPSAA
>1038844.18:TY-2482_chromosome_5083171_5084595__1187_210
MEHELHYIGIDTAKEKLDVDVLRPDGRHRTKKFANTTKGHDELVSWLKGHKIDHAHICIE
ATGTYMEPVAECLYDAGYIVSVINPALGKAFAQSEGLRNKTDTVDARMLAEFCRQKRPAA
WEAPHPLERALRALVVRHQALTDMHTQELNRTETAREVQRPSIDAHLLWLEAELKRLEKQ
IKDLTDDDPDMKHRRKLLESIPGIGEKTSAVLLAYIGLKDRFAHARQFAAFAGLTPRRYE
SGSSVRGASRMSKAGHVSLRRALYMPAMVATSKTEWGRAFRDRLAANGKKGKVILGAMMR
KLAQVAYGVLKSGVPFDASRHNPVAA
>1051347.3:AOET01000161_46762_48088__1260_259
MENIALIGIDLGKNSFHIHCQDRRGKAVYRKKFTRPKLIEFLATCPATTIAMEACGGSHF
MARKLEELGHSPKLISPQFVRPFVKSNKNDFVDAEAICEAASRPSMRFVQPRTESQQAMR
ALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISRLSTILEDNSLPLYLSQLLLK
LQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCVGTLTASTISTEIGDGKQYASSR
DFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLLVQCARVFIQKLEHQSGKLADWVRD
LLCRKSNFVVTCALANKLARIAWALTARQQTYVA
>1055539.3:AOUP01000685_2062_3420__1288_293
MQNITLIGIDLGKHSFHIHCQDKSGKALLRKKFTRTKLMQFLATCPPSVVVMEACAGAHF
MARRISDFGHETKLISPQFVRPFVKSNKNDFVDAEAICEAASRPSMRFVQPRTEPLQAMR
ALHRVRESLIRDKVKTTNQIHGFLLEFGISLPTGDAVIKRLSLVLAEHEIPEYLSRLLVR
LHTHYLYLVEQIAELESELSQSINADDTAQRIMTIPGVGPITASLLSSQPGDGKQFSCSR
DFAASTGLVPRQYSTGGKSTLLGISKRGDKNLRRLLVQCARSFMMRLERQHGKLAEWVRE
QLNKKHSNVVACALANKLARIAWVITTQQKEY
>1069618.3:ALXW01000015_214631_215737__1096_137
MRNAVGLDISKLTFDAFAMVGNAEYSAKFDNNSKGLNQFSDWLKSLGCENLHICMEATGN
YYEDVADYFAQYYSVYVVNPLKISKYAESRFKRTKTDKQDAKLIAEYCRSAQESELVKRQ
KPTDEQYRLSRMTAAYTQIKSECAAMKNRYQVAKDEEAAKAYAEIIKAMNEQLEVLKAKI
KEQTEKPKCKEGVKCLETIPGIGRMTAAVLFHHLTSSKFETSNKFAAFAGLSPQQKESGT
SVRGKGKLTKFGNRKLRAVLFMPAMVAYRIRAFPDFIARLEAKKKPKKVIIAALMRKLAV
IAYHVHKKGEHYDPSRYKSA
>1147786.5:AJFM01000076_11_1354__1062_253
GHRVQLIAAQHVKAYVTGNKNDFIDAEAICEAASRPRTRSVPVKTLEQQILSTEHKLRKS
WVDNRTGIINQVHGFLLEFGIIFPVGYAALEQVPALMENHELPIRLRNAVERMLLDIQRL
TRDIKTIDVEIKQQLSEDAAGMRLLSIPGIGPLTASALLADVGDASTYKSSRDFAASLGL
VPRQYSTGGKTSLLGISKRGDKYLRCLLVQGAHALMIRIDKRNDALGAWVRKLLARKPQN
KVACALANKMARIVWAVLARGGSYNVQQTA
>1227924.3:APBQ01000076_29285_27849__1311_256
VELCTTICVDLAKQVFQLAGEDATGRVIYEDRIKSRQTFHDFLLKLPTTVAVLMECGPGA
QAWARLLQAKGNPVRILPAQRVAEHRSGAKNDRNDCYAILRAGRDTSIASIPIKSTTALA
IQALHRIRRGNIKRHTALGNQIRGLLLEHGVSMPQGDAAINKHVPQALEDASLPLPDLLR
ELLDELLMDWLSLGERIAVLSRRLEATAQEDKVAQRLITIRGVGPIIATAIVAKQTEPSR
FASGRMYSAFFGIVPDQHSSGNKIRLCKMSKRGDGYIRSLLIQGAHAVLSQLRPDSDQPD
DRRLLRWLSRLGRKEAAIRLANRNLRIIWALLQSDQVYQRKPNEKPEAAMSL
>1231390.3:AMZG01000029_3522_4881__1287_265
MSDLALVGIDLGKHTFHLHGQDKYGRELFRKKLSRQQMMRFFANLSACTVVMEACAGAHF
VARELTAMGHQAKLISPQFVKPFVKGNKNDFVDAEAICEAASRPSMRFVSPKTEAQQTLS
VLHRLRESLVGERTKAVNQMHGFLLEFGVSLPQGLAMMKRLASVLAEHELPVRLTVLLQR
LHDHFV*LDEQIKALDKELVCQLADDDLGRRLLGIPCVGPITASLLAVEMGDGQQYGCSR
DFAASVGLVPRQYSTGGKANLMGISKRGDKNLRRLLVQCSRVYMQRLEHQKGPLADWVRS
LLTRRHSNVVACALANKLARIAWAIAANHTEYEAGPSTIAA
>1234597.4:AOGE01000017_18429_17114__1181_267
ILSRKVSRSKLAETVNALAPKTIAMEACASAHHWGRQFKDNGREVLLINPRFVKPFVRGS
KNDAVDAAAIYEAATRPTMRFVPVKSITQQDVQSLHRVRERMIIQRTSLINHARGLLAEY
GIVLPQGAWRFVSQAPAAVESADLSDLGRELFLELLDQLTDVNDRIAKIDRKISEICRDR
EDCRRLSELPGVGPIIATALVASVEDGRHFKSGRELAAWIGLVPRQYSTGGKPRLGGIGR
RANHYLRRQMIHGARAVISRLASHDDRRSQWLKELVSRRGYNKAIVALANKTARIAWALL
TRQER
>164546.7:NC_010530_783348_785262__1343_321
MNTTTYGLDIAKGVFQLYWVEPSGECFNRRFTRKALLNFLAKRAPGRVALEACGSAHWWA
RQLAALGHKPVLLHAAFVRPFVQTNKTDVADAKAIWTAVHQPGMRQVARKTETQQAILAL
HGFRALRVKMRTMLINQLRGVLFEFGIHFRRGRRAGLEEIKQHMAELEQQLPRVLFDSVA
EQLQDIARLDEEIGQIEIRLNTWLKEDHDCQTVAAIPGIGPLTATALVATIGDVHAFRSG
RQLAAFLGLVPRQRGTGGKVNLGGISKRGDTYLRTLLIHGARIVLSHLRRKGQSHWSTAL
VQRRPANVVGVAMANKMARTAWALLAHNRTYDRDYVSVKLA
>167879.3:NC_003910_379676_378330__1275_250
MNKVNTIGVDLAKNVIQVSVLSPLNKELTNKELPRTKFAEFLAKQPISLVAFEACSTAHH
WARLARSYGHRVKILPAKVVSSFRQGHKTDKNDALAVAEAANRPNVKEAPLKELEQQGMQ
SIQRSRELLVQNKTCLSNHIRGLLMEFGVFIPKGFASLFKNIPDILEDGENDIPDMFRAT
LNLMYQRLLDLRDDVGLLDEQVKQLVKNNEACSNLTKMEGVGPISAILLFSTLGTGDAFK
NGREFSAYIGLTPKQHSSGGKASLMGISKFVANKRLRSVLIQGARSYVHRMKSVTTKKDE
WLVKLIERAGYGKAAVALANKNVRTAWALLTQGTEYRKELIA
>205922.3:NC_007492_4316353_4317694__1262_243
MDTLNLLGLDIGKSTFHLVGHDVKGKEVLRKKFNRNRLLEFAARLKPCTIAMESCGGSHW
LARKLLSFGHQVKLIAPQHVKPYVTGNKNDYIDAEAICEAASRPKTRYVAIKTVEQQVLS
TQHRLREALVGHRTQTINRIHGFLLEFGIELPATKAAMNQVHQILDDPAAELPQQLKSFI
EHLLEEMKRLNDEIKAIDRSIKEQVDTDDAGTRLMSIPGIGPIIASALLADVGDASNFHS
SRDFAASLGLVPRQYSTGDQTVLLNISKRGDKYLRKLMIQGSRAVLVHIDKRTDALGTWC
RDLLIRKHPNKVACALANKLARIVWAVLARGGSYNAQSMA
>216591.1:Bcep1160b05.p1ca_160119_161543__1299_283
MNSMAVGVDVAKQVFQVHYVDRETGGIVNKAIKRAKFLEFFANRAACLIGMEACGGAHHW
ARQLTQMGHEVRLMPAEFVKAFNIRNKNDAADARAIWLAVQQPGKPVAVKTEMQQAMVAL
HRMREQLVKFRTMQVNGLRGLLTEYGEVMSKGRAKLDKEIPAVLGRIAERLPAALIDTLR
EQWNGLAKLDEQIAEIERRMREWKKEDKAVKAISEIPGVGLLTATAAVAMMGDPKAFSSG
REFAAWAGLVPKQTGSGGKVNLHGISKRGDMYLRTLLIHGARSVLTHAKEPGEWIEQMKK
RRPPNVVIVALANKMARTIWAVLAHDRPYQKGYVSVKPA
>223926.1:NC_004605_1326381_1327698__1250_237
MSAIKVIGIDLGKSTFHLVGHDYSGREQYRHKLSRSKLLQFISVHEPTLIAMEACCGAHW
LARKCQEYGHQVKLIPPQYVKPYVKAHKNDFIDAAAIAEASTRPNMRFVSPKSEQAQVGV
VIRRVRTGYIRERTATMNRIGSMLIEFGISFPRGHANMKKLFQWLADNKEPIPPLLVREL
QNQLDYYNQLNERIKEQDRKIEKLSSEDELYTLLQTIPGVGPMTASCCLSCVGKPSDFSN
GRNFAAWIGLVPFQYSTGGKQRMLGISKRGNKKLRELFVHAARAVMWREETAERYFGSWL
LDLKRRKPFNVALVALANKLARIAWSVMTSHKPFELRV
>262724.1:NC_005835_1136672_1135478__1001_51
MTFAGIDVSKPHLDLALVSNSPKPTRLRFPNTPEGRKALLAALAHLRPAWVALEPTGAYH
LPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRHDALLLARYAQVYHGELRAYTLP
PEALRELKALVGYREDLAGRERAILNQMEAVEWAGSGEVLALLQKELACVKGLLGEVEAR
IQALLATLPEAEALMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLTPEREESGKRV
ERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRM
MGRLREYYATQLDQGVA
>360116.4:NZ_AAUP02000007_32513_33886__1292_276
MKDIKILGVDIAKDVFQLCGIDEWGKVIYTRRVKRAQYVSTVASLKVGCVVMEACGGANH
WYRTFMGMGISTQLISPQHVKPYVKSNKNDRNDAQAIAEAASRASMRFVRGKTVEQQDVQ
ALLKIRDRLVKSRTALINEIRGLLQEYGLTMARGAKRFYEELPLILASEAVGLTPRMKRV
LNCLYTELLNRDEAIGDYEEELKAVAKANEDCQRVQSIPGVGYLTALSVYASVGDIHQFH
RSRQLSAFIGLVPRQHSRGNKEVLLGISKRGNLMLRTLLIHGARALLRHVKNKTDKKSLW
LKALIERRGMNRACVALANKNARIIWALLTRQETYRCGA
>426117.3:NC_010511_6139214_6137985__1050_49
MGEVSTVGIDLAKSVFQVHGSDPSGTVVFRKKLRRAQVLAFFSTLPRCVVAMEACASAHY
WAREIALAGHDTRLIPPAYVKPFVKRQKNDMADAEAICEAAQRPTMRFVQGKTAQAQACA
VVFRTRDLLVRQRTQLINALRGHLTEFGYVVRQGVGHVGQLVAVIRDQTSDVPAQARPVL
AVIADTLQALQAQIALLDREIAQRAKDDAVAKRLMTIPGVGPVIAAALVALAPAASTFRR
GRNFAAWLGLVPRQHSSGGKERLGRTTKMGERSLRRLLILGASSATKVAARDPDKAGAWL
AGMLLRKPRMLVTVALANKMARIVWALMAHGGCY
>460265.11:NC_011892_344144_345571__1285_266
MGEYIGLDVSLKETALSVRRDGKRVWRGRCASDPAVIARVLRKHAPEAQRIVFETGPLSV
WFYHALRAEGLPAICIDARHAKAALDMAANKTDANDADGLAHLAEVGFFREVRVKGYDSL
LVRTLVAARSKLVQVTTELSNQIRGLMKTFGLIVPGAKGGSFEAEVRRLLSGDHGLARVI
LPLLEAWNAVRRRAAELGRQLLAGARQSQACQRLMAIPGIGAITATAFVTAIEDPANFRS
SRSVAAWFGLTTRRYQSGEVDYDGHISRRGDAHMRGLLYEAATVLLTRSQVDSDLRAWGL
KLRERLGFKRAAVAVARKLAVVMHAMLKSGHSYRAKAAMA
>553481.3:NZ_ACFI01000030_21468_19997__1249_47
MAEPDRVWVGIDVGKSTHHACAIDDTGKVVWSKKIPNEQAAIEDLIAQGGRIANHVVWAI
DLTSPPAALLIAVLLSAKAEVVYVPGRTVNTMSHAFRGEGKTDAKDARVIAETARHRRDL
SPVVPGEDLVAELRSLTAYRSDLMADWVRGVNRLRSMLTAIFPALEAAFDYSTRAPLILV
SAMCTPGEIRSAKRAGVIKHLRKNRAWPNNIDTIADKALAAAAGQIITLPGEAGTAALIK
QLAARLLDLDRQIKDIDKQITNKFREHPSAAIIESMPGMGPHLGAEFLVITGGNMAAFTN
PGRLASFAGLVPVPRDSGRITGNLHRPKRYNRRLRRVFYLAALSSLKIEGPSRAFYDRKR
SENHIHTQALLALARRHVDVLWALLRDNRTWQPQQPTVAAA
>698759.3:AEJC01000624_23478_21936__1277_63
MFDTEDVGVFLGLDVGKSAHHGHGLTPAGKKVFDKQLPNSEPKLRAVFDKLTAKFGTVLV
IVDQPASIGALPLTVARDAGCQAAYLPGLAMRRIADLYPGEAKTDAKDAAVIADAARTMP
HTLRSLELTDEITAELTVLVGFDQDLAAEATRTSNRIRGLLTQFHPSLERVLGPRLDHPA
VTWLLERYGSPAALRKAGRRRLVEVIRPKAPRMATRLIDDVFTALDEQTVVVPGTGTLDI
VIPTLAASLATVHTQRRALEAQINALLEAHPLSPVLTSMPGVGVRTAAVLLVTVGDGTSF
PSAAHLASYAGLAPTTRSSGTSIHGEHAPRGGNRQLKRAMFLSAFACMNADPASRTYYDK
QRARGKTHTQALLRLARQRISVLFAMLRDGTFYESRTPPDVALAA
>754501.3:AJUA01000027_3657_348__1281_310
KHVFQLHGVNAAEEPILRKKLRRQDLVAFFTKLPPTLIGIEACGGSHHWARLLQGLGHQV
RVLPPQFVKPYVKRGKNDAADAEALCEAMSRPTMRFVPVKTAEQQAALMLVGLRDRLIRQ
RTQLANAIRGYAAEFGLIAAKGLGKIEPLLARIREDDTLPPLARELFAMQAKEYTQLQTR
LEEVDDKLMAWHRADACSRRLAQIPGVGPIGASLLVMKTPTPECFRSARHFAAWLGLTPK
DHSTAGKVRLGVITRAGDEALRSVLVVGATTVLQQVRRGRGSASPWLVALLKRKPPKLAA
VALANKIARIAWKLMVSGEHYGVK
>1053178.3:AHCY01000059_1655_96__902_93
KKELKPRKESDTPTKKTRISTTDPDSGFLMRDGKPNGFHFLDHRTTDAKYNIITDTYITA
GNTADSEPYLARLQAQIDKFGFEVEAVALDAGYFTGYICKKLSERNIFMVMGYRRFGKRN
KEVPKSQFKYVEEMNAFACPMGCILEYATTDREGYRQYKSNPEDCAVCPLREVCFSKKQK
QKVITHHIWEKYKDIARKNKLTATGKKLYKVRCSTIERSFADAKELHGYRYARFRGLKSV
QMQAYLTAACQNMKKIALHLTKKGLVEGYF
>1073386.3:AGXQ01000026_239239_237410__1718_90
MAKIVFKELTSNQNVLFPVSLSEKIAPNHPVRVVNSVVDALDISCLLWAYKGGGTSSYHP
RMMLKVLFYAYLNNIYSCRKIEKALQENIHFMWLSGNSTPDFRTINDFRGKRLKEHIKSL
FSAIVLLLQESGYVSLDVQYIDGTKVESASNRYTFVWRGSVEKNKAKLESKIQAILSEVD
RHIEQDKQERTPDALPDMDSCGLREKVSALNKRLSGMNKAEQKQVRKLQEEYLPRLAKYE
SQLEKLGDRNSFSKTDEDATFMRMKEDHMKNGQLKPAYNIQIATENQFITNLGIYRRAGD
TGTLISFLKDFRETYHRQSSIVVADAGYGSEQNYEFMENAGIEAFVKYNYFHKEQKRAWK
KDAFAIQNLYYNQEQDYYVCPMGQHLEHTGQRKSKSDLGYVSVLKRYQAQNCEGCPLKSQ
CHKSKTNRIIEVNYNLNRHKQKTREKLMSEEGIYHRGRRCIEPEAVFAQIKHNSAWNRFR
LRGLEKVKTEFTLAAIAHNLRKLAKKVSALFFFTYFCRITSRKKIIEKNKDGFKIKMDNR
RAA
>1087440.3:AJZU01000042_22862_24401__1488_172
MAASYLPYRPDQSYLLPPSLGEWLPEGHLAYFISETVDTLDLSAFHARYAGGGPGNQPFH
PAMMVKVLIYGYASGVFSSRKLARKLYEDVALRVLAAGNFPAHRTLSDFRALHLTELENL
FVQVVQLARECGLVKLGTIAVDGTKVKANASRHKAMSYKRMKPAEDELHCEIKALLDRAK
ATDDQERNEPELDIPAEISRREKRLEAIQAAKARLEARQREADQARGRSEDDGRRPRHPD
GSDKGGGSYKREFGVPDDRDQESFTDPDSRIMKHAGGGSEQSYNGYTAVDAEHQIIVAAE
LTNCAADSQALLGMLAAVQANTGEMPAQTLADAGFRSEAVLAKVADHHGDVIVALGREGR
EDAKVNAKTHPHTAAIAAKLKTEQGDAAYRRRKSIVEAPNGWIKAVMGLRQFSMRGLDKV
QAEWKLVCMALNLRRMAYL
>1104325.3:CP004063_1155602_1157118__1424_3
MRKQSIEGRNQFAMLTIDDLVPKDHLVRKIDAAIQFDFIYPIVESTYSTHGRPSIDPVVL
IKLVFIQYLFGIRSMRQTIKDVETNVAYRWFLGYSFEDPIPHFSTFGKNYVRRFRETTLF
EDIFSHILEQAVKAGFVTEDNLYIDSTHIKANANKHKFTKEMTYGQAKAYQDELEDEINK
ERIAVGKRPFTWDIESELSLQKISHSDPESGYYVKGEREKQFAYSAHTSCEDNGFILSTL
ITPGNVHDSQVAIDLVKQSKRAFPNIKRVVADAGYKTPKFVHFLSHLKLYPILPYTVPHG
VKGMFRKKDFVYDAYFDCYLCPNNQPLLFSTITRDGYRTYKSNPKFCRSCPLLKNCTLST
KHQKIVTRHVWADLMDELEHQRHTALNREIYKKRKQTIERIFADAKEKHGMRWTKYRGLE
KVATHTMLTFAAMNLKKLATWLWKAKKPMAFYFKFLQRLTKRSWQLSHSFLSTV
>1105236.3:ANEY01000006_1540_3__1441_50
MFHKENPDYNRNQVGFYSLDELVPKDHLLRQIDEAIDFSFIYDLVKDSYCADNGRPSLDP
VMLVKIPMIQCLFGIRSMRQTIKDIEVNVAYRWFLGLTLEDKVPHFTTYGKNYNRRFQDK
QVIEAIFAYILGLCLNAGLIDPTDIFVDGTHIKAAANNHKYINQEVDAQAKFMSDQLEKE
IAKDREKHGKKSLGIAKEKEPISKKISTTDPDSGWFHKGEHKQVFAYNAQVACDKYGWAL
GYSIHAGNVHDSQAFPELFDKIKALTPHYLIADSGYKTPSIAHYLLTIGIIPVFSYTRPR
SKKGMLRLKDFIYDEYYDVYLCPENHPLSYSTTTRDGYREYKSNPAVCQSCPLLSVCTQS
KNHQKVITRHLWKDDLEVCEDIRHQRGMKERYQQRKETIERLFGTAKEYHNLRYTRLRGK
SKMEATLGLTLACLNMKKYSKIMAGIVFLVCLKVIISRPIVITI
>1141106.7:CAIB01000050_1_2004__1667_24
MYKNYNMTQLTLPIETSVRIPQNDISRYVNEIVETIPDSEFDEFRHHRGATSYHPKMMLK
IILYAYTQSVFSGRRIEKLLHDSIRMMWLAQNQTPSYKTINRFRVNPNTDALIESLFIQF
HSQCLKQNLIDDNSIFIDGTKVEANANRYTFVWKKSIQNHESKLNENSKALYRDLVEEKI
IPEIKEDGDSDLTIEEIDLIGSHLDKEIEDLNHSIQNEDCTQIRKQTRKKRTEIKKFKKK
FDDYSERKSKYEEQKSILKDRNSFSKTDHDATFMRMKEDHMKNGQLKPGYNLQIATNSQF
VLSYDLFQNPTDTRTLIPFLTMIQNTFGYLPEYIVADAGYGSEQNYMAIIDDFNKTPLIT
YGMFIKDKTRKFKSDIFNTQNWKYDELNDEFICPNNKRIGFKRYANRNDRYGFKRDFKLY
ECDDCSACSLRQQCMKPNSKSNKKIMKNYNWEYFKAQINQKLSEPETKKIYSQRKIDVES
VFGFMKAILGFTRMSVRGINKVKRELGFVLMALNIRKIAAQRAVHYKINIKKADFHQIIN
RNQLFYIA
>1141662.3:AKKL01000049_1625_30__1518_331
MLKEPSPQQYQFETVTLDELVPEDHLVRKVDAIMDFEFIRDAVAHLYCPNNGRPAIDPVR
LIKMMLLGYLFGIPSERKLVK*IQVNMAYRWFLRMGLTEKVPDASTLSQNRIRRFNDSDI
FQQIFDHVVEQAISGGMANGRVLYTDSTHLKADANSRKAINEERPIAPSEYIEQLNAAVE
KDRKNHAKKPLPDVKKTNENSAVKNTKVSTTDPESGFIHRDNKPKGFFYLDHRTVDGKHG
IIMDTHVTAGNVHDSQPYIGRLQRQITRFNLNTVAAGVDAGYFTAPVCHLAKEMSIALVP
GYRRPNKGQNAYQKKHFQYDAQRDVYVCPAGELLTYSTTDRNGYKHYKSNRQQCQLYEHR
SSCTQNQKAEKTVTRHVWEEAKEWSNALRLTKWGKK
>1211117.3:ALNY01000106_8489_10045__899_93
KKELKPRKESDTPTKKTRISTTDPDSGFLMRDGKPNGFHFLDHRTTDAKYNIITDTYVTA
GNMADSEPYLARLQAQIDKFGFKVEAVALDAGYFTGYICKKLSERNIFMVMGIADLENEI
KKYRKANLNM*KK*MFSLVRWDVF*NM*QRIVKDTVNTNRIQKTALFVRYVRCAFQRNKN
KKLSLIIYGRNIRILLKKQANSYREKVV*STLFHYRAKLCGRQRTTWLPLCPVSRLKSVQ
MQAYLTAACQNMKKIALHLTKKGLVEGYF
>1219061.3:AMQV01000068_1594_2__1517_84
MLQEPTPQQYELEMVTMEQLVPKNHLVRKIDNAIDFEFIRDEVAHLYCKDNGRPPVDPVR
LFKIILLGYIFGIKSERQLVKEIEVNVAYRWFLRMSLTEKVIHASTLSQNRIRRFNGTDV
FERIFINIVEQAMTKGLVAGQELFTDSTHLKANANKNKHTNKVTAVRASAYLDMLDDDVA
LDREKAGKKPLKARESESKTKNTKTSTTDPESGFMTRDNKPQGFFYLDHRTVDGQHGIIL
DTYTTAGNINDSQPYVQRLDYTLATFQLNPIAVGLDAGYFTAPVAESLERRGILGVFGYR
RPSRTKNAFKKKHFTYDAQRDCYQCPNGQALLYKTTSRDAYREYHSDPKECAFCPMRDDC
TQSKNMKKVITRHIYSDAVERANQMRLSSYGKKTYRRRSETVERSFADAKQHHGHRYARF
RGLANVQMQCWLAAAAQNIKKIALVVNYLRKMGLNMAEIRQILASVYPCNEWELLRTI
>196164.10:NZ_GG700700_1692_4__1610_165
MSGGSDDGLFPEETLQRVPAPDPVEAPVDKRFAPFNPHAVMLLPPSLDEWLPDNHLARFI
ADLVDTELDLTGFYDSYTRSKGRPPYDPRMMLRVMLYGYCTGVRSSRKLETACIDSVAFR
WLAAGAGPDFRAFSRFRARHLQALAGVFVQALALCREAGMVKLGTVALDGTKVQANASRR
KAMSYQRLVPAEEKLAEQVEQMLNDAATTDEVEDQRYGVDARGDELPEELVSRSARLATL
RRARQQLEQDAADKARQVAETKARDRGDDDDTVADKGQAAADTAVVKPSAQRNFTDPDAR
IMKLSSGGFDYCYNAQTVVDAEHQVIVATELSNTATDVGATVPMVLATAEQLGVWPARWL
MDAGYCSKKNLTEVAGLEDTHDTEFFIATGRVKHGEKIPDAPRGRIPNDATLRERMGRRL
RTKRGKAVYGKRKSVIEPVFGQIATRQGKHVVLRGLAAARAEWDLVAGCHNLLKLFSFRQ
TA
>209882.4:NZ_AABF02000114_1698_3453__1611_148
MIKVINNNRYFKFFQPKLFYINQDIDNDDPVRFLSAILEEMDFSNLLQVFPNKTKVHPVN
MFAVIIYAYSQGKYSTRDIEFLCKDSQRTKFLLNSANTPNYSTISRFLSKANNIIYELFC
QFVEKLLKLSEITTETIYIDGTKIEAYANKYSFVWKKSTLKYKERLEENILQLIDEFNKY
FNKELDSIFDILSFLEELKIHKVYGRGKRKSKEQLFLEKAQSYAERLNKYTNYLEILGER
NSFSKTDKEATFMRMKEDYMRNGQLKPEYNLQIGVISEYIASYEIFHNPADTKTLIPFLE
KIKSQNIEVKNVVADAGYESLSNYEYLKINNYVSYIKPIYYEKSKTRKYKKDLNKVENLE
YNEEENRLFRKDGLELEFLYYGKDKKTIYFRNPETEKKVRYNYEFRKLSKDNIESEFGKQ
LRMNRSIQVEGAFAVIKEDMKLRKLKVRGKNSVKREIALFCIAYNSNRYIFKLSKNKIGT
VLHPLKSA
>350701.3:NZ_AAKY01000175_4645_6216__1519_53
MLKKPTPAQEELEMVTLEMLVPKDHLLRKIEAAVDFEFIREKVAHLYCADNGRPALDPVV
LFKLLLIGYLFGVRSERQLMREVQVNVAYRWFAGFRLTDKVPDASTFSQNRRRRFTDTTV
YQEIFDEIVRQAIGRGMVDGRVLYSDSTHLKANANKNKFDEVQVAQTPSAYLAELNAAID
ADRAAQGKKPLKRDDDDQPPPSKQIKVSRTDAESGYMVRDDKPKGFFYLDHRTVDAKHAI
ITDTHVTPASVHDSQPYLARLDRQRKRFGFEVQAVGLDAGYFTPAICQGLEDRGVTGVMG
YRSPNHKPGTFYKREYRYDAYRDEYMCPQGQTLRYSTTNRVGYREYKSNPELCKRCEARS
QCTSSANAIKVVVRHVWERAKERVDARRLTEWGKRIYARRKETVERSFADAKQLHGHRYA
RMRGLRKVAEQCLLAAAAQNIKKIALLLTRLRALLPGFWRSRAPLQRLIADLTGLLDPVA
ACRINSAAA
>447214.4:NZ_ABDT01000062_9502_7673__1721_162
PMHQIGFPINLENIISDSDSVRVLYDVMEGLDYSELNRTYSTIGRNPALLPKTMFAIIVY
GYMEGIYSSRALEKACKRDINFKWLLQGQLPPGHNSIDRFRRERLAGCIENLFNQLVKKL
RELNEIQFKNIFIDGTKIESAANRYTFVWKKSIDKFEDRLQKKIKESLIRMNHDLNLCLI
ITNAKISVQDANYILDSIRIMIEANNIEFVYGKGKRKSKFQRYTEQLKEFIEKQNKYNEY
NSIFNGRNSFSKTDHDATFMHMKEDHMKNGQLKPAYNIQIGVEGEYIVGVDISSERSDQL
TFIPFLDRLEKNLNQKYESVTADAGYESEENYAYLESKKQEAFIKPANYEKSKTKKFKSD
ISKKENMYYNTDEDYYICASGKKMLLKGTKKKKTKSGYETTVSIYECEDCDGCEYKSKCT
KAKGNKQIHVAKNFMRLRTNSLKNITTPKGILLRMNRSIQVEGAFGVIKQDYGFRRFFMR
GNIKVRTEFLLMAFGYNVNKLYHKTIQNRNGELLHKQQAS
>467661.3:NZ_DS999533_330294_331837__1462_80
MMGPKQEAQAALFYEFSLEEHVPQDHLLRSIERHLDLSGIRGYLSDFYSHTGRPSVDPEL
MIRMLLVGYCFGIRSERRLCEEVHLNLAYRWFCSLDLTDRLPDHSTFSKNRHGRFRESEL
LRHVFETTVAQCIAEGLVSGQRMAIDASLIEAEATKQHSASQEEWDAAQIDAQTAPRAVR
KYLETLDEAAFGAASPVKPKFISYSDPASQWTAAHKAPAFFAYSDNYLIDTDHSVIVDVE
ATRSIRQAEVGSTKTMLDRVKKRFDLHPERLIADTAYGSAPMLGWLVDRGIDPHIPVIDK
AGRPDGTWSRTDFEWDAENDQYICPEGHALKQFRRNYSDPNRGLSGKGTARYRALKLTCQ
ACPSKAKCCPNTDARKITREEHEDARQIARDIAKTRQYKVSMKLRKKVEMLFAHLKRILG
LGRLRLRGPCGANDEFLLAATAQNLRKLAKIFPAPQQMRTA
>555793.3:AKFJ01000058_4441_2916__1449_79
MMGERRVAQEALFYEFSLDRHVPADHLLRAIDRFVDLSAMREHLRGCYSAIGRPSIDPEL
MLRMLILGYCFGIRSERRLCEEVHLNLAYRWFCRLGLEGDVPDHSTFSKNRHGRFRESDL
FRQLFEATVRRCIEEGLVAGDGFAVDASLIRAEANRHIYVEGTQGLPADQPRRAVEEYLA
VLDDAVFGGATPVEPKRVSPVDPAARYTASHGGRADFCYSTNYLIDVDNAVIVDVEASTA
VRQAEVTAAKRMIERAADRHGLWPRKLIGDTGYGSAGMLAWLVHERGIEPHVPVFDKSAQ
SDGAFERSDFTFDNEDDSYTCPAGKRLRPRNRNFASPRPEADKDGFIRYRARQQDCSGCA
LKPQCTPILPARKVTRSIHEGARDLARTLSQEDEWVASRRERKKVEMLFAHLKRIMRLDR
LRLRGPNGARDEFHLAAAAQNLRKLAKISLAGQPAMT
>1002367.3:AFZZ01000053_60026_58430__1485_178
KYVSNPTDMAKKAIKSEKLTPFGGIFAMMEQFDSTLSYVIDTTLGLRCRLYGYQYSEIIR
SLMSIYFCGGSCIEDVTTHLMPHLSLHPTLRTCSSDTILRAIKELTQENISYTSDTGKNY
DFNTADTLNTLLLNCMCAAGQLKEGEMYDVDFDHQFIETEKYDAKHTYKKFLGYRPGVAV
IGDLIVGIENSDGNTNVRFHQKDTLKRFFERFEQNNLVINRFRADCGSCSEEIVEEVATH
CKTFYIRANRCSSLYNDLFALRGWKRGEINGIEFELNSILVEKWKGKTYRLVIQRRKRMD
GELDLWEGEYTYRCILTNDYEPSVREIVEFYNLRGGKERIFDDMNNGFGWSRLPKSFMAE
NTVFLLLTALIRNFYKVIIQRLDVKRFGPNKTSRIKAFVFRFVSVPAKWIRTSRWYVLNI
YTCNNAYADVFQTDFG
>1048765.4:NODE_10_length_11321_cov_310.392975_2391_736__1470_211
MINKIDFKAKNLTSNAGLFLLLENAKSNGIFDFIENDLVFDNDSTNKIKMNHIKTMLCGH
FIGIDKLERLKLLQNDPLVNEFDISVKEPETVSRFLGNFNFKTTQMFRDINFKVFKKLLT
KSKLTSITIDIDSSVINVEGHQEGASKGYNPKKLGNRCYNIQFAFCDELKAYVTGFVRSG
NTYTANGAAEMIKEIVANIKSDDLEILFRMDSGYFDEKIIETIESLGCKYLIKAKSYSTL
TSQATNSSIVFVKGEEGRETTELYTKLVKWEKDRRFVVSRVLKPEKERAQLSLLEGSEYD
YFFFVTNTTLLSEKVVIYYEKRGNAENYIKEAKYDMAVGHLLLKSFWANEAVFQMMMLSY
NLFLLFKFDSLDSSEYRQQIKTFRLKYVFLAAKIIKTARYVIMKLSENYPYKGVYEKCLV
>1116224.3:AHBU01000052_1678_1__1523_207
MTSLHKNQVKFNSNITISHTGGQLSSDSGLVLVKELMNIFGFSELAKQHIHIEDERAYFT
HDNLSILEQFIMQLIAGYSADSAANLLRQDPVFKAVLDRKELASQSSLSRFLDRLSEENI
HELQALNQELIDKARLIRNDTELIIDLDSTHSDTFGHQEQTNYNTHYQTYGYHPLVAFDG
LTGDFLKAELRSGNQYTSKGVKEFLTPLLEHYNHSLPNTDILVRGDSGFATPGVYDSCES
KKSHYVIRLKNNRRLGQIAEKSVLYGDNQKWEEREVQYFSTTYQAQSWSQSRRVCIRSTR
EAGELLFRHEFIVTNLSENVSPDTIFSIYAKRGTMENFIKEAKAGFYFDKTDSPRFLENH
VRMMLSLIAYNLVNFLRTIGFEEVQKGMTIHSIRLKFLKVAGKLVQTGRRVYLKLSSYHV
YQNEFYRVFARLRRASQWI
>272558.1:NC_002570_4126606_4124942__1512_199
MATLPQLTLDFNRRIKLSTDGGSLSSDTGEFVFREFDEKIGFSDTLVQHLHLNDERKYYL
HSNENLFRQKIYQLIAGYAEDDAADQLTNDPVFTQVIGTNALASQPSLSRFYTRFDHESI
EQLHHANQELLDKVHELRESKALIIDLDSTHADTYGQQEFTAYNTHYGTVGFHPLVAFDG
ITGDFLKAQLRPGNVYTSNGVVDFVEPLIKHYNEKFPATTPFLRGDSGFAVPALYDLCER
ESVYYVIRLKSNAILQRMADECHPATVPSDVTKSECYYEEIDYQAKSWSKPRKVIIQSVR
PAGELLFTHSFFVTSLGDIFSPKDIVRTYQKRGTMENYIKEAKNGFYLDKMSSHSFQVNE
VKMMVSLLAYNLTNWLRTLCSPEAQKGMQIETIRTRVIKVASKLVKSGRSLYFKLSSSFV
YQDFFWKVLQRIQQLKLG
>871963.5:AGJE01000021_41579_43223__1061_291
VINVEGHQEGASKGYNPKKLGNRCYNIQFAFCDELKAYVTGFVRSGNTYTANGAAEMIKE
IVANIKSDDLEILFRMDSGYFDEKLSKR*NLLDANI*LKPKVILHSPHKQRIHQLYSLKE
KKVEKLQNCIQN*LNGKRQKICRISRTETRKERAQLSLLEGSEYDYFSL*QILPCFLKSS
YIL*KRGNAENYIKEAKYDMAVGHLLLKSFWANEAVFQMMMLSYNLFLLFKFDSLDSSEY
RQQIKTFRLKYVFLAAK
>1073383.3:AGWU01000010_16006_14976__956_9
MAKSKIQFQKGYSLFEFLKDYGTEAQCENALFTWRFPNGFVCPECANKTCCRLRRRPRVW
QCNHCRHQMSLTGNTIFANTKLPLTKWFLAMHLLSQTKTGLSAMELKRQLGVKYDTAWML
KHKLLQAMKESDDKQPISGIIQLDDVYWGGERRGGKRGRGAAGKTPFVAAVALNKEGHPI
KMRMTVVDGFKTKSVADWAKRHIASGSAVISDGLACFKAVKEANCEHLGVVTGGNLDWLD
HPAFNWVNTMIGNVKNSLRGSCHTLGAKHLPRHLAEYCFRFNHRFDLKSMLVELGHAVVA
SPPMPYRLLKLAEGHG
>316273.10:NC_007508_2768943_2767872__981_22
MSINAVQFQAGLSMPEFFAFYGTEAKCYRALYTWRWPQGFRCPVCAGRVRSRFKRRAAIY
YQCSACRHQTSLMAGTMFEGTKLPLRTWMLALHLLTSTKTNMAALELMRHLGVNYKTAWR
MKHKIMQVMAEREATRKLAGFVQIDDAYLGGERNGGKAGRGSENKQAFLIAVQTDATFTA
PRFVVIEPVRSFDNTSLQDWIARRLAPECEVYTDGLACFRRLEDAGHAHTTLDTGGGRAA
TETAGARWLNVVLGNLKRAISGVYHAIAQGKYARRYLGEAAYRFNRRFRLREMLPRLATA
MMQSNPCPEPVLRAASNFHG
>1095641.3:APFU01000006_1_1761__1630_23
MSTHPVIKRLDHLGLIAAFCHEIGLPRMIDAVIPKYSDHNVSHGDAVLAMLLNGLGFHSR
TLHMFSDFFKTKPVSKLLAKDIEAHHLTDDVLGRTLDALYEADVSALYQVIAERVVDKLG
LTTNSVHLDITSFHVDGEYAQDENTNVIKLVRGYSRDHRPELNQVVLELICENQAGIPVY
MQALSGNTNDAKAFAEVTKRHIHCLKAAQNSRYFIADAALYTEESISSLDEQNQKFITRV
PMTIKLAKQALLALEPEQLSTIGHGYSGCWIDSDYGKVNQRWLLVHSEQATKREEITFFK
NLEKNIAKEIKALEKLSKKPFACEVDAELAFNEFKKQCDLLGFEQGTLIKQPTYSHSGRP
KTDEAPTGYQYFIEAAPFTDLEKVKLAKLKVGMFILATNDTDNEALTMAALLAHYKSQQK
VERGFRFLKSPEFLTSSIFLKKPERIEALLMIMTLSLLVYASLEHKIREQLAQTEAFFPS
MVKNKTTSRPTARWVFLQFEGIDTLEINGQRFITGLQDHQTQLLKLLGRFYEVVYS
>1160282.3:CAIL01000237_2437_370__1899_982
MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTAGQVVKAIILNGLGFV
SRALYLFTQFFEDKATEHLLGESIEPKQLNDDQIGRVMDKLYQLDVSVIFLLISLAAVKK
FGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETGQQPIKITYGYSRDRRPD
LKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFQKQVDFDSLIVSDSALYSKE
NLKLMREMRWLSRVPFSIQEAQELVDSISEKELTDSEIPGYSWRETISNYGGIEQR*LLV
ESQARQ
>1234382.3:AMXF01000006_45964_44040__1765_68
MHVKLTTSGGRRYVQLVESYRDEAGRVKKRTVATLGRAEQVDGSLDAVINGLLKITGREP
MGAKPPAPTVSFESARALGNVWALTELWRSLGFSGLRRVFRRTRRTTDVEALIRLMVLNR
LCDPESKLGVLRWVQTVALPDFGPKAVTHQQLLRSLDALMDHQDEVDAVIAGLLRPLIDH
DLSVVFYDLTTIRSEGLSQQPGDVRQYGMAKEGLIARQFMLGMVQTAEGLPIYHEVFDGN
TAETRTLLPTLSKVLERFPSVQRLVLVADRGLLSLDNLEALKAVRLASGKPLEFIVAVPG
RRYNEFIELLEPFHEQQCATATQEVISEQPWNGLRLVVAHDPVTAATKTQQRNERIDALT
RQADQWSGKLTEQDEGVKHRGRKLSDSGAKARFYHAVSEAHLSRIIKVDLGEELFSYHID
DKAKRLAEMMDGKLLLVTNAEGLAAQNVLQRYKSLADIERGFKVLKSEIEIGPVYHRLPE
RIRAHASICFMALILHRVMRSRLKAADAGYTPERALEQLQRIQHHRVRLNGGEPVVGVST
LSTEQNEVFHALGIEKPAAPEQLALL
>165597.4:NZ_AADV02000006_51970_49964__1868_246
MSYLEEIQVKNLDHLGIVAGLIDEIGIVKIINNKLGIDVREKISAGTVVKSILINGLGFV
SRPLYLFSQFFQDKAIEKLLGERIKPDYLNDDKIGRVMDELYKYGLNDIFIEVVLEVIKK
IKIDLKYSHLDSTSFHLDGEYKREEDKEKQEEEKIIKERPIFIKKGYSRDHRPDLKQCVL
DLITSQDGDIPLFVRVGDGNESDKAVFGKVLVEFKKQIKFDSIMVCDSALYGQENLQLIQ
HLKWITRVPMTIKKAKELVQNIEVEEVKDEDKEKRSDLNLESYTWKEEIVTYGGIKQTWL
IVLSEKRQKSDLEKLEKQLSQEEKKSQKFLKEIQSEEFEHPQAARYKLKAINKKLRLLEI
KEVELIETYSKKKEKIYKMISLIIKKDEEISRKTKEAGKFILATNLVEENKLEASEILIT
YKNQQSTERGFRFLKDPLFFTDSFFVEKPERIETMLFLMSLCLLIYNLGQRELRNCLKRV
KKGINNQVGKVTLRPTLRWIFQCFQGIHYVILNGVKQIVNLTEERRFILSLLPASCQRYY
L
>240292.3:NC_007413_867431_865741__1645_23
MTPSVSEIRVQDIDHCGIVAGIIDQMCLVEQINQILGTHQQEIVSPGQAIKAMILNGLGL
LSAPLYLFEKFFVGKATEHLLGEGIKAEHLNDDRLGRVLDKLYEAGLTQVFVTVALAAAE
KFGVKHESLHLDSSSFHVHGEYANNSTANEASPGQIKIIKGYSRDHRPDLKQFIVDLMCS
GDGDIPLYLRVADGNEADSAMFAQILKEFHQQWEIDALFVADAALYSQDNLKQMDSLRWI
SRVPATLTTAQMLMENISQEAFVDSAMTGYRIAECGCDYAGVKQRWLVVESEARTESDLK
QLEKRLIKQLEQAQSQLRQLSQQEFACAADALQAAKCFETQQRFHQLAHLEVIEHKRHAK
SGRPRKDAQPRQSHYQIRATVVANEVAIATEKQRAGRFILATNVLDTYQLSNDDLLQEYK
AQQSTERGFRFLKDPLFFTSSVFLNSPQRVAALAMVMGLCLLVYSLGQRTLRQALAQAKQ
TINNQLGKPTASPTLRWVFQCFMSIHLVTLSGFEYIANLTDERRWILQFFGAPCRKYYLL
T
>262724.1:NC_005838_207684_209365__1644_19
METTPNLQVYDLGHLGLVASIVDQIGLVQTVDQFVGPRPGEKVSTGMALKAAILNALGFV
TSPLYLFGHFFQGKPTELLLGPGITPELLNDDRMGRMLDSLYAAGVTELFVEVAKSARRA
FPFPVRALHVDSTSFHVHGAYGSGEEGQSDTGDEPLVIRLTHGYSRDHRPDLKQWVMNLI
CADTGGIPLLFAPGDGNQSDQEALVPLLARYRQGLELGEVVVLDGASYSQENLGALQGFS
WVMRVPATLKEARALLRKELPQEAWRPLLPGYRGLEVESEYGGVRQRWLLVESQERARME
EASLRQRIVRAEGEARKVLGQLTARTFACEADARRALSEASGRLPLHRLVYLGVQEERQW
ERVGRPGKGERPLAVVYRLRARLEVDQEKLERARRGLGRFLLATNVLDREGLPPQEVLRR
YKDQARTVERGFRFLKDPLFFAESTFLKRPERVMALGMVMALALLVYALGEWALRRRLWE
AGSSLPDQKGRPTAKPTLRWVFQLFMWVRLVELGGRWFVLNLAPHHETAARLLGAGRYYL
LE
>376219.3:NZ_ADDH01000002_129310_131070__1676_30
MQIKNLDHLGLVAGVIDELGLVELTDKRIEPHSLEHVSAGQVVKAMILNALGFLSAPLYL
FSEFFESKAVSHLLGEGVEARHLNDDRLGRVLDELYAEGTTSFFLQVALQAVERFGIDIQ
QRHLDATSISVEGKYQRCSKGKSEVGLESAPPGETSAEPSPIRLCRGYSRDHRPDLKQFL
MTLVCAADGGVPLWLQLASGNEQDTQQFAEVLKAFGDQWTSDGIVVMDAAFYTAANLQQM
ETTGWLSRVPLTLKAAQELVHSDVTRLTEVPCNSKDYRMWEIEQTYAGVRQRWRLVESQT
RKANADLWQPELEKLEHRLNRQLKKLTQRVFACKPDALEALMQFQDGLEVHQLTQVSLET
VRAKRPPGRPAKSAEPTPVQGYRLQATLQQTATAEDRFSRQRSRFILATNQLEQSLWPAQ
TCLSEYKGQQTVERGFRFLKDPLFLASSVFVKKPQRVEALALIMALTLMVYTLAERQLRQ
ALDAQKQTVRDQRQQPTAKPTFRWIMQKFQGIHWVNLDGQRQISNLNDERRLIIHLFGPP
VERYYYASG
>1001989.3:AFAT01000040_119140_117371__1217_510
MLRATKVRIYPTPEQAEFINAQFGAVRFAYNKALHIKKHSYQRHRVNLNPRKDLKPLLAV
AKKSRRYGWLKEYDSIALQQAVINLDVAFSNFFNPKLKAGKPTFKSKHGRQSSYHCVGIK
VLDGAIKIPKILPIEARLHREITGMLKSITLSRSATGKYYASLLCDDGMEAPAKPALISN
VTGLDMGLAHFVIKSDGNKIASPRHLINASRNLRRKQEAGSTVP*EKRERKQAQSQ
>1001989.3:AFAT01000160_3_712__566_111
MGNEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLCEWKSVRILEAECCAE
HIHMLVEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTA
KIQDYIKHQLEEDKMGEQLSIPYPGSPFTGRK
>1005042.3:CP002641_1414625_1415451__628_254
YHIVFTPKYRRKIIYNQYRSSLGEIFRHLCSY*GVEIIEGHLMPDHVHMLVSIPPRLSVS
SFMGYLKGKSGLMMFDKHPNLKYKFGNRHFWTEGFNNLGNC*RM*VGLNEATIKKYIQEQ
RNYPV
>1005411.3:ANLU01000536_37188_35441__1252_47
VKRLQAFKFQLRPGGQQEREMRRFAGACRFVFNRALALQNENHEAGNKYIPYGKMASWLV
EWKNATETQWLKDAPSQPLQQSLKDLERAYKNFFRKRAAFPRFKKRGQNDAFRYPQGVKL
DQENSRIFLPKLGWMRYRNSRQVTGVVKNVTASQSCGKWYISIQTENEVSTPVHPSALMV
GLDAGVAKLATLSDGTVFGPVNSFQKNQKTLARLQRQLSRKVKFSNNWQKQKRKIQRLHS
CIANICRDYLHKVTTTVSKNHAMIVIEDLKVSNMSKSAAGTVSQPGRNVRAKSGLNRSIL
DQGWYEMRRQLEYKQLWRGGQVLAVPPAYTSQRCACCGHTAKENRLSQSKFRCQACGYTA
NADVNGARNILAAGHAVLACGEMVQSGRPLKQEPTEMIQATA
>1027364.3:AFJJ01000082_632_10__503_177
MSSYRSSAHVFWRCKYHLVWTPKYRYKVLTGAVGKELYRSVYILCNMKDCEVLELNVQTD
HVHLVVMIPPKLSISTLMGVLKGRTAIRLYNKFPHIRKKLWGNHFWARG
>1048254.3:AFRH01000001_171265_169492__1278_127
VKRLQAFKFQLRPGGQQECEMRRFAGACRFVFNRALARQNENHEAGNKYIPYGKMASLAG
*VEKCH*NRNGLKILPHSHCNSH*KTFERAYKNFFRKRAAFPRFKKAGTE*CIPPTRRAL
SSIRKTAVFFCRNWAGCATGIAVRVTGCCEKCHCQPSPAVSGYISIQTESEVSTPAHPSS
HQWSGLDAGVAKLATLSDGTVFEPVNSFQKNKKTLARLQRQLSRKVKFSNNWQKQKRKIQ
RMHSCIRKYPQGLPSQSHNGRQQKPRNDSH*GFEGQPTCQSQQRVRSASRGGNVRAKSGL
NRFDTGSGLV*NAPPA*VLSSSGVAVRCLLFRQRTQASVARAVVIQRKKTACHKVNSDAR
YVDVDIQANADVNGARNILAAGHA
>1048254.3:AFRH01000001_171265_169492__1102_47
WLSGKMPLKPQWLKDSPSQPLQQSLKDL*AGLQKLLPEAGCFSPIQKSGDRMMHSAYPQG
VKLDQENSRIFLPKLGWMRYRNSRQGHGVL*KMSLSAQSCGKWVHQYSDRK*SIHSGSPF
QPSMVGLGCWRG*TRHAVRWHSL*ACKQFSEKQEDAGETSATVKPQGQIQQQLAEAETQN
TANAFLYPQISAGTTFTKSQRPSAKTTQ**SLRI*RSANMSKSAAGTVSQPGRQCPGKIR
FKPFRYWIRAGMKCAASLSTKQLWRGGQVLAVPPAYTSQRCACCGHTAKENRLSQSKFRC
KVCGCGYTGERRCKWRS*HFSGGARPFLPVERWWQSGRPLKQEPTEMIQATA
>1053178.3:AHCY01000016_125245_123757__1272_157
MMLAKKVRIKPNKEQELQLWKSVGTARWAYNWTLAKQEENYKNGGKFISDGFLRKELTVL
KQTEEYAWLYDVSNNIAKQAIKDACEAYKRFFKGLADKPRFKSRRKANLSFYNDNVKLKV
KEKQVLIEKVGWVKTSEKLPVGVKYSNPRISFDGKYWYLSVGIEQEFTKEKLTAVSLGID
IGIKELAYCSDGQRKNNINKTKMVRQAEKRLRRLQRQVSRKYEMNKEGNRFVKTSNIIKI
EKEIRQLHRRLSNIRKNHLHQSTSEIVKTKPFRIVMETLHMNGLLKNRHLAKAIAKQCLY
EFKRQIQYKCEKYGIEFVEADTWYPSSKMCSSCGSINKELKLSDRVYKCTCGHEMDRDLN
AAINLSRYELAS
>1072568.3:AFYX01000001_50655_48838__1282_77
MMLILKAYKFRLEPTPEQSQRLRQLCGCARFVWNLGLAETKRILGSGEKLPSAFELNRML
TVWKKMPGHIFLQDAYTDNLQQKLKDLHTAWKRCFDKKLAAKAPVWKRKNEGRDSIRFVN
FEKYCRLENRRVKLPSGLGWVKFRQSQRVNGKIKNATISQLAGQWYISFQVEVETAEPNH
TSTTIVGLDAGVTKLATLSDGTVYQPVNSFKASQRKLATLQRQLSRKVRFSSNWQKQKRK
VQHLHSHIANIRRDYLHKVTSEISKNHAMIVIEDLKVSNMSKSAKGTAEQHGRNVKAKSG
LNRSILDQGWYEMRRQLEYKQLWRGGQVLAVPPAYTSQRCACCGHTAKENRLSQSKFVCQ
ACGYTANADVNGARNILAAGHAVLACGGMVQSGRPSETGTRR
>1076650.8:AJXV01000067_2149_1490__541_260
MDEYESLNHTQWECLHHVVFIPKCRRRTLYVELRK*LG*VFRRLAEQKESRVEEGYLMSD
YVHMMLRIPPKHAVSQVVGFIKGKSDPSGASVWG
>1134808.3:AMBJ01000257_54293_53507__607_140
MDSNSLSHTRWNCKYHIVFAPKYRRKVAYGKIKQDIANILSMLCKRKGVKIIEAEICPDH
VHMLVEIPPSMSVSYFVGYLKGKSTLMIFERHANLKYKYGNRHFWCRGYYVDTVGKNAKK
IEEYIANQLQEDLEYDQMTLKEYIDPFTGEPVKQNR
>1292024.3:APFI01000097_6419_5070__1251_397
MEILQACKFQLRPKAGQESLMRRFAGCCRFLWNKALAMEKDAYEADGKRSGYHALAGKLK
DWKKEEETVFLAEAHSRILQQALKDLDRAYRNFLAKRADFPRFRKKGVHDAFRYPQGFRL
DEGNIRIFLPGIGRGRYRKSRRIEGTLKNATVSLSAGKWHVSIQTEREVPEPVHPSQRAV
GIDMGVARFATFSDGSSITPPHSFRKHERKLASLQRNLSKRTKFSSNWQKLKKRIQRLHR
KIADVRNDFLHKLSTTVSKNHALVMIEDLKVRNMSRSASGTLGAP
>1306162.3:CAVM010000108_44576_44091__406_83
MDYRYGSHMLFQIEYHFVWVTKYRYKVLTSKVAIRGWELVCQTCETFEIRILKGVVSQDH
VHILGSAFLGQRLFLCHGRSINGRNDKGLSGASF*TEPNLNDNFRMDN
>243230.17:NC_001263_1948461_1949040__492_58
MGQQRSGSHTVSRLTLHVVWATKYRYHVLVGEIKPRCRELLIQICKAEDVRILKGVVSKD
HVHMHVEYPPRLAVSDLVKRLKGRTSRRLQQEFPHLEKRYWGKHFWGVGYGAWSTGTITE
AMVQEYLEHHRHPSDPDDSAFILED
>246195.3:NC_009446_431816_430119__1252_128
MLKAYKYRIYPNSEQALLIEKHFGCSRFVFNWALALQKRYYAMFGKSLSRTQIQSQLVKK
KKTGKFAWLNEVNSQSLLNALLNVYTAFTNFFKGRTKFPRFKSKKILGRSYQCPQHCTVS
FEQGIINLPKIKGIKTVFSREFVGNIKTVTISKNATGKYYASVLVENTDILPTPTTVEPN
LTVGIDLGISHLLNLSDGSKFDNPKYLANASKRLAVQQKIFARKQKQSKNYQKQKLAVAR
IHEKVRQQRLDLHHKITHSLICENQATSYALEDLAVKNMVKNRKLAKAINDVGWGQFVTL
LTYKATWYGKNILKVNRFFASSKICSHCHHKLDNLPLSVRNWTCPSCQTHHDRDTNAASN
IRQQALADVAGLATV
>272569.1:NC_006396_705111_703104__1315_44
MTDSQALVKTLDFQLDIQSDNESLLYDATLEARSVYNETIRLAKQGVDWDAIPDRVADDA
NLVKNTTQRVVAKALGAMENYYEYDDFGKPSHTKDGAYPLRANYEEGYNLSLTDDGDVAF
RISAKPYKHVTGVLKGSDANLDILQTALESDEWKIGTAEALFHNDNAELHVNVTNTEQTV
RDKQDSRTVVGVDVNEDNVALTALSEDGIEDSLVIDFPEIKFERHRYFTMRKRVQNAGKD
SIHDTLEGREERFVRDRLHKVSRHIVEWSRQFEKPCIVFEDLKEMRDSIDYGTRMNRRLH
HLPFRALQFYTSYKASFEGIPTAWINPEYTSQRCPMCGHTERANRNKKRFNCWDCGHQDH
SDRGASVNIAVKGVKKLDWNVPALNSLPVVRKVRRRASGAVDAPTVTQPTVRGYQADGRM
GVSD
>272630.7:NC_012809_27427_28084__538_110
MDEFESLSHTKWTCKYHVVFIPKGRRKALYGTLRPHLGEVFRTLAQQKESRIEEGHLLAD
HVHMMIAIPPKYAVSQVIGYIKGKSAIHLARVYGERRRNFVGQHFWARGYFVSTVGRDEA
VIRAYIKQQEQEDQRLEQLNLWR
>319795.16:NC_008025_2395199_2396955__1213_41
MTTHRKVYRYRIEPTPVQESKLYMLAGSRRFVFNWALARRREHYAETGKTLGYNAQAGEL
TALKNQEETSWLKESDSQLLQQALKDVERAFVNFFEKRARFPRFKSKKTDTPRFRIPQRV
RIEGSRVYVPKVGWVKLRKSQEIEGKTKSATFKREADGHWYVLLVSEFEMPDVPLPPVPE
SEVVGIDLGLKDFYVLSDGGRKEAPRFARKGQRKLRRAARRHSKCTRGSNRKAKAKRKLA
RVHRQIANQRKDFVHKATSGLVQQYQGFCIENLSIKGMAKTKLSKSVLDAALGEFRRQLA
YKAQWHRKWLAVIDRWFPSSKLCGECGSINADLTLSDREWTCECGAVHDRDLNAARNIKR
EGLSQIVVAGHAETLNARGEGVRPAIAGSPR
>445334.5:NZ_ABDU01000030_10912_12744__1261_110
VIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNYWNIVEEMVQQGYFQE
NNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGAGYDKYYKKTGGRPKFK
SKKNEIQSYTTKLVKAKGNVNIEIVGKGIKLPKLGLVKIENSRNVDGNIKRVTVSRTQSG
KYFASILCDVNIQELPKIDKKVGVDVGLKTFAVCSDGYEEANPKHFRKAEKRLIKLQRDL
ARKEYNSKNYHKNRIMIAKLHERIVNQRMDFLQKFSTKLIRENQSIAIEDLRVSNMLKNH
KLAKVISEASWSEFRRMLEYKTEWYGRKIVIAPPDYASSQLCSECGYKNIEVKNLGLREW
ICPECGTHHQRDLNASINLEKLIA
>485914.4:4083000.C1_1188492_1190338__1255_56
HKERKLCDLLDTYRAGLHEAFGAGCETMTATSDVVTPYDLPYQAKAALCNYVPQLHGTYD
AQELDDDHPIRLTNQAAEFDYSSERDYEFTWWVPQPGRGTNFWIPLRINPAQEELWHDLV
DGEASAGQLRLQRHHTSWTLHVTVEFPVEEPDYEPTDDDVTPVGFDIGEAHLLAGCACEQ
DTPTDPLLINGGRARHLRKEMYTTLKRLQEREATAWRIDERFDHYQNALTDIIEKASRQA
NEYASRFEKPVVVLEDLSYIREELDYGEWMNRRLHAWAFARLQERIEDKAREAGLPVEYI
RPEYTSQTCHECGHVGHRNGDEFWCTNDECWVTEYHADINAAVNIAGRHDPWGESLPLKP
ASDDISRDGSACDSAAIPTEQSQPRRMTLGEVGSEPSAGS
>64091.1:NC_002608_154296_156131__1266_76
PNAHKRRKLRETREAYQQALQDAFDAGCTTQTEANDVVVNYDLSGYAKNALKKYVPQLTT
TYNAGELHDDHPVRFTNGGLRLDHKPENAIEWYVKIPHHEDYHLWMPAQPNPEQRDWLEA
LNAGDATMGESRLFERDGTWYLHVTATRDVEERSDVSAEERTPIGVDIGEASLATVCHRD
GHGSPTAPELWADEGKTVRRLRKTYFTATRRLQTRGSERIVESFGDDIWDQIDDVFHRVT
REVVEYAESVENPVLVLEDLTYIRESMDYGEYMNRRLHGWGFAKLHAQIRYKAVEKGIPV
ETVNPCNTSKECHACGEVGYRPRQATFKCTNDACWMGESQADVNGAINIADRYLSGESHS
REHTDGDDSAGDGGRLTAPQDTLADATTQETLGTYAS
>662475.4:contig00124_35970_37932__1318_44
MTQTQALTKTLVFPLDVQSGNESLLHDARLECRRVFNEVLRLNYDGWDWDEIEDVVEQNA
DLVQNTAQRIINKAFDALNNYYDYDDWGRPWYKHETFPLRMNYGEGYNLFLGDETVRFRI
SAKPYNHVKGELCGTQDQFDLLTQAMEDDDWHIGTAEALARNEREELHVTVTNETAEVGA
KTAAETVIGVDINEDCVALAALTESGIEDSIVIDYPEIKEERHRYFTMRKRMQEARQTAF
NDVFRDKEQRFVHDQLHTVSRRVVEWMQRFDSPVIVFEDLEDMRDDIEYGTRMNRRLHSI
PFAKLRDFITYKAAWQGIPSDDVDPEYTSQQCPLCGHTERANRHKKRFKCCECEHQDHAD
RGAGVSVAQKWLRKQDNRDVPALNTLPQVRKWELRRQASGPVDGPTVASDTVRGDQTNGI
RGVSD
>1001989.3:AFAT01000044_1_1954__1868_849
MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPPKYTPRPAVASLLDEY
RDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSLSVPQEQEPAVRFETEP
GRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDTLEACHRNAFRFFGGVPR
EVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLCRPFRAQTKGKVERMVQYT
RNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKHETIQARPCDRWLEEQQSML
ALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
>1005491.3:AMTQ01000008_173501_175819__2099_1380
P*TASQKKRHKMVKLKPFMDYIDMRLAENVRNSEVIFAEIKAMGDTGGRSMLRYYIQPKR
KMRPSKRTVRFETQPGYQLQHDWGEVEVEIAGQRCKVNFAVNSLGFSRRFHVFAAPKQDA
EHTYESLVRAFRYFGGCVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLADHYNFLPQACRP
RRARTKGKVERMVKYLRENFFVRYRRFDSFTHVNQQLEQWIADVADKRELRQFKETPEQR
>1053166.3:AHCM01000065_31380_29221__2062_812
MIKDGEFFMIKEYHSKGWTQIAIAELTGFDPKTIRKYLNQNELPKKKKQPHGKLKTSLLD
PYKDYLLRRLKEGTTNCEVLLEEIQSMGYPGKMTILRDFIRPYRQKPKKQSSIRFETPPG
KQAQMDWAEIGEHEVDGKKQKLYVFIIVLGYSRMKYMEITNTMNMEQLMKCHMNAFAYFN
GVPEHILYDNMKTVVTLHSPTQIRFNRKFEEFLAYYGVVPKACKPARPQTKGKVESAVGY
LKKNFLQRKQKNTLHEMNEMLSGWLDKVANKKPNQTTLEPPLQRFEEEQKHLLHWNTRPL
FPISKWKVTYVTESSMISYNDRNYSVPYRYKGMEVKVKETLDHHLEIYFDLECIATHPII
SGINKSLTDINHIKNIKKEPDVTQNGLATRHIQPSNHEVEQRSLHVYEEQLKAGDHK
>1087440.3:AJZU01000042_21679_19724__1870_848
MLTQEQTVEIRVLARQGHSIRHIARTLGVSRNTVRRYLRDPSVARYQPREPRPTKLGPFE
SYLRQRVEQAHPIWLPATVLNREIRAQGYGGGLSLLRAFLATLKPARREAGPAVRFETEP
GRQLQADFVVLRRARSPMSAFVATLGYSRMTFVTFVPDESFESVRDSLLLAFDYLGGVPR
EVLFDNMKTVVLERDAYGDGKHRFHPGLLQLADDLGFRIRLCRPYRAQTKGKVERFNRYF
RESFYNPLLTRMKGTGLLLDCAAANRRVRDWLADEANVRVHATLNERPIDRWRQEREHLQ
PLPSRVRRDEAPLLDNSLRPVPLESLQHPLSVYDAIGEACR
>1122215.3:ARNP01000040_4511_2478__1928_879
VEIQLLKRHGLSLRQIAAEVGCAVNTVRRHLALEAVPKYERKVKRQTKLAQFEQYLRERQ
QAAQPDVIPATVLYREIAARGYEGGMSQLRAFMRTVRPAPPADPVVRFETAMGEQLQVDW
VEFRKGSAPLHAFCATLGFSRASYVEFVSNMKVETLIACHERAFAAFGGVTKRVLYDNMK
TVVLERDAYGEGEHRFHAGFLDYARHSGFVIKLCQPYRAMTKGKVERFNGYLRRSFYVPL
ASRLAQSGQKLDVVTANVEVAHWLREVANARTHGTTGEPPAEALKREVEHLQALPAPWRA
DIAAARPQPASAAPAVPRPAAVVERIALPSPLQHPLQVYDALLVRVSEAV
>1217660.3:ATGH01000025_1266_3220__1867_863
MLTLEQAVTIQILHQQGKSIKAITRELGVSRNTVRKYLRQNTTPQYQRIQPRISILDPYK
PYLLQRVNAAHPEWIPAVVLYQEILGLGYPGKIRILREYLATLKPVAKPEPIIRFETQPG
QQMQVDFTTIRRNNTTLKAFVATLGYSRATFVKFYDHERTDAWIDGLENAFQFFAGVPQE
ILFDNAKTIMIERDAYQEGQHKWNPKLLDCAKKYSFRPRVCKPYRAQTKGKVERFNGYLK
SSFIVPLKASLKTSGLLLDVDVANAHIGRWLHETANQRIHATTQEKPAVRLQQEQQKFTP
LPQSDTGSSTVPVAAAQHVMPYESLQHPLSVYDQL
>338966.5:NC_008607_95468_97660__2077_842
MDIAALKRSGHSIRWIARKLGIHRKTVKKYLESNSFPAYHRKDTKPSILEPYHQIIRDFL
DEDEYQATWILTRIKRMGYSGSYDTLKVFVRSIKEQKRRIAYQRFETEPGLQAQVDWGDF
KVVDSTGKTTPLYAFVMVLGFSRAMYVEFVERCTLEAFMDCHLRAFRHLKGVPAEILYDN
MKQVVVGRENGRPVFNTEFLHFARHYGFTPRLCPPYSPWVKGKVERPMHYVRESFWRGYG
FHSLEETNQDVAAWIAETAHQRIHGTHRQQVQARWEQEQPCLGALPPSEYDTSLKYFRKV
YKDCLLSFGGNRYYVPYQAAGRKVLLKVKASVIRIYHDDELLALYQIPEINGQTIGIPDK
PPPRTPRQTPRYGQDRGMATRGLTTGTLYPEVYRRPLEEYDRYAAGGAPWNS
>398261.3:ARAA01000083_209112_211482__2209_944
ELMTILDLHRQGLSVTAIARQLGLDRKTVAKYIARGLEPPVYGPRSPRARATDAFLPYLR
ERLAAYPQLTAVRLWRELKERGFAGAYTAVKRAVALLRPSAPLPIERRFETPPGEQAQVD
LARFEVVFADEPGVTRIVWLFAMVLGHSRYLWARFVVHQDLQTVLRCHIAAFQALGGAPR
EILYDRMKTAVIGEDPDGLVIYNRSLLDLARHYGFLPRACRPYRAKTKGKVERPFRYLRE
DFFLARSFRNLDDLNDQLRHWLDTVANARRHATTKRIVADAFAEERSQLRALPPVPYEAV
LSLERRVTHEGFVSVAGNLYSVPDTTRRRALEVHVLADQIRIYEAGELVACHLPLEGRGL
TQVDPAHRRPRSPPPEPRDPAEPVVVRRAGDQVARRPLAIYDAVARQLAGAGVPRTDRGD
AA
>447217.4:NC_011145_899054_896860__2070_847
MVEAEAVREMRALAGRGWGAKRIARELGLARNTVRRYLRGGPGAEVQERPAARRLDETAR
AEAVALFDGTAEGNAVVVADLLAARGVEASVRTVQRAVAGRRREQRAADLATVRFETAPG
RQMQIEFGERKVSIAGERVTVHFLAAVLSYSRRGFVKAFLHERQGEWLDGIASAFRHFGG
VPAEVLGDNTRCLVAARNRDAQTVTFHPAYLAFCRDWDVQPRACQPYRARTKGKTESGVK
YVKRSAIAGRQCESFAHLEAHLADWQLAADQRVHGTTHERPAERFERDERQALRPLPARP
LPTHARRLQRRVANDALIDIDTVRYSVPHRLVREHVEALVTATEVRVYHGQDLVAVHARS
QEPHARVVDPAHFEGLWRRTPVENVVPLAQPLAALGRSLDDYAAVIGG
>690871.3:ANMT01000018_2107_1__2015_828
MITRGEFFMIKEMYERGMSISDIARELGIDRKTVRKYIHSPNPPSKSKRKQRKSKLDPFK
PYLQKRMLEDGVFNSEKLFFEIRQQGYTGGKTILKDYMKPFRETAKKKYTVRYETLPGEQ
MQVDWKEVGEVVIEGKKVKLSLFVATLGYSRMKYAVFTTSQDQEHLMECLIQSFKYFGGV
PKKVLFDNMKTVTDGREQGVVKWNKRFSEFASYYGFIPKVCRPYRAQTKGKVERAIQYIM
DHFYVGTSFESIEELNFLLHRWLDQVANRKPNATTGISPQERWAEESLKPLPLKDYDTSY
LSYRKVHWDGSFSYKGEQWLLSAEYAGKEILVKERLNGDIRLYFRGKEISHVDQQKKVIS
FAEKIKKKQTEMAATISPVSMEVDTRPLSVYDAFLR
>1000951.3:ALEA01000206_1305_1__1247_39
MPISDKLIDQLLEGYDSPDDILGEAGLLKQLTKKVAERALNAEMEQHLGYAKHAPEGRNS
GNSRNGKSSKKLRSVHGEIELDIPRDRNGSFEPKLIKKGEKQLNGFDDRIISLYARGMTT
RDIQAHFEESYGVEVSPTFISQVTNEVMDEVKQWQQRPLDALYPVVYLDCLVVRSRDSGA
VQNKSVYLALGINTDGEKELLGLWMAQTEGAKFWLSVMNELKNRGVQDIFIACCDGLKGF
PEAIEAVYPKTQVQLCIVHQIRHSLRYVNWKQRKVIAADLKRIYGAATLAEAELALAEFA
EKWDDQHPTISLSWRNNWARLSVFFDYPPEIRKVIYTTNAIESLNASLRKITKTRRSFPT
DDSVMKILYLALHQISKKWTMPIRDWKAAMSQFMIMNSDRVSI
>1003237.3:AFBX01000066_17227_18548__743_48
DESLVRNKAIHVAISVRANGAKEVLGLWIEQNEGAKFWLRVLNELKNRGVEDILLAVVDG
LKGFPEAIAAAYPETIVQTCIVHLLRHSMEFASWKDRKAIACALKTIYEAVDDKAAEAAL
TAFEAGPWGEKHAAIGKAWRRAWQEVIPFFAFPREVRRILYTTDAIEALNSKLRRAVRAR
GHFPNDEAALKLLFLVLNRAEKDWKMPPREWTAAKAQMAVMFGERFSKAMSA
>1029814.3:AFHX01000285_1417_2__1342_68
VVKRPRITTERNIAMALDQSALLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGA
GPHERSASRINQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVM
EAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSEQHFPYVFLD
ATYCKARVNHRVVSQAVVIATGVAADGRREVLGFDVGDSEDGAFWTAFLRSLKTRGLSGV
QLVISDAHTGLRSAIEAILIGASWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTIFAQPDA
EHVREQLDTIAGMLGRQLPKVETMLREAADDITAFADFPVLHWKKIWSTNPLERLNKEIK
RRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVAEKRYLSETTLALLHPRSDSADQSVAVP
AAITA
>1078763.3:BADQ01000006_18002_19407__1282_56
MALPQSALSELLDAFRTGDGVDLIRDAVRLVLQELSELEATERIGAARYERSDTRVTDRN
GARSRVLSTQAGDVELRIPKLRKGSFFPAILEPRRRIDQALYAVVMEAYVHGISTRAVDD
LVEAMGVETGISKSEVSRICAGLDEIVGAFRTRTLGHIEFPYVYLDATYLNVRNGTGQVV
SMAVIVASGIAADGSREILGLDVGDSEDETFWRGFLTSLKGRGLGGVRLVISDQHAGLVK
ALKRCFQGAGHQRCRVHFARNLLAHVPKDKADMVASMFRMIFSAPDAEAVHATWEGVRDR
LAASFPKIGPLMDDARAEVLAFTAFPKAHWQKIWSTNPLERINKEIKRRSRVVGIFPNPA
AVIRLVGAVLADMHDEWQASERRYLSEASMALLYPDSDNAVVAAISGGQ
>1123388.3:AQWU01000042_5932_7213__1252_11
VFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDRTAFLQVHGGRRNGYYP
RKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAVALYAAGVSQRKAAEILSL
LLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLDGLSLKVFREGEGIVRESVYV
ALGIAPNGERRVLGFWLLPTESALGWEGVLGKLWQRGLRRVLLFVTDGLPGLPEAIRRVY
PQAEWQRCVVHGVRWSLSQVRSRDRALLAEDLRRVYGAESREEALGALEEVKAAWGSRYP
GVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLMERFIRELRRGTKVRDHKFPKEEAVYKL
LYLESERQAASRSEHLAGRWAERKLKGFSEVKEVLEKMLQERYAPRTQTLTHNS
>1134794.3:ALZS01000131_6315_4991__1221_58
MTKFTIEIMQTLLNKGDLDELFQDHLERAINSLLQAELTAFLDYEKYD*NGFNSGNSRNG
NYSRTFKTEYGELNLTIPRDRNGELSQQTLPAYKRTNDSLETTIIQLFQKGITMAEISKL
IEKMYGHHYTPQTISNMSKLVAEDVLAFKERTLEANYSVIFMDATHIPVKRQTVSKEAVY
ITIGIRLDGTKEVLGFTIAPTESAYIWKEVLQDLRKRGLEEVLLVVTDGLSGIEESIHSV
YPNAQFQQCCVHVSRNIAHKVRVRDRKEICEDFKLVYQANSKEEALDHIDFMIRKWKKQY
PRVVNLLLNPALLTFYNFPHAIRRTIYSTNLIEGFNKQLKRYTRRKEQFPNEESLERFFI
SQFNQYNQKFLGRIHKGFKEIQDTLESM
>1144305.3:AKKE01000131_1_1425__1265_57
MTDDRLPLAELMAKSGDTDFLRTIAESVLQIIMEADVDGLVGAGRHERSGERTTWRNGYR
DRSLDTRLGTLNLKIPKLRTGAYFPGFLEPRKTAEKALVAVIQEAWIAGVSTRRVDELVQ
AMGMTGISKSSVSKLCKDIDERVHAFLKRPLAGDWPYLWLDATYLKVREGGRIVSVAAII
AVAVNTEGKREIVGLHIGPSEAEPFWSSFLKDLSRRGLTGVKLVISDAHEGLKAAITRVF
SATWQRCRVHFMRNALAYVPKGQNTVVAAAIRQVFLQPDHAAATQVWRQVADQLRARWPK
LGACMDDAEHDVLAYMTFPEQHRVKLHSTNPLERLNKEVKRRADVVGIFPNEDSIIRLVG
AVLLEQNDEYQLQHRYMQIEGMAALATPITEEIEPLQITPKAA
>1144307.3:AJVL01000092_23_1535__1438_218
MARKRIITPEKKELIRNLISEYNITSAKDLQEALKDLLGDTIQNMLEAELDEHLGYEKYE
STEEAKSNYRNGYTSKTLKSSVGQVEIDIPRDRNAEFEPKIVPRYKRDISEIENKIIAMY
ARGMSTREINEQIQEIYGFEVSAEMVSKITDKILPEIEEWQKRPLGEVYPIVFIDAIHFS
VKNDGIVGKKAVYIVLAIDIEGQKDVIGIYVGENESSKFWLSVLNDLKNRGVKDILILCA
DALSGIKDAINAAFPNTEYQRCIVHQIRNTLKYVSDKDRKEFARDLKRIYTAPNEKAGYD
QMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKS
RTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI
>1160710.3:AJGR01000436_100_1391__1236_37
MTQPFNFEQALKDLQSGKSLTGKDSILGPLIKQLTEAALQAELEQHLAHDPQPNRKNGKT
PKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHV
EDMYGLNVSNATVSAITDKLIPELKAWQQRPLDSHYPIVWLDAIHYKVKEDGRYVSKAVY
TLLALNMKGKKEILGLHLSENEGANYWLSVLTDLNNRGVKDILIACVDGLTGFPEAIASI
FPHTETQLCVIHQIRNSMKYVASKNQKAFMADLKPVYRAVSKEAAEMALDELEAKWGDAY
PLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKL
LYAGILNASDKWTMPIHNWSLCLSQLAIYFEGRLDSVLEI
>1194706.3:ALAA01000162_22768_21471__1240_41
MAIEKELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNA*LDDHLDVERLEGGPANRR
NGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDDKIISMYARGMTVREIQ
GHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYPLVFFDAIRVKIRDEGFVRNK
AVYVALAVLADGSKEILGLWIEQTEGAKFWLRVMNELKNRGCQDILIAVVDGLKGFPEAI
TAVFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPALRAIYRARDAEAGLKALEAFEEGYW
GQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPGDEA
AMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIFGERFFN
>1200348.3:ALYH01000020_29334_30767__788_93
EAGRVVGVHTLIATGVNAEGYREILGIQVTSAEDGAGWLAFFRDLVARGLSGVALVTSDA
HAGLVAAIGATLPAAAWQRCRTHYAANLMAATPKPSWPWVRTLLHSIYDQPDAESVVAQY
DRVLDALTDKLPAVAEHLDTARTDLLAFTAFPKQIWRQIWSNNPQERLNREVRRRTDVVG
IFPDRASIIRLVGAVLAEQHDEWIEGRRYLGLEVLTRARAALTSTEEPAKQQ
>1214916.3:ALPS01000278_1328_1__1263_40
MNKTPHTITDELLDQLLANYQKPEDLIGTDGILKQLTKKLVERALDAELTHHLGHNKHQP
VSNWMGNTRNGFSKKKLKGEFGELPIEVPRDRHGTFDPQIIEKHQTRWTGFDDKILSLYA
RGMTVREIQAHLQEMYGAEVSPSLISSVTDAVADEVKAWQSRPLDTVYPIVYLDCIHSKV
REGAVRVKAVYLALGINLAGEKEILGLWIAQNEGAKFWLQVVTELRNRGVQDIFVACVDG
LKGFPEAIEAVFPRTSVQLCIVHMVRHSLNYVSWKRRAEVAADLKRIYQSSTADEAELRL
GEFEAKWDDDYLPIGQSWRRNWARITPFFDFPPEIRKVIYTTNAIESVNMSLRKITKNRG
SFPSDEALLKLFYLALRNISKKWTMPIRDWKAALTRFTISYEDRLPQQ
>267608.1:NC_003295_284128_282785__1291_44
MPRKLKAKPVDLPAIPAELLEQFGNGPMTAEAINAATLALKKALIERALSGEMNHHLGYP
PGAAKPATVTNQRNGSGAKTVLTEDGPIRIEVPRDRDGSFEPLLIPKHERRFKGFDDKIV
AMYARGMTVREIQGFLLEQYATEVSPEFISSVTDEVMAEVTAWQARPLDPMYPVVFFDAL
RVKIREDAVVRNKAVYLALGVLPDGTRDILGLWIENTEGAKFWMKVFNDLKTRGVNDILI
AVTDGLKGMPEALAAVFPATTLQTCIVHLIRNSLDYASWKDRRELAAAIRPIYTAASAEA
AQAELDAFADGPWGQRYPTVCAAWRNAWDRVIPFFAFPPAVRKVIYTTNAIENINAQLRK
IIKTRGHFPTDDAATKLIWLALRNITAGWSRAAHDWKQAMNQFAILYAERFVRPSV
>290399.4:NC_008537_147773_146434__1330_41
MAATLEAVPSTKTADKKTEISEADAARELVRMAKEQGLSLTGPDGLLKQLTKTVIETALD
EEMTEHLGYEKHDSAGKQTANSRNGVRPKTVLTETTGPVEVDVPRDRAGTFEPVIVKKRQ
RRLTGVDEMVLSLYAKGLTTGEISAHFAEIYGASVSKETVSRITDRVLEEMAAWQNRPLD
EVYAAIFIDAIVVKVRDGQVANRPIYAAIGVTLEGEKDILGLWAGTGGEGAKFWMSVLTD
IKNRGVKDTFFLVCDGLKGLPEVVTNVWPLATVQTCIIHLIRNTFRLASRQDWDALKRDV
KPIYTAPNAEAARTALEELAERWGRKYGAIVRLWENAWEELIPFLDYDVEIRRVICSTNA
IESLNARYRRAVKARGHLPTEQAALKCLYLVTRSLDPTGAGKTRWAVRWKPALNAFAITF
SDRFPAAESY
>314265.3:NZ_DS022278_215124_216486__1267_68
MTKPMMDLRALVEKSADADLLREMIGFAAERLMELEVGAKTGADYGEKTSERLAQRNGYR
DRDWQTRAGSVELRIPRLRTGSYFPSFLEPRRSVEKALTAVIQEAYVHGVSTRSMDDLVQ
AMGGTGVSKSQVSRLCEEIDERVDAFLTRPIEGEWPYLWIDATYLKVRQGGRIVSVAVTL
AVGVNTDGRREVLGMAIGASEAEPFWTEFLRDLVRRGLSGVKLVISDAHEGIKAATARVL
STTWQRCRVHFQRNALAHAGKNSRRVVSAFIATAFAQPDHAAAKAQWRLVADQMRGKLPK
LATLMDTAEEDVLAYMTFPAQHRTKLHSTNPIERLNGEIKRRTDVVGIFPNEASIRRLVG
AILMEQTEEWTVQRARYMTLETLAPVCDDLGVSLPAAQSD
>325240.15:NC_009036_51028_52284__1202_36
MTTPTFDINAAIQALREGKDLTGKDGILTPLIKQLTEAALAAELDGHLASTEGANRKNGK
TTKTVKSPIGNFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNG
TVNAITDKLLPELQAWRERELEPLYPVIWLDAIHYKIKENGRFISKAVYTILALNVEGKK
ELLGLYLSDNEGAHHWLSVLTDLYNRGVKDILIACVDGLKGFPEAIETIYPQTEVQLCVI
HQIRNSMKYVASKHQKAFMADLKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKW
ALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASER
WTHPIQNWNLTLSQLSIHFEGRLENHIDL
>350058.5:CP000511_3474504_3475920__1292_48
MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQR
NGYRHRGLDTRVGSIDVAVPKLRKGTYFPEWLLERRKRAESALITVVADCYLAGVSTRRM
DKLVKTLGIDSLSKSQVSRMATDLDEHVEQFRHRPLDSAGPFTFVAADALTMKVREGGRV
VNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARGLAGVRLVTSDAHAGLR
EAIAANLPGAAWQRCRTHYAANLMSICPKSMWPAVKAMLHSVYDQPDAPAVAAQFDRLID
YVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPAERLNKEIRRRTDAVGIFPNR
DAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTITNDNPEIGADDMPALTA
>395019.3:NC_010087_434876_433510__1221_58
MAMRVETNPLEAAYAALLENGLDGAGEALRILVNEAAKIERSAFLGARPYERTETRRDYA
NGFKPKTVLTRHGELTFQVPQVRSSDFYPSALEKGTRTDQAVNLALAEMYVQGVSTRRVI
DVLQRLLGPEISLSSAQVSRAAAKLDEGLRAWRERPLGETPYLFLDARYEKVRLEGRIVD
CAVLIAVGIEASGKRRVLGCEVATSEAEINWRRFLESLLARGLKGVTLIIADDHAGLKAA
RRAVLPSVPWQRCQFHLQQNAGALTTRQEARKTVAAQMRAIFNAPDRTEAERLLKAALTL
WCKEHPKLAEWAETAIPESLTVFDFPAAHRIRLRTTNGLERINRELRRRTRVASIFPNPD
SCLRLVSALLAELDDEWMTGKVYLNFNP
>404589.10:NC_009675_1222625_1220997__1566_391
MNEVAELELPTQENVQADLRTVFQGAVRLALETVLEEVVRDMIGARRWQRLGSRKDLRNG
TYLRRLLTTMGAIDLAVPRTRENGSPIDVVGRYRRRAAEVDAGIVSAYVSGASTRDVGRI
TEALMGEQVSRSTVSRVTKTLDEKVNELRKAPIAGPIPYLFLDATFLDARWARTVENVSA
LVAYGIGLDGKRQLLAVTIGAEESEDSWSDLLAQLTERGLSGVHLVVADAHAGLAKAVRK
HIPEAPLQRCTVHLQRNVLAKAPQRLRARLAKAVTHVFEAPSKAEAKKRVEALAAGLGRQ
VPEAIACLEAGFEAATHFYAFPREHWHRIRSTNGLERLHGEIKRRTRAVGAFPDRASALR
LVTAVALQVTAIWSDRRYLDMDLLPESMQFAA
>521045.3:NC_012785_819612_818281__1259_48
VGNFDREAMKRLVRERKLKTTKDAENLVKELFGDIIKEMLEAELEEELGYSKHDYRNKET
DNSRNGYSKKTVNSSYGKIELSIPRDRKGEFEPIVVKKHQRSIASIEDQILSMYARGMTY
RDIQAHLKDIYGSELSIESISRITDKIIPIVSEWRNRPLEEVYTIIYMDAIFFKVSENNQ
IRNKALYIAFGVNLEGMKDVLGMWIAQSEGSKYWLGVLNELKNRGVKGVMFFSIDGLKGM
EEAIEAVYPQAKIQRCVVHQIRYSMKFVSWKDKKKFAADLKSVYTADTKEAAWNALMAFE
EKWGEKYPFSIKSWKDNWEALTTYFEYPKEIRKLIYTTNPIESLNSQLRKVTKNRGVFPN
DMALMKLAYLAINNITRKWTVRINEWDKILATLMIEFDWVKSYV
>548476.3:NC_012590_180211_178763__1275_67
MANRNRPSCDMCGHGLVKNGKTAAGTQRWLCPQCNVSSINTRAHTSDIRHFKIFIDWILS
GESADHLAKRLGVTRRTLTRWFKLLWFITVPTTTDPYRVYDQVFIDGTYFHKKCLLVACT
ETHVIAWHWCLRESSYEYLKLLDKIAQPLIVTTDGAGGALKALRIKWPDVAIQRCLVHVQ
RNTFADISRNPIHPAHKAIRKLGYMLVQVHNREDAARFTAAVHHTRITFADWLKERTYRS
AIPAGQVPKWVSPNQKWWYTHRNARRALKRLEKLIHAGQLFTFLDPPEGVTQDLKATTNL
LEGGINKQLKDLAGNHRGMFDEHQRITMDWWLYTHTEDPVAPLELTKQQDFGRQGEKAAR
AAWAKEELTRRGHPDGRPATYDTHIDNEWNPSLGIRKGWAGRS
>632516.3:NZ_AEKD01000005_57690_56138__1119_475
VFKRNDNTRHS*AN*KDIYDIEISSEMVSKITEKIIPEIREWQNRPLEKIYPFIFMDAIH
YKIKDESKIVNKAAYVVLGINIEGYEDVLGIWIGESESSKFWLGVLNDLKTRGIEEVLLF
CVDGLTGLKEAIEAVFPKSDIQRCIIHQLRNSFKYVSYKHIKEFSRDFKNVYQAVNEEEA
FENFCQLKEKWGKQYPYAFRSWENNWELLTSFFKF
>720554.3:NC_016627_3722130_3723710__1492_278
MSTLSKEHVKQLVRENNFKSVSDVNAYLKDIFKDIIQELLEAELEAKLGYAKDDIESKNT
DNSRNGYTPKTIKSEFGEVDIQVPRDRKGEFKPKIIPKYQRDVSGIEEKVIALYARGMST
RDISQQIEDLYGFSLSAEMVSKITDRIAPEIKEWQQRPLEPIYSFIFMDAIHYKVRDNGR
VVNRAAYVVLGVTIDGYKDILGIWIGENESSKFWLGVLNDLKNRGIQDVLIFCVDGLTGL
KEAINAAYPKAEVQRCIIHQLRNSFKYVPYKDLKAFSNDFKEVYHAINEEVALDKLYELK
DKWGKEYPYAIRSWENNWEVISPFFKFTEEIRRIIYTTNIIEGLHRQFRKVTKSKSIFPT
DSSLEKMLYLASMNVVKKWTQRYKNWDRVLSELMIQYEGRLESYI
>866776.4:NZ_AEDR01000016_7475_8734__1150_32
MLVRCINCGFSCQKYGKTKAGSQRWYCKQCNITFTQTIDNTTKCFHRFLNWLFSKETQQD
MPGQGRTFRRKIADFWQIWPMPPKIENSRDVVFVDGIYLAKKACVLICYDGEHVLGWYLC
RSEQSRSWQALMQRIATPIVVVSDGGPGLRKALKKVWRTAKLQRCIVHAVWQVHRYTTRR
PKTLAGIMLKDLASDLYSVKTQEDAQIWIQRLFNWRVTFKEFLSEMTRDSNDNLRATHER
LLKAYNSLVVLINTETMFRYLDETLVLDKECPRTNNPIEGGVNAQLRRLLRYHRGMSVEK
RIKAVFWWCYLHSPRPLSAKEILEVMPTDASISKIYRSMNERAQLQGIIPTWGDAISWGD
LHNYDKLSFNDWD
>1001989.3:AFAT01000174_31233_32528__1242_88
MTKNTRFSPEVRQRAIRMVLESQGEYDSQWAAICSIAPKIGCTPETLRVWVRQHERDTGG
GDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDRLWKK*CHCWISCVSST
GSDRYAANCILPRQRITTVSNSDIIRINAVPVRSAMTG*RERYSAYTMYGVRKVWRQLLR
EGIRVARCTVARLMAVMGLSGVLRGKKVRTTVSRKAVVAGDRVNRQFVAERPDQLWVADS
TYVSTWQGVVYVAFIIDVFAGYIVGWRVSSSMETTFVLDALEQALWARRPSGTVHHSDKG
SQYVSLAYTQRLKEAGLLASTGSTGDSYDNAMAESINGLYKAEVIHRKSWKNRAEVELAT
LTWVDWYNNRRLLERLGHTPPAEAE
>1005399.3:ANLJ01000008_16117_14762__932_15
IKKGYNRALDVRLPEQFSIIGKLRAHYPVVTLCHVFGVHRSSYRYWKNRPEKPDGRRAVL
RSQVLELHNISHGSAGARSIATMATLRGFRMGRWLAGRLMKELGLVSCQQPAHRYKRGGR
EHVTIPNHLGRQFAVTEPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDS
RLTIKALKMAWEIRSKPAGVMFHSDQGSHYTSRQFRQLLWRYQIKQSLSRRGNCWDNSPM
ERFFRSLKNEWIPVTGYMNFSDAAHEITDYIVGYYNALRPHEYNGGLPPNESENRYWKNS
KAVASF
>1005416.3:ANLZ01000088_1262_2__932_21
IKKGYNRALDVRLAERFTIVARLSDSHSVVSLCSALEIHRSSYQYWRKRRDTVNPARVRL
CSEIRRAWNQSRGSAGARTLAEMLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQ
EHTCLPNLLERQFAVPEPDRVWCGDITYIWAGNRWCYLAVVMDLFARRVIGWSLSANADT
ALISSALRMAYEVRGQPRDVMFHSDQGSQYTGLKYQQLLWRYRIKQSVSRRGNCWDNSPM
ERFFRSLKTEWVPTDGYTGKDVARQQISSYILNYYNSVRPHHYNGGLTPEESENRYHFYC
KTVA
>1017266.3:AFHF01000013_39490_40743__994_56
DSRITKKECPTRGRKSYFKKSECHIHAKLQVRLKAVYRLRFEHTTVMLCRVLHVNRSTYY
NFINKKPSKREIENQRLRKLLLEIYMKAKKRIGTRAFKIILLRDYGVNISEGRILRLLKS
MTLPKMSTIKPRFKSNHSPVFSSDNLLKQEFNPKSPNQVWTTDFTYISIGPKRHVYLCAI
LDLYSRKCIAWKVSDKINAKLACDTLEIAISKRKPKEPIIFHSDQGSQFKSASFRKILDD
HQLLASYSKPGYPYDNAVTEVFFKYLKQREINRRTYHSIQEVQLSCFEYIEQFYNNYNPH
SANNGLTPNQKEE
>1028805.3:NZ_AFQQ01000013_44290_42903__898_32
KSSRAQPTKNAEKATIVKALRVHFPRPILLDLLGLVRSVFFYHLKTKDNKNAAISQEIVT
IYHDNHGNYDYRRVTFKLRETIKINHKKVQRIMQWLGLKGKCKTQKYRSYQGEVGRIADN
LLQRDFTATQPNEKWATDITEFKCAEGKLYLSPIKDLFNNEIIAYDLARSPNLE*ITRMM
KQAVARLEGIKPILHSDQGCQYQMRGYQNILRENGIQQSMSRKGNCLDNSAMESFFGRLK
TEYYYGKRFETFEQQEKTIHEYIHYYNHERIQGKLKGLSPVNYRTQSLN
>1036674.4:AFPO01000005_1_1262__932_12
IKKGFSSLDVGLPEQFSIIEKLKTSYPVKSLCEVFNVHRSSFKYWEQRSMKPLCATKAKE
IAKVKELFRISEYSAGARSIAQMATDQDVPLSRYRAGRLMQKLGLISCQIPNHTYKKTGD
EHVEIPNHLERQFNVEAPNRVWCGDVTYIWTGNRWAYLAVVIDLFARKPVGWAMSLSPDS
ELTGNALRMAYESRGRPKGVMFHSDQGSHYTSRKFRQMLWKCQIKQSLSRRGNCWDNAPM
ERFFRSLKIEWVPTYGYRSFLHAQHHIVKYLIGYYSQLRPHQHNGGMSPNNAEQKYWNDY
KPVASFS
>1037908.3:AFQL01000078_1_1445__1016_36
PTTDR*RAGKTLPRRAQGRTALSAGRECLSKKVESLGSERKKWQKALIISELRHEHALRD
LLRAAGMSRSTWYYNMNALKQGDRYAGLKENIRKIYHYHKGRYGYRRITLALRKQGLRIN
HKTVQRLMAELSLRSVIRAKKYRAWKGRTGEAAPNILSRNFGASKANEKWVTDVTEFPVQ
GKKLYLSSVLDLFNREVIAYSLSERPVMEMVNTMLDGAFPKLRPGDAPLLHSDQGWHYRM
RSYQERLKAHGMTQSMSRKGNCLDNAVMENFFGTLKSECFYLREFRSVSALRKAVEDYIH
YYNNERISLKLKGLSPVEYRTQALRAA
>1041149.3:AQUS01000181_1860_532__663_43
GYHRVIRGKPIRTTIPDNTAPSPLDRVNRQFKAPAPNRLWVSDFTYVATWQGFVYVAFVI
DAFARRIVGWRVSRTAHAGFVLDALEQALHERRPVHGGGLIHHSDRGVQYVSIKYSERLA
EAGIEPSVGSVGDSYDNALAETINGLYKAEVIHRRGPWRSFEAVEFATLEWVDWFNHRRL
LEPIGNIPPAEAEEQYYAMLDEPAMAA
>1042404.3:AGFN01000375_8599_6916__965_45
KKVRRNQTTKPTVRLGRHLETFQAIKEYADEYEEVSISHLCHILKVSRSGYYKWLQHQET
TSEQENLGLMDIIKKLHSQHNGILGYRRMTLFVNRKLETNYNKKRIRRLMHILGLRSIIR
RAKGYCTKTSFVNVEDNILNRNFTATAPNQKWCTDVTFLKYGFSCKAYLSAIKDLYDGSI
VAYVVGQFNDNELVLETLRKAQKANPNATPLIHSDRGSQYTSKDYYRLTTQYQMTRSMSR
VGKCIDNAPIESFFGHFKTECYDLKKYKTFEELVSDIDAYIYFYNHQRFQERNNGLAPLE
MRNKAVA
>1051503.3:AFSG01000009_86241_84803__1061_39
QNKEKGASVHEKENRKASTSYRINRSITGGKRTVAYGE*VFKKVECLSSKQGTITKQDKA
QVVYDLRHKYPVKALLRLAGIPRSTYYYCVKHFDRPDRDADIKKMVQLIFKEHQGRYGYR
RIRDELKNRGRKVNHKKVQRIMKALGLKCMIRKKKYRSYKGTIGKVAPNILARNFKAEKP
NEKWVTDMTEFKLFGQKLYVSPVLDLFNGEIITYTIGLRPVYSLVSVMLNQAFKHLKDGD
KPIMHSDQGWHYQMKHYRQALKERGITQSMSRKGNCYDNAVIENFFGILKSEFLYLKEFE
SIEHLKQELERYIDYYNQKRIKAKLKGMSPVQYRTHASRTA
>1053184.3:AHDE01000002_58184_59641__959_36
KEITLPPSQKFILIRSVIMKYNLRNMVSHLCKVAGVSRSGYYNYFSVSSQEQRKQKSDRD
EILKETILKALRFRNRNKGARQIKMTLAGQFQVVYNLKRIRRIMKKYEIICPVRKANPYK
RMLKATKEHRIVPNQLNREFKQNTPGKTLLTDITYLVYGKNQRAYLSTILDGSTNEILAY
HVSEQMTLELVTTTLHKLKRNPRIRLTEGAYIHSDQGSHYTSPTYQKLVKKLNLGQSMSR
RGNCWDNAPQESFFGHLKDEAHIKPCVSFNELKQEIKKYMTYYNHYRYQWNLKKMTPVGY
RNHLLDVA
>1001583.3:AP012168_23828_22786__944_18
LSSITYSERIKIETFCELGLSNIQMGVRLNRSPSTISYELSRCQPYQAELAQTDAEYKR*
RCGRKTKLSDELKQKILNYLRLSWSPGMIAHEVKLATKSIYNWLNQGRIGFSLNDLPEHG
VRQRRNVDQRSKYNQSLERSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRK
SRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYDIKIYYC
HAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQVM
LTNLSKNSD
>1001744.3:AFCB01000219_1232_1__973_23
MQEHYTPKGKHLTIDNRRLIERWKNENKSNREIAGLLGKAPQTIHNEVKRGTTLQQVRKG
LYKKVYSADYAQTVYQFNRKRSVKKLILTKEIREKILHYHKQKFSPEMMVNKKQVKVGIS
TIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEERPDVINLRLENGHYEI
DTVLLTKIKNYCLLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEHRILSITADNGSE
FKRLSEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKTTPKEVAFIENWINNY
PKKCLDYKSPSEFLLGG
>1005491.3:AMTQ01000042_358522_359693__1114_11
ELWKNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLTLSEREEIRAGLSAK
MSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKL
VLEKLEMKWSPEQISGWLRRTKPRQKTLRISPETIYKTLYFRSREALHHLNIQHLRRSHS
LRHGRRHTRKGERGTINIVNGTPIHERSRNIDNRRSLGHWEGDLVSGTKNSHIATLVDRK
SRYTIILRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYF
CDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHEDLVAAQLNNRPRKTLKFKTPKEII
ERGVALTD
>1005704.3:AFNM01000037_63227_62068__737_60
VHSVDTFVHTYRLQHIDAVVPSTKTLYNYIHQGLLEIKVIDLPRAVRIRKKFTKRPSTKK
HLGKSIEERPEEINNRSRFGDWEIDSVLGGKTVGEPSILTLVERQTRYAVTKKLVEKKAE
YVNQAVLECIKLYPIKSITADNGNEFSSLSKTEGLDVYFAHAYSSYERGTNENFNGLLRE
FIPKGSSLKELKPTLLEDYTKAINERPRRIHGYQSAKKLFELTQTA
>1029823.3:AFIE01000129_1_1079__976_11
MLESRKEGFSARKFAELIKRHPSTIYRELKRNSINDVYQARYASDNTFARRRRGHRKLKI
DSILWKFIVEAIRCLWSPQQIAKRLKTFPDLDQTMNVSHTTIYSTIRALPKGELKKDLLS
CLRHENKKRKANGEPKKDSILQDIKTIHERPAEVQERKIPGHWEADLIKGKDNKSSIATL
IERNTRLCILATLPDAKAESVRKALTEALKYLPAELRKTLTYDRGREMAEHKILEEDLGI
DVYFCDPHSPWQKGTCENMNGLIRQYLPKGIDLNQADQHYLNQVAMSLNTRPRKALDWLT
PLEKFAQLVDYHKTFQTVAPHV
>1037908.3:AFQL01000065_2780_1697__979_35
MSYQQLTEGQRYQLSVLRAQGMSILATARAIGVHRSTLYRELRRNAGPQGYQPDNAHQHA
THRRASAAKSRLSADVIQFVELTLAWWWSPEQISAVGKQIGLMVSHEWIYRHVAADKARG
GQLYRHLRQGHKRYRKGASSLRSPIKEARSIDERPAIVDSRERLGDWEADTVLGKQGTGA
LVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIEQVHTITFDNGGEFAEHKAIEEA
LGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDLREVTDEDVRRAEQWLNLRPRKCLG
FRQPVKVFEEYRQAA
>1069608.3:ALXM01000005_157215_158521__779_30
KLDSQLIQHIDTLIRRKLSPEQVCAYLCKHHQITLHHSTIYRYLRQDKSNGSTLWQHLRI
CSKPYRKRYGSTWTRGKVPNRVGIENRPAIVDQKSRIGDWEADTIVGKGQKSALLTLVER
VTRYTIICKLDSLKAEDTARAAVRTLKAHKDRVHTITMDNGKEFYQHTKITKALKAETYF
CRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRPRKTLGYETPSVL
FLNLFQPLIH
>1069616.3:ALXU01000010_75909_74647__1175_30
MSYTQLTQGERYHIQYLFRHCTVTEIAKQLNRHKSTISREIRRHRTQGQQYSAEKAQRQS
RTIKQRKRQPYKLDSQLIQHIDTLIRRKLSPEQVCAYLCKHHQFTLHHSTIYRYLRQDKS
NGSTLWQHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVNQKSRIGDWEADTIVGKG
QKSALLTLVERVTRYTIICKLDNIGY*NFMLNLIFKMQNFSDFSYFLLNIRKVLGN*KFF
GAFLCVKFR*QTIFAKVSICKLDSLKAEDTARAAVRALKAHKDRVHTITMDNGKEFYQHT
KITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFRNISDREIRRVQDELNHRP
RKTLGYETPSVLFLNLFQPLIH
>1072575.4:AFWL01000304_4_1069__970_11
MTTHYRQLTQGQRYQIEAGLSAAESQASIAKRVGVHPSTISREVRRNSTQNIYKAVSAAH
ESDARRAGARKFCKPATWLSHHLPVWLKHGMSPEQIAQRLKQEQPSRAVSHEWIYRFIAA
EQRAGGELYTYLRHRRKRYRKRYGSHDRRGQLRNRVSISERPAEVESRERLGDWEGDTVH
GLGGNLVTLVDRKSGYLSAYPVKRRTRRQVTRAINLMLQGHAAHTLTLDNGREFAGHERI
ALRSQCQVFFADPYSSWQRGTNENTNGLLRQYFPKGSDFSKLTVEAVNRTVARINLRPRK
RLGWKTPYEVHTGVSVALMC
>1079364.3:AGFJ01000040_552_1664__1058_33
MSYSELSVEERAIIQLSQAQGFSLRGIARLIDRSPSTISRELKRNRGSSGAYSARCAQQQ
MNIRRQVCRPKRKLVPGSERFELVAHMLRKRLSPEQIAGKLRSMTIPNLRDAYVCRETIY
NAIYALPVGELRKELIVCLRQGKTTRRPRSGGVDRRGQIPEMVSIHVRPPEIEDRLMPGH
WEGDLIKGKANASSVGTLVERTSGYLMLMKMNDATATSAMEGFSAALNSMPLAMRKSMTY
DQGREMARHAEITQQTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEQLN
AIALELNMRPRKRFDFKCPIEVMGEVMQEAMAMRHHAPASNQ
>1079455.4:ARDR01000068_24742_23627__1051_53
MSRCYTQITLADRRRLHHMVAAKVPVNEMARQLGRHRSTIYREIRRNTFRDRELPDYDGY
YSTVANDTAKDRRRRLRKLRRHSTLRTEIINQLEARWSPEQIAGRLLSDGLSRIRVCKET
IYRFIYSKEDYGLGLYQYLPEARRKRRPMRSRKPRDGAFPATHRISQRPDFVGDRSRFGH
WEGDLLIFDRPLGHANVTTLVERKSRYTVLIKNPSRHSRPIMDKIIRAFSPLPAFARQSF
TFDRGTEFAGFRALEEGIGACSWFCDPSAPWQKGTVENTNKRIRRFLPGTTDLAVVSQRD
LLHLTRHVNDQPRKCLGYRTPTEVFMAHLHEDR
>1116220.3:AHBQ01000107_1_1064__969_13
MTYTHLTTDELVMIESYYHQNIKIVKIAEYLKRSRTPIYNVINFLKEGHTALEYYQQYKE
NKKRCGRRNIVLPKKQQSYIKEKIAQGWTPDVIIGRKEKPISCSVRTLYRQFKEKVFDES
TLPMKGKRKPNGHQERRGKQAFKRNIVERETDYPTFKEEFGHIEGDTIVGIHHKSAVITL
VERLSKIIITLKPEGRKAIDIENTLNHWFGSIPRHLFKSITFDCGKEFSNWKALSNQHDI
AIYFADPGTPSQRALNENSNGLLRKDGLPKNMDFNQVDQAFISSVANKRNNIPRKSLDYQ
TPLEVFMSYMNEDILSSLI
>1131451.6:AJRZ01000082_216049_215007__952_11
MSSSRLDLSERYRLHALYETGMSLRAMADALERAPSTISRELRRNQHARQYLPDHAQRIS
EHRRTRASRRPRIDAERITQIEVLLGEDFSPEQIAGRTGLASQEWIYRHIYADQKRGGQL
FTHLRKRRRRGMRDGRGQLTHRRSWTQRPSVVEQRSRIGDWELDIIRASHGKAVVVSMTE
RRSRLHLLAYSSDGTAENVRNAIVQRLGGLRHTVHTLTADNGKEFADHRLIAVCLQRDFY
FADPYCAWQLGSNENANGLTRQSLPRQTDFSTITDAHLRWIEQRLYNRPRNILGFKTPLE
VFSEEVLNSVANRS
>1132836.3:AEYF01000052_4089_5065__622_53
EIAGRLLSEGLSLVRVCKETIYRFIYSKEGYGLGLYRYLPVWALGGRPPHLRTSTRPCQC
HFPRGAQEPLYRRHSRPIMDKIIKAFSPLPAFARQSFTFDRGTEFAGFRALEEGIGACSW
FCDPSAPWQKGTVENTNKRIRRFLPGTTDLAVVSQRDLLHLTRHINDQPRKCLGYRTPTE
VFMAHLHEDR
>1132836.3:AEYF01000052_4089_5065__912_397
MSRCYTQITLADRRRLHHLVAAKVPIDQMARQLGRHRSTIYREIKRNPFRDRELPDYDGY
YSTVADDISKERRRRLRKLRRHPNLRTEIINQLEARWRLPDACCRRG*VLFASAKRQSIA
SSTARKVMG*ASIAICQFGHWEGDLLIFERPLGHANVTSLVERKSRYTAGIR
>1136161.3:AIDC01000026_24892_25980__984_49
MNYRQLTEGKRYQISALLERGISVSEIAKTVQCHRSTVYRELKRGSKGSHYCPSEAQVFS
IKKRTSARKYRIPQERVDFIRLLLESDWSPEQISSVLTRVGAAVSHEWIYRFVAQDKRLG
GKLYRHLRQGHKRYRRGRKEKAPAIKNAVSIDDRPSIVDSKKRLGDWEIDTVLGKHGTGA
MVTILERKTRFYVVKKVQSKSADDVTKATIELLMPYKEHVHTITADNGREFAGHETIAKA
LEADVYFAHPYSSWERGANENANGLLRQYVKKGTDLTTVTDSDIEFAVSRINYRPKKCLD
FKQPAIIFKEMA
>1157441.3:AITK01000011_126184_135034__8755_7799
MTYKHLTIDELTMIESYYLQHNKPVEIANRMGRAIQTIYNVVNKFKQGKTALDYWHQYKE
NKKKCGRKVIQLPAHEVDYIKEKVTLGWTPDVIIGRKERPVSCGMRTLYRLFSKGIFDID
TLPMKGKRKPNGHQEKRGKQQYQRSIHDRPDNYPDFNSEFGHLEGDTIVGIHHKSAVITL
VERLSKVIITIKPNGRKALDIETALNQWFSRFPKNFFKSITFDCGKEFSNWKAISNQHDI
DIYFADPGTPSQRPLNENSNGILRRNGLPKSMDFREVNQTFISSVSNQRNHIPRKSLNYR
TPIEIFLSYVQEAFYSSLI
>1160710.3:AJGR01000120_285511_286744__1165_11
LQGKHGHLSREQKQLALRLHSKGWRLIDIAREIGCTAPMVGRMAREGRHLDGKPFGWEPR
EGHLTVFDREEILVGLARGDTLTAIARALGRAVSTVSREVKRGGGREEYSAWRAHEDARE
QARRPKPFKLDSGRLLEVVTTQLEQLWSPQEIAARLRLEHPDNPEMHVSHETIYQSLFVQ
GRGQLRRELARCLRSGRAARKSRTATDGRGRLPGMVMISERPAEVEDRAVPGHWEGDLIL
GENSRSAVGTLVERSTRLTLLLHLPDGKSADKMEAAMREAITALPASLARTITWDQGAEM
AKHAEFTTATGIPIYFCDPHSPWQRGSNENTNGLLRQYLPKSTDLSIVTRAELTAIQDSL
NGRPRKTLSYLTPSEKFTELIATTA
>1208104.3:ALJZ02000183_1088_4__983_39
MKYQQLTEGLRYQIACLRDHGLSQARIAKQLGVHPSTISRELRRNCAGQAYQPQQAHQLA
TARRLTSQKRTVPSDTIDFVCMALVADWSPEQISGVGDMINCPVSHEWIYRYVARDKANG
GTLYRHLRQGHKRYRKGKNSKRSVIPNPVSIDERPAIVNERSRVGDWEVDTVLGKQGSGA
IVSLLERKSRLYLVQYVPSKTASAVADTIISMLKPYQAHVHTITADNGSEFVEHERVAAE
LEAQVYFAHPYSAWERGQNENSNGLLRQYVPKGSDLSVVTAEALSAVEKRLNFRPRKCLG
FKQPQVVFDELLKAA
>1256209.3:ANKF01000183_1873_783__988_11
YKHLTIKEREILMFLRAKGLSIRAVALRMGRNPSTISRELKRCAGNYSPSKADNDYHQKR
QNCHKKRLLDSHPQLCRQIVHYILDPHWSPEQITARFNKEHQWCVSYNTIYRHIYQHNLG
EKYSSRGDTGIQRHLRHKHRTRHSKNTRRHREVQTDYISIHERPGFINQRQRIGDWEIDT
VIGRTGHSILLTVVDRLSRLTLIKKVVQKDSQEINKGLVELLGAIPKEFVHSITPDHGTE
FLHLDEISERLGVTVYWPDPYSPEQRGTNENTNGLIREYFPKRTDIDNYTEQDVEHCQKQ
LNQRPRKVLNYETPYEVFFDKPLHLV
>1266716.3:APVE01000015_106446_114210__7574_6504
HRQGVAQRKDTIERQEREAIGGLVSFHRGHSPKDQFEVSEPGRAHQHRRLAEGRHERARD
RAHAQSSRVDRQPRAGAQHESRDRHVRAVPAPADERGRPRRPKPAKIHTVPGLLAYIRAG
LRAHWSPEQIAGRLRADFPDNDAMHVCAETIYQAIYVQAKGELKKDVIKALRSGRAQRRP
HGQTDSRKPRFREPMIMISERPAEVEDRAIPGHWEGDLICSAANKSAIGTLVERSTRFTI
LLHLPDRHDAKHVQQAVIRKMQYLPKLLRNSLTWDQGSELTLHKRISTTLDMQVYFRDPH
SPWQRGTNENTNGLLRQYFPKGTDLSAYPEDHLDAVAEELNDRPRKTLGYRKPSEKI
>1269760.3:ATBQ01000190_8267_7031__1103_57
MDHSYSNTKPHQKGKHLTLNNRTTIQELHSKGYSNRAIARELNCSPSTVGYELKRGTVSV
YTGNVKRYKAVEGQSTYELHRSECGRKSLFLRRHKFIDYVSHCFHNRGWSLDACVGYALA
KGIFQKDQVVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILGRSIDERSP
RIESRKDFGHWECDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKLRE
YYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERYNGLIRRYI
PKGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYFDTELDRIYRRR
>1310164.3:AQPS01000020_160188_161823__1213_11
MGPYYGPRTLHQVLREDYTGLFNELSSLGLPAQVCGALLHLAPPPSLRFSYMPCVVPLFA
DEIKVVGQGTRLSLEEKMMIQRFHDTGVSAAEIGRRLGRCRQTISRELRRGQDDDGRYRA
RDSYEGAMRKLARPKTPKLDANRRLRAVVVEALNNKLSPEQISGLLATEHANDSSMQISH
ETIYQALYVQGKGALRDELKVEKFLRTGRKGRKPQSKLPSRGKPWVEGALISQRPAEVAD
RAVPGHWEGDLVIGGENQATALVTLVERTSRLTLIKRLGVNHEASIVTDALVEMMGDLPQ
ALRRSLTWDQGVEMAEHARFSVATKCPVFFCDPHSPWQRGSNENTNGLVRDFFPKGTNFA
KVSDEEVQRAQDLLNYRPRKMHGFKSAAQVYEKIVVGASTD
>1313.244:GSPN1_B353_B354-1a01.w2kaB353187946_44151_42920__973_23
MQEHYTPKGKHLTIDNRRLIERWKNENKSNREIAGLLGKAPQTIHNEVKRGTTLQQVRKG
LYKKVYSADYAQTVYQFNRKRSVKKLILTKEIREKILHYHKQKFSPEMMVNKKQVKVGIS
TIYYWFHNGHLGLTKADMLYPRKRKGVKKQASPNFKPAGKSIEERPDVINLRLENGHYEI
DTVLLTKIKNYCLLVLTDRRSRHQIIRLIPNKTAESVNQALTLLLGEHRILSITADNGSE
FKRLSEVFPEEHIYYAHAYSSWERGSNENHNRLIRRWLPKGTKKTTPKEVAFIENWINNY
PKKCLDYKSPSEFLLGG
>203119.1:NZ_AABG03000003_21870_23093__1183_77
MVIHCKMFNNQRKTLAKEYHELYMNNNTETRKNKHLNERERYAIELYLKEKYTVTEIAKR
LGRHRRTIEREITRGTIYLQNSDLTYRKEYCADVAQRRYVENGKNKGPRLKIGNDHELVR
YIESKIINEKYSPDAVIGQIKAKGLKFKTSICTKTLYNYIDRGDVFLRLTNKYLPVKKDG
KKRIYQRVKKIALKNLKGSSIEERPKEVNDRKEYGHWEMDCVVGRKNSAAVLLVLSERKT
REEIILKLPDKTQESVIKAIDELERKYRRKFREKFKTITVDNGTEFLDYRGIEKSKTEPG
KDRTKVYYAHPYSSWERGTNENINKLIRRFIPKGTDISKVSKAKIKSIERWINEYPRRMF
GYRSAIEMA
>204773.3:CU207211_3170265_3171517__1181_24
MERRTRIIYTDSQKAVMWERWKKGESLQQIAQLFDRNHSSVQRILAESGGIKPPHRTRSI
RSLTLAEREEISRSIVAGHSMHTIARSIGRSPSTISRELNRNGGVESYRAADADKATWER
AHRPKPCKLLQNRPLASMVADKLRQQWSPQQVAGWLKHIHPDDEEFQVSHETIYRTLFIQ
TRGALKKELTEHLRRTRVMPRSLHHTQKTDNHGKISDAVSISERPAMVEDRAVPGHWEGD
LLCGSANSQIATLVERHTRYVMLVKIDRKDTQTVVNALIKHAGKLPQELYKSLTWDRGKE
LADHKRFTLATDIQVYFCDPRSPWQRGSNENTNGLLRQYFPKGLNLSGYSQAQLNAVARR
LNERPRKTLNYETPAQRFYQSVASTG
>266264.4:NC_007972_105099_106204__1054_38
MTRTKYQQLQPEERMRIEIWKAEDVSLRAMARRLGRAPSTLMRELRRNATARGGYGAMSA
QACRTQRLKASRPVAKLAPDGVLWGVVRHFLDQKWSPQEISATLKRAFPDQPDLNVSHET
IYNAIYAYPRGELRRQLIACLRQARTKRLPRSRGTDRRGQIPDMVSIHVRPPEVNDRLMP
GHWEGDLIKGAGNQSAVGVLVERMSRAVLLVKMPDATAASALAGFTGKLQSLVAPLRQTL
TYDQGREMARHAELSAATGVRVYFCDPHSPWQRGTCENTNGLLRQYLPKGTDLSVYSQEE
LDAIADSLNGRPRKTLNWHSPLQVLAQVLANPTDRLPVQ
>314264.3:Rose217.contigs_25_516648_515539__1049_51
MGRCYPHLNLDERRNLAKWLEAKISIKEIADRLCRDASTIYREIKRNSCRFDDQPELNGY
HALAAQDRSEDRRAVHRKLILYPEIMAAVRCGFDAGWSPEQIAGRMRLERHPMRVSHETI
YRYAYSKAGRAEKFYRHLPMHRHRRRPRGTRRHHGRHILDELAIAHRPEAIAERDQFGHW
ECDLVMFRKEFGKANVTSLVERVSRFALVLKNPDRQSKPVMESLIANLSPLPAEARRSIT
FDRGTEFSAWQHLKDGLGVEPWFCDPQSPWQKGTVENTNNRLRRYLSRKADPTAFTDRYL
RSICDRLNATPRKCLGYQTPAEVFRAKLMEGGP
>398261.3:ARAA01000018_452719_454173__1402_11
GRRRSDRALREKLRSPGRPGVGLRETRRGFWAFLAQGLSSEVAAMKLGISPPVGSRWFRT
AGGMAPSHLSPSSKSPSARYLSLAEREEIAILQAQGHGVRDVARRLGRAASTISRELRRN
AATRSGGLDYRATTAQWHAERAARRPKPAKLAGNAALRTYVQERLAGTVATPGGSALPGP
SVAWKGRRHGRRQSRRWGRSWSPQQIAERLRLDFPGDTTMRISHEAIYQALYIQGRGGLK
RELTACLRTGRALRVPRARSLGRGRSFVTPEVLISERPPEVEDRAVPGHWEGDLILGLKS
SAIGTLVERTTRFTMLLHLPPMDGHGXTPRAKNGPALAGHGAQAVREAIAGTIARLPEQL
RRSLTWDQGTEMAEHARLRIDAGLQVYFCDPRSPWQRGTNENTNGLLRPYFPKGTDLSAH
SANDLAAVAAALNSRPRKTLNWKTPAEALDAVLAAVQDGVATTA
>469594.3:NZ_GL622625_138723_137441__1232_474
VTRSHRNEDRGGEHRWTFNGVEYPTRKLMCEARRAEYVRLLDEEGMNFTQAAHAVGVSKR
TGKAWRNGRTRATGRNEKPLVDWYRSTMDKPKTLHPRYLSQEERIQIADRLRLGDSIRAI
ARLLGRDPGTVSREVERNRNPESGGYEPYRAQQKAADRLKRPKPRKAAEGTRLWDEIAAG
LRRHWSPEQIANRLRLDFPDNGDMHASVETIYQAIYLQARGELKQELKRAMRQGRTARRP
QGGQGRKPVSANP
>637390.5:AFOH01000006_27334_28396__1014_7
MARKYRQLLPDQRNQIQRGLNQGLSIRGIARQLGRSPSTISREIQRGRVEETYDAVCARE
EAQRRRRKGVRKLTEGSPLTLAVTHAILQRKWSPEQIAGRLRMDYPEDKQWHVSHETIYQ
FIYAHPAGELRKALIAGLRRGHSKRKPRTRGKDRRGGITNMRSIRERPEEAQAREVPGHW
EGDLIKGAFNASAIGTLVDRSSRFVILARVEDATAEAILESFTRRLRTLPKSFRQTLTYD
QGREMARHQELERNTGICVYFADPHSPWQRPTNENTNGLLRQYFPKGTDLSEYSQRRLTQ
VAEELNNRPRKSLGFRTPAEVMAQQIRQLNSGVALQ
>717605.3:AGFE01000002_86289_85217__965_15
MSYSHLSIIERGQIEALHRLGWSTRKIGKQLGRHHSTIARELGRGQVNACYEAASAQDAY
QERRASCVPAGKFTPELAAELQEKLEQTWSPEQIAERRRCEGQAFVCFKTIYRWLYDGKL
TVCENKVLRHKGKRRKPIETRGRFTVGTPIRQRPKEVRKCSTFGHWELDTIVSSRGKSKA
CVATFIERKTRLYFAVKMPDRTAHSMEIAFGVAASQYPKGTFKTATTDRGKEFACYTELE
HTHAIKVYFADPCSSWQRGSNENANGLLREFFPKGHDFAIVTDEELARAVRLINNRPRKC
LNWKSAYEAFMDELSHL
>756499.4:AGJH01000007_111912_112971__956_15
MSYTHLSTFDRGRLESLHKLGWSTREIAQELKRHHSTIARELQRNQINNSYTSQQAQKTY
EQRRRKSKPTGKWSTSLATIINRKLKLTWSPEQIVGRLFQRQLSYKTIYRWIYQGLLIKG
NLALLRHKGKRQKPKETRGRFNVGTSIHKRPKDVKKRLSFGHWELDTVVSSRGKSKGCLA
TFAERKTRIYLALPMEDRTAGSMEMAIRTLHGFYPIGTFKTATVDRGKEFACYPSIEKDL
NLPIYFADPYSSWQRGTNENSNGLLREFFPKATDLAKVSENQVATALALINSRPRKCLNW
KTPHEAFIEELSHL
>880633.7:AEIR01000004_300152_291681__778_71
HKHFFKDGWSLDVCSNRATAVGAFSSRDVVCTKTLYNYVDQGLLDIHNYDLPEKLKRNTK
LHRIRKNKKKLGRSIEERPKEINKRNEFGHWECDLVLGHKSKDDEVLLALSERMSREFLI
LRIPDKTSVSVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEKASNTLVYYAHP
YTSCDKGTVERHNGLIRRFIPKGEAIANYSLQDIINIETWCNSLPRKILAYHTPDE
>1005462.3:AMTG01000022_3_1341__1284_202
MNYSHDNWSAILAHIGKPEELDTSARNAGALTRRREIRDAATLLRLGLAYGPGGMSLREV
TAWAQLHDVATLSDVALLKRLRNAADWFGILAAQTLAVRAAVTGCTSGKRLRLVDGTAIS
APGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRPECI
RSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGKNGETTVMIGNSGNKKAGA
PFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLPEDEYSAEQ
VADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIFANLLAAFLIDDIIQPSLDFP
P
>1123054.4:ARNG01000006_1431_1__1344_25
FFMHISQALETVLVNSHTISFDSLSDVLDPALIETGLGIAGVSTIRTRRLPMEQMVWAVL
GMALFRNISIKQLVSQLDILLPGKAPYVAPSAVVQARQRLGYEAIEHIFNLTAGHWNEKA
EHPNWCGLTLLGVDGVVFRTEDTPENSAAFARTKSQTGEACYPQIRMVCQMELTSHLLTA
SRFDSVDVNEMILAEDLIAHTSDNSLTLFDKGFYSLGLLHKWQSTGEQRHWLLPLRKQTQ
YEVIRSLGKHDQLVRLTTTPQSRKKFADLPQTMEARLLSKTIKGKEVKILCSLTDPMRFP
AADIVDLYSTRWEIELGFREIKQSMLHNAYTLRSKKPDMVKQELWGVLLAYNLIRYQMVL
MAASLGKDISPSQLSFKEAASHIVFQLATLPYVSPGRIPRVVMDITAMASYFLLPGRRER
CYPRCVKSSKLKYPVRKKNA
>1123236.3:ARJT01000022_44928_43500__1299_22
ADELNSVDKCKSFLDPEILEQAFEYSGIATVRRRRLPLEAVMWSVIGMSLFRNEPVWNIA
SKLDISLPGKNKLVAPSALVQARQRLGDEAVGRVFHMLAQRTFQQEAFEQWCGLNLLAVD
GVMFRAQDTQENLAEFGCERNNHGDAAYPLIRMCSLMETSSHMLLASEFDSRSVGEMTLA
QRLLSSVPDNSLTLFDKGYYSLGLLHQWRQKGEQTHWMLPARKDLQYTIKHQLDENDAVV
VLKSTPQARKKFDDLPEVIEARLTRYQLDGKAYRVLSSTTDTLRYPYDEVVDVYTQRWEI
EVGFREMKQGLHQARLTLRSKKPEMVRQELWGLLLA*NLVRMAMLDAVKSTPDVAPSRLS
FSLCMRQVVTFFISTTIRSPSKLPEHYKYLLETLRMLELPNKKPKRSYPRVVKGKPQKYR
KKKNAS
>1191298.3:AJYW01000280_1_1412__1321_20
MDVSQALNVINNWKPSSVETLSDLLPIDLINEAYSLTDTVTMRKRKLTLESMVWLLVGMA
IYNNKSMKDLVNQLDIVDRTGKAFVAPSALTQRRKTLGEGAIKAVFERMTTSWFESAKLP
QWNGLTLLGVDGVVWRTPDNPQNEEAFSRQKGTQYPQVRMVCQMELSSHLITASAFDNYN
TNEMVLAEKLIGTTPNHSVTMFDKGFYSLGLLHKWQMVGSERHWLIPLKKNTQYEIIQSL
GRNDKLVLLHSNPRARKLWPDLPETVTARLVTRKIKGKDYQVLTSMTDSLRYPSKDIVGL
YEHRWEIELGYREQKQYMLGNRLTLRSRLPELVKQELWGILLTYNLIRYQMVELCFNLKG
NYLPYQLSFNGTLAHVSALLVGLPYSNPGAIPRQLKGFHNMAESLILEGRRERTFPRAVK
PRPQRYARNKNAVH
>1191322.3:AJZM01000211_76214_74790__1343_24
MLEQELAMAHETIEDADNYESVVDAIQIEWIEQALLETNKASIRRRRLPAQQAVWLVIWM
GLQRNMSIKEVCSSLDIALQPKPEDSWSRVAPSVLTDSRRRLDESPLAALFHTTVKAWNG
DILQQDKDLELNVLAVDGTTFRCQDSPENAEEFGFISKKLKPYPQLRLVALMSTETRMIM
GAAFDGCHVGETTLAKRLFNDIPAHSLTLFDRCYFSADLLLSWQESAENAHWLMSAKRKL
RYEVLEKYAENDMLISMPISPQAQRQNPNLPARWEARLVLYQEPKGEIKGFITSLTDPSR
YSLESLLRIYWQRWEIEEGYGEIKQTQLQSHVTLRSRFSAGVKQELWGVLLAYNLVRLEM
VKIASEAGVRATRVSFTAAINLIDAQLRWLALSPDGTLPVKLKRMRDSLSHFILPDKRKD
RTFPRSVLFVPAKYPFRFKQ
>1269941.3:ASAH01000007_339_1723__1137_370
VAIYNNKSMKDLVNQLDIVDRTGKAFVAPSALTQRRKTLGEAAMKSVFERMTTSWLKSAN
LSQWNELTLLTIDGIVWRTPDNQKNEEAFSRQIRNTISTGKNGLPNGTKQSSYYSKRFR*
LQYK*NDIGREINR**SRP*RNHVR*GFYSLGLLHKWQTTGSECH*LIPLKKNTQYEIIR
SLGRNDKLVLLRSNPRARKLFSDLPKTMTARLVTLKIKGKDYQVLTSMTDLLRYPLKDIV
GLYEHRWEIELGYREI
>196600.1:NC_005139_3174961_3173533__1335_61
LQLTTALTLANRYAPNTEQLGKLSDILCPDFINQCLDASGVATIRKRRIPLDMAVWAVVA
MSLYRQEPLWSIVSKAQLMLPGKRSLVAPSAIVQARQRLGADAMKEVFHQSQSLWNETAD
HPTWCGLKLLAVDGVVWRTPDTKENRDAFQSASNQNGEGSFPQVRMVCQMELTSHMLVAS
AFASYKTNEMILAEQLIETTPDYSLTMFDRGFYSLSLLHRWANTGNERHWLMPMRKNTQF
TEVRKLGRNDRIVELKTTPQARKKSLSLPETIEVRLIKKTIKGKEVSILTSMTDHRRYPP
AEIAELYSHRWEIEVGYREMKSSLLNNEFTLRSKKPEMVKQELWGLLLSYNIIRYQMVNM
AKAVPGIYPNQLSFTTCAHSIIHVILGFWLESAGTIPKRITHLQEEAIHHVLSIKREERI
YPRAI
>269799.3:NC_007515_2380_3693__1183_17
MHTGPTVFKQLLQFLPRYEFNLCVRRHRGEYREKKFSTYDQFLCLAYAQMAGRESLRDIE
TCLNSHQEKLYHIGFRGDVSRTTLADANERRDWRIFQDFGHVLIGIAQQLYQADAISVEL
TQPLYAFDSTTIDLCLTLFPWAEFRKTKAAVKMHTLIDLRGPIPTWVTITTGKVHDVRML
DHLPVAKDAIYTMDRGYVDFARLHSIHKQGAFFVVRAKDNLKCQRLYSHPKDKESGVRAD
QIITLVTQKSKKGYPEKLRRVSYVDKERNKRLVFLTNNFEIPAATVAAIYKQRWQVELFF
KWIKQHLRIKSFIGTSVNAVKSQIWVALCIYLLVAITKKKLGVPCSLYTFLQILEVNLFE
KKPISSLVAEALKRNADYPERNQLNLFNY
>272564.4:AAAW04000001_770390_768798__1415_174
MQDKDTTQSTFMQAFQPFFSKDLWETIHREVPGLDLRSQKLTTNQLTLLISHAQLQEYRA
LRKISTSVHHDSLGQAIGLESISHSQISRRLKTLPTQVPEMLFKGTLHNVAQKQGYGKIR
QQLGKLYMIDASTMSLCLSRYPWAVFRKSKAGVKMHLRLSFDAMAVPDEVLVTPAKTADR
KKLDELIVQDQEALNIFDRGYVDYKLFDDYCEKGIRFVTRLKNNAVIEFTGVERPVKEDG
LIEEDVDVILGAGSRKMKHTLREVTIDDNVHEPFTILTNDFNLSAEELGEIYRYRWQIEL
FFKWLKQHAQIKHFYGTSETAVINQILLALMMYCLLVLLKLEAGYPRDLLTLQRLLIACL
FERYEEFLEKLRRRRRKGSKRIRYEEIYRMTEHSILKEEETQWLDDLTYDPVIL
>272569.1:NC_006392_20891_22293__1288_17
MRRLTTLFPSEFLEEHAEELGVVEREGKLQIPVLVWALVFGFAAGESRTLAGFRRCYNAT
ADEPISSGGFYHRLTPTLAEYLRDLVEAALDEVAVPDAVDADIDRFRDVMIADGTVLRLH
EFLSDEFQARHEEQAGAKLHLLHNATDQTIERIDVTDEKTHDSALFKTGSWLQGRLVLFD
RAYFKYRRFALIDENDGYFVSRLKQNANPVITAELREWRGRAIPLEGKQIHDVVNDLSRK
YIDVEVEAEFKRGQYEGTRSLDTKRFRVVGVRNEDADDYHLYITNLPREEFLPADLATLY
RCRWEVETLFRELKTQYELDEFDTNNPDVVKILLYAALLSLLVSRELLDLVTEQADDEIV
FPPERWAATFRSHAQLILHELGEYLGYSPPPLLERLIEDAQKIHQQRPILQETLATATQP
RCES
>296591.1:3634502_Cont43_111295_112823__1386_13
MDRNARNAFHQRQVRIKRQTKATHAVEFFNVLTSPELLETTEALLPEHRERLYPPTVALS
MFMRQVLEADGSCQKAVNGWAAQRAADGLRPCSVRTGGYCRARQRLPLEMVGTLTRETGR
LLHEKALAQWLWRGRAVKLVDGTGISMPDTPENQERYPQPSTQAPGVGFPLARLVMVICL
ATGAALDMAVGPHSGKGSGELGLVRRLLAGFCPGDVMLADALYCNYFLIASLMAAGVDVL
FEQNGSRITDFRRGQSLGPRDHIVRWPKPPRPEWMTPEQYTGFPDELTVREVKVAHQVLV
TTLLDHRKVSKNDLSALYARRWNVELDLRNLKTTTGMDVLSCQTPQMNEKQLWVHLLAYN
VIRLLMAQAARNVGIDPRELSFKHTVQLWTEWVSRGLSATKEGGRLFTLIAQCRVGNRSA
RMEPRMRKRRPKPYPWLKVPRAYARRKIKIHGHDWEPK
>349521.5:NC_007645_2149783_2148151__1508_393
LKIAHKITNLLDCPEFISAHRVLPHHFTRKRHLTFKNLVLFLLNQPNSALQTELDQFFRV
LTDAALETQVVTAQAFSKARKKLKPSALQALNEVLQAQIDLCRQRQTWQGMRLLAIDGST
VHLPLEDALARHFGAHSGFPVARLSVLLDIADNQALHNLIVTPDIDERGCAAMHLEHAPD
NSLILFDRGYPAHWLFAECQRRQQHFLMRMPVNFNPEVTQFLHSDKAEQTIHLTCRSWST
RQACEQAGVDPQTVIPLRLIRVILSTGEVEVLATSLLDADRFPLALFSDLYHRRWGIESD
YRRLKQTLQLDNFSGRTVTAVLQDFHAQQLLKNLAMLMQALQQPLIEQQCRRRKLRWKAN
FAGAPSRKGCLG
>388272.4:NZ_AAQW01000001_3574724_3573088__1512_244
LKIVQKITSQLDCPDFIDTHRQRPHDFTRRRQLTFKNLVLFLLNQPRTALQTELDQFYRV
LNQASAETQVVTAQAFSKARGKLKPEVFESLNQTLQQQLDSLGLRQTWRGLRVLAVDGST
VHLPLESVMTRFFGCHSEFPVARLSMLYDVADGQTLHSLIVPSAVGERDCAHLHLEHLPA
DSLTLFDRGYPGHWLFALFEQHRRHFLMRLPCGYNAQVKQFLRSGQTEDTQFFSASHPEA
RLFCTEAGVDPAGRVELRLIRVELASGESEVLLTSLLDRQAFPAEVFADLYHRRWGIETD
YRRLKQTLCLDNFSGRSVTAVKQDFHAGQLLKNLALLMQHLLQPVIEQRHKGRKLRWKVN
FTQGVSRLKNTLVDLLVRPGVQGLANVMELMANSLSAVRPGRSFPRQRMRLASRGCEGYK
PTR
>399599.3:NC_009997_2855780_2854361__1354_17
ISSDFFMQLSEALARTHITRLTEFTCLADVLEPELIQSCLDSQGVATLRRRKLPMDAMIW
AVIGMALFRGESVRSLINKLDIVLPQEIDYVARSAVTQARKRLGSEVIREVFSRSANTWH
ARAEHPHWCGLNLYGVDGVVWRTPDSVQNQAAFARTANASGEAAYPQIRMVCLMELSSHL
LVNSAFDSVAENEMNLASQLIPSIPNHSLTLFDRGFYSLGLLHAWQQAQPDSHWLLPLKK
GTQYEVVRTLGKHDQWVKLTTTPQARKKWPQLPDTLEARLLTKTVKGKSVAILTSLTDPM
RYPSEDIVDLYAHRWEIELGYREMKQHLLESRFTLRSQLPELVTQELWGVLLAYNLIRYK
MLLMAKSLSSVHPNQLSFRDAASYIIFKLTQLPSQTPGNVPRDVLDIERNARQFKLDGKR
ERAYPRVLKMSKNKYPVRPKKNAVHS
>561231.5:NC_013421_3195007_3193593__1333_518
MELSQALGIINLTAPDDVQTLADLLSPDLIQQAFSLTDTVTLRKRKLSLESMVWLVIGMA
IFNNKSLSHIVNLMDIADRTGRPFTAPSSVVSRRKTLSEDAVRVLFELTQQHWHEEARHP
LWHGLTLNAVDGVVWRTPDTPDNAHTFGKASNQHGERGYPQAHMVCLMELSSHLLRASVM
DSYDVNEMRLAARLAAQAPDNSVTLFDRGFWSIGLLNNWHNAGENRHWLLPLRKGTQYEV
IRRLGKQDELIMLKTTVQARKQWAGLPDELIV
>64091.1:NC_002608_264220_261173__1574_243
VAAVSYEPPDSVIVDRIKRAFPSDELRERARATNLVQRERKFDTVALFYTLSLGFAAGSD
RSIQTFLERFVEMADCDELAYPTFHGWFSPAFVALLREILDDAIENLEPGQTDLSGRLER
FRDVLIVDASIVSLYQDATDVYAATGEDQAGVKLHLTESLSTGLPTRFQTTDAKTQERSQ
LPTGEWVAGALVLLDLGFYDFWLFDRIDQNDGWFVSRVKDDANFEIVEELRTWRGNSIPL
EGESLQDVLDDLQRQEIDARITLSFDRKRGSGVSTTRTFRLVGVLNEDSGEYHLYVTNLA
RDNYHAPDIAQLYRARWEIELLFKELKSRFGLDEINTTDPYIIEALIIVAALSLLMSRVI
VDELRKLDAKRQGSDDDAAASSTRLPRRRCSHALERHAHLVQLYLMVDLGYELPDLDELL
LWSSRDPNPHRPRLREQVESGEFW
>701176.3:NZ_AFWD01000042_1_1434__1341_22
MSLESQLANTFRSCNTFHHFDKYSDILSPELIQQGFEQAGVATVRRRRLPLEAVLWSVVG
MSLFRQQSVWDIANQLDIVLPDKRRFVAPSAVVQARQRLGEEGVKQVFKKMAAHSYQSSN
FETWCGLNLLSVDGVVWRTTDTLENHQEFKAQRNQSSENIYPKVRMVCLMELTSHQLIDS
AFSDYRTSEMSLAEELIEQTPDQSLTIFDKGYYSLGLLNRWNKVGQERHWMLPVRKDFQY
DVVHKYSQSDAIVAIKTSPQARKKFSDLPEIIEARLVSKVIKGKEYQVLTSMRDGLRFPG
EDIVELYRYRWEIELGYREMKQTLLDSEYTLRSKRPDMVRQELWGILLAYNLIRQVMTKA
ASNLDSVWPNQLSFTSSAMAVTQYFAALPLTSPGKLPKHYEVLLQQISMFILPPRRDDRN
YPRWVKLKPKKYATNRKNAS
>766162.3:AKNC01000102_27806_23927__76_1398
DFFMHIGQALDLVSRYDSLRNPLTSLGDYLDPELISRCLAESGTVTLRKRRLPLEMMVWC
IVGMALERKEPLHQIVNRLDIMLPGNRPFVAPSAVIQARQRLGSEAVRRVFTKTAQLWHN
ATPHPHWCGLTLLAIDGVFWRTPDTPENDAAFPRQTHAGNPALYPQVKMVCQMELTSHLL
TAAAFGTMKNSENELAEQLIEQTGDNTLTLMDKGYYSLGLLNAWSLAGEHRHWMIPLRKG
AQYEELRKLGKGDHLVKLKTSPQARKKWPGLGNEVTARLLTVTRKGKVCHLLTSMTDAMR
FPGGEMADLYSHRWEIELGYREIKQTMQLSRLTLRSKKPELVEQELWGVLLAYNLVRYQM
IKMAEHLKGYWPNQLSFSESCGMVMRMLMTLQGASPGRIPELMRDLASMGQLVKLPTRRE
RAFPRVVKERPWKYPTAPKKS
>1004954.3:AFFC01000051_30_1028__940_2
GQILHGSAKTTHAIRAELQRSKASAAELARRYGINEKTVLKWRKRRSVEDMPMGPKERRS
TVLAPVEEAAIVALRVQARLPLDDVYIALKDVIPHLTCSSLHRCLQRHGISRLPKGDREK
PKKFKDYEIGYFHIDIAELRYEGGKGFLFVAVDRTSKLVFARIYRKATKLAAAGFLKSLI
RTVPYRIHTILTDNGVQFVQREQGTGLTFSHIFGRVALEHGIEHRLTKPYHPWTNGQAER
MVRTIKEATVKSFHYSSINEMRRHVRDWLTAYNFAKQLKALKFKTPYEAIHELWKSKPEA
FIVKPHHHMMGPN
>1010838.3:AFIF01000105_1089_1__985_2
MSHRNAPLSETGRLRLARCVVDEGWSLRRAAERFQVSVTTAERWARRYRELGEAGMADRS
SRPHHSPNRTPTRTERRIIKVRVIRRWGPARIGYLLGIHPSTVHRVLTRYALAKLRWLDR
STGRIIRRMEPAGCGDLVHVDVKKLGKIPAGGGWRMLGRAIGGHNSNADKSSGVFSKHRN
PIRGYHYLHTAIDGYSRLAYSEVLDDEIKETAAEFWTRANAWFAECGISVRKVLTDNGSC
YRSRVFAQALGDIEHRRTRPYRPQTNGKVERFHRTLADEWAYARLYRSDTERCEEFTTWL
HTYNHHRGHTALGGQPPASRVPNLSGQY
>1033736.3:CAHK01000022_38666_41519__1738_695
MTRGHHANAALTPRHRLKVARLVVDDGWPISEVAARFQVSWPTVKRWVDRYLVGESMQDR
SSRPRTSPNKTPKSVTKRCVSLRMRLREGPVQLASRLDIAPSTVHRILTTARLNRLSYVD
RATGEPVRRYEHPHPGSLVHVDVKKVGNIPDGGGWRYVGRRQGEKNRAATPGKPRNQYGG
PKLGYAFVHTVIDDHSRVAYTEVHDDETAVTAVAVLRRAVQWFAGHGVTIERVLSDNGGA
YRSHLWRDTCHGLSITPKRTRPYRPQTNGKVERFHRTMADGWAYARCYTSEQERRDALEP
WLGHYNEVRPHTACGNQPPLTKLRAAGYSSVASTPTPGGSSVKNSGSE
>1055352.3:AGSW01000283_6_1057__973_2
LHRTEAFVSHRNARLTVHGRRLLVDRVCSGRPVAHVAAEMGISRPTAHKWLRRWRSEGES
GLIDRSSHPHRTPHRTSAATEARICRLRQERKLGPARLGPVIGMPVSTVHRVLTRHGLNR
LAFLDRPTGQVIRRYERERPGELVHVDVKKLGRIPDGGGHRTLGRQAGRATRSNVGFDYI
HSAVDDHSRLAYSEIHPDEKVATCAGFLTRAAAFFHDQGIPRIERVLTDNAWAYRKGLAW
KNALADLGATGKLTRPYRPQTNGKVERFNRTLADEWAYLRPYTSNDERTAALADFLHTYN
HHRCHTALGGQPPITRVNNPAGQY
>1096546.3:AKFK01000005_9687_10731__983_240
MASVLHGSARTTSHIRAELQVSQESSRALAAAYGLNPKTVAKWRGRSLTSDAPMGPKKPK
STVLTPAEEAIVVVFRRRTLPSLDGVLGCLRDTIPNLSRSALHRCLQRHGISRLPADETT
QTRKRFKIYEIGYVHINSCSLRHADGKLVILLEFGRL*KFIYVEFYDRAGKKEESAFLRT
VVAAFLYKIPTVLTDNGMAFADLPKNRTGPSRQFLGPHIFDRVCIEFGIEHRLTKPYHP*
TNGPFDRL
>1096546.3:AKFK01000012_43803_44819__961_2
MGQILHGSARTTEAVRRAIQLRQESVRGAAKRYGVSPTTIQKWRTRQTTGDAAMGPKQPR
STVLTPEEEAIIVAFRRHTLLPLDDCLYGLQPTIPHLTRSSLHRCLERHGISRLPEMEGD
KPKTKRFADYPIGYMHIDIAEVRTEQGKLYLFVAIDRTSKLAFAKLEAEANRYTASDFLR
ALVAFVPYTIHTVLTDNGVQFCHAPRNRSGPTALYSRHMFDRVCHEHGIEHRLTKPNHPW
TNGQVERMNRTIKDATVKRYHYETHEQLRAHLQLFVDAYNHARRLKTLRGLTPYEHVLQV
WTKQPKRFRLDPSHHIPGPY
>1107881.3:AGVV01000004_161930_162975__964_2
MNIHKNARLTPLRRVEMARDVVEGRFSKAQAARVYGVTSKVVGRWVKRFLADGCDGMMDR
SSRPKTSPRQTALKIADKIVALRRQRLTGKHIAQQTGVSAATVSRVLKRAGLSRLKDIEP
AEPVRRYERAFPGEMIHLDIKKLGRFHEVGHRITGDRTRQSSRRGKAWGAGWEFVHVAID
DASRVAFSQILPDETKESAVTFLKAALAYYASLGIVVERVMTDNGPCYTSKAFVQACREH
GLKHVRTRPYTPKTNGKAERFIQTALREWAYAVAYPNSDRRAAELPHWLHRYNWHRPHGS
LNATTPISRLGLAEDNLLRLH
>1110697.4:BAFO01000043_1114_28__985_2
NPEAFVSHANAALTPRARLRLAQLIVDRGWTYTAAGKLFMVSARTAGKWADRYRVEGPTG
MVDRSSRPTTQPNKTPPHLVRRIVALRWRHRLGPI*IAGRLAMPASTVHAVLVRCRINRL
SRIDRVTGEPLRRYEHAHPGSMIHVDVTKFANIPDAGGHRYLHRAQSKRTGERGAAYRPV
IGTAYVHTVIDDHSRLAYAEICTDEKAVTAIGVLQRAVTWYAERGVTVEKVLSDNGSAYK
SHAWRDACTELGIRHKRTRPYRPQTNGKIERFHRTLGEGWAYARLYDSTEQRNTALPGWL
HFYNHHRAHSAIGGRPPVTRLTNLPGHH
>1120227.3:AHGS01000014_7622_8688__952_2
HRNAPLTPTGRLRLARCVVDDGWPLRRAAERFQVSHTTAVRWAGRYRRLGEAGMHDRSSR
PHRSPRQTPAAVEQQIVRLRREHRIGPLRLAARTGIAASTAHRVLRRHGLPALAATDRAT
SEPVRRYERSRPGELLHIDVKKLGRIPDGGGHKVLGRAAGSPNKDRRNGAGYAYLHTALD
DHTRLAYTEDLPDETAATCAGFLRRATAWFARQGVIAERVLTDNAWAYTKNTWRQTCHEL
DISPRWTRPWRPQTNGKVERFHRTLLEEWAYQQPYTSDAQRQATFPDWLDWYNYHRPHTG
IGGHPPASRVTNLSDQH
>1120936.3:ARMS01000020_48564_45878__797_213
PADRPRQTALADVGNRICELRRDRKLGPARIGPVLGIPSSTVHRVLTRYGLNRLRWMGRP
TGQTIRRHERSHPGELVHVDIKKLGNIPDRGGHRIVPRQQAAGNRQATTDVRRGGSPVIG
YSFVRTAVDDHSRLAYSEVLTDERKENAASFWQRANAFFAEHGITVERVLTDNGSCYRSR
LFGRTLSATGIVHKR
>1125630.4:CP003224_20276_19197__976_2
MTQALHSQARTTHLIREEIRNSTLPQAELARMYNVTRQTIRKWQNRESPEDKSHAPNKMY
TTLTPEQELIVVELRKTLLLPTDDLLAVTREFINPAVSRAGLGRCLRRHGVSDLRNLVEQ
EGTAPATKKTFKDYEPGFVHIDIKYLPQMPDETARRYLFVAIDRATRWVFIELYADQTDG
SSGDFLNKVQQACPVKIVKLLTDNGSQFTDRFTAGGKKKEPSGTHVFDRLCKQLGIEHRL
IPPRHPQTNGMVERFNGRISDIVNQTRFGSAAELESTLRNYVKIYNHSIPQRALQHKTPV
QALKEWHEKRPELFRKRVYNQPGLD
>1154764.4:AMRP01001211_1028_6__943_2
MNSHKHARLTRAGRALLVDRVLQQNWTMRQASEAAGVSLRTGYKWMARFRNEGPDGLLDR
SSRPHRSPQACPPEQVQLFEQQRRQRLPLWRIARETGRSLATVARHMDRIGLSRLASLEP
PQPVRRYERASPGELLHIDTKRLGRIHGVGHRITGDRTQNRNRGIGWDAVHLAIDDHSRV
SFAQVLADETALSCVQFLRDAVAYYANIGVRIERVMTDNGSGYKNAFRAACEELGIRHIR
TRPYTPKTNGKAERFVQTSLREWAYARPYESSAQRTAALQPFIDGYNWCRPHSALGHQPP
ITRIPGVNNLVRLN
>1169230.3:AQKN01000013_17130_16109__939_367
MNIHKNARLTPLRREEMAVAVLGGRLTKAQAARLYGVSLKIVSRWTERFRISGRAAMTDR
SSRPTRSPRQMGQDIVERILHLRRQRLTGKHIAMETGVSPATVSRILRRAKLSRMKDIDP
VEPVIRYEYAEPGGLIHLDIKRLGRFERVGHRITGNRTRQSNARGVGWEYVHVCIDDVSR
IAFTDIFPDEK
>1169334.3:ANST01000051_78711_79730__980_51
MNREIQQRLQWVKLYETSSDAGFVCRRCGISHPTLRKWWRRYLAQGIAGLESHSRRPKHS
PSTKTGAGEVALILELRSLRNLGARRIQSELKRLHAISLAVATIHKVLCQNKVKPVVKFR
RKADFIRYERPVPGDRVQMDTCKIGPGLYQYTSVDDCTRSRVLRLYSRRTAANTLDFIDC
VIEEMPFPIQRLQTDRGREFFAVKVQEKLKEYSIKFRPNKPASPHLNGKVERSQKTDKAE
FYATVDLSTDDLKELLAEWQHYYNWERPHSAHNGKTPMERYFELAEQTPYSDAVHASYQP
NEEHIQEQNY
>1183154.3:ALOG01000003_408478_409500__940_2
MNHHKNARLTVHSRALLVRRILHEGLRPEEAAQACGVSVRTAYKWLARFRQFGAPGLENR
SSRPHQTPHATPAPVIEQIKEHRRKRQTYLTISKALGVGHSTISRLMRAHGLNRLCRLEP
PKEVIRYEYDQPGGLLHLDIKKLGNFQRPGHRTDAKRRGNAAGGGWGYVHVAIDDHSRVA
FSSVHPNEQAETACQALLGALQYYASLGITFKRILTDNGACYRSTAFAKLLKSLGIKHIR
TKPYTPRPNGKAERFIQTSLREWAYAREYASSDQRNSVLTQWLHHYNWHRPHMGIGGQPP
ISRVLLNNLVGLH
>1203571.3:ATFM01000005_939028_937936__1006_2
EVFVTHANAPLTPEGRRRLAVLVVEQGWSLRRAAERFQCSPATVKRWADRYRAGLPLIDR
SSRPTSSPNRLSRKTEHRIVALRFTGRWGPHRIAYHLRLHRSTVGRVLARYKMPKLINID
QATGLPVRRPKPKRYEVAAPGQLVHVDIKKQGRIPDGGGWRAHGRGFMQDRHAGVARDKA
ARAGAAGSRGYRYLDHAVDDHSRIAYSQILDDERKETAARFWTRANAFFAGLGVTVTAVM
TDNGSCYRSGAFADALGDEVKHKWTRPYRPQTNGKVERFNRTLAVEWAYAKPYASEAERA
AAYETWLHHYNHHRPHTGIGGQTPSARVHNVTGKY
>1206722.4:BAFR01000305_1093_1__988_2
VSHRNAPLSELGRLRLARCVVDDGWPLRRAAERFQVSPTTAKRWADRYRTVGTAGMSDRS
SRPHRSPTRIPTRTERRIIKVRLLRRWGPARIAYLLGLHPSTVHRVLARYRMARLRWLDR
VTAAPVRRYEHCAPGELVHVDIKKLGNIPDGGGHRVVGRRAGARNRTSTPGKTLRSNGKS
HVGCSYLHNAVDDHSRLAYSEILPDERKETAVMFWRRARKYFASKGITVKRVLTDNGSCY
ISQLWRAELATTGITHKRTRPYRPQTNGKVERFNRTLLEEWAYARPYRSETERRAAFTDW
LHAYNHHRGHTALGGHPPASRVPNLSGQY
>1210005.3:ALYK01000336_15831_16853__940_2
MNLHKHARLSPRGRALLVDRILVQGLRAEEAAHAAGVSVRTAYKWLKRFSQEGPDGLLDR
SSRPHHCPHATPQAVVDQVFEQRRARQTYRQIAEQLPVAPSTIARLLRRAGLHRLAELEP
APPTNRYEYARPGQLLHLDIKKLGRFRQRGHRVTGNRQINSRGGGWEYVHLAIDDHSRVA
FAAIEPDESGRSAGRALLLAVRYYRGLGVRFERVLTDNGACYRSRRFHRLVRRLGMHHLR
TRPYTPRTNGKAERLVQTSLREWAYARAYDSSEQRAHALGPWLHHYNWHRPHASLGYKPP
ISRIPLNNVLGLH
>1212819.3:ALWI01000028_72942_74035__601_26
LDDCSRFRVLAVYPRRNARNTLLFLDRVIEEMPFPIQRIQTDRGGEFFAESVKRRLINEC
IKFRPIPPRSPHLNGKVESSQLTDLNEFWSRHAPTEQAIDLRIEEWQFDYNWHRPHGSLG
GKTPVDRIAELGEITPLAEEVESACDERKERIQHREWRVDKILGEHHRRASEPVSPTVAA
GSDAQKKQPSRK
>1286373.5:contig000042_14689_15707__980_12
MDREIAKRLRWVKLFEETGHAGLVCLKCGISRPTLRKWVKRYAALGEEGLQEQSRRPKTS
PSKKIFAEQEALILKLRRERSLGHRRLASELKRNHGTSYSLATIHKVLQKNEVKLLGKRS
IRKPFIRYNRPIPGDRIQIDTCKIAPGLYQYTAIDDCTRWRVLRLYARRTAENSLAFLEC
MLEEFPFAFQRIQTDRGREFFAYKFQERLMKYGIKFRPIKPRSPHLNGKVERSQKTDLEE
FYPTVNLTAAEIHDQLSEWQHYYNWERPHGSLGGKTPIEQVVELSSKTPFWDDVGAQYDQ
AKERIQEQNYYADLQIRKLKRCL
>163164.1:NC_002978_160104_161114__946_2
MGQILHGCAKTTETIRRAIQNSKESIAKLSRYYNLNPKTIIKWRKRSFAKDADMGPKHAR
STVLTLEEEAVIVAFRKHTLLPLDDCLYALQTSIPHLTRSSLHRCLQRHSISRLPDVDGE
VKPKKKFKQYPIGYFHIDIAEFRTEEGKLYLFVAIDRTSKFTYVELHKSATKPIAAEFLR
NLIKILPYKIHTILTDNSVQFTNQKRHKYAFQHIFDRACEENDIEHRLTKVSHPWTNGQV
ERMNKTLKNATVKKYYYQSHQQLKEHLYDFVMAYNYAKRLKTLKGLTPFEFISLQWTKSP
ELFILNPHHHTLGPY
>216594.1:mar22d05.p1c_394177_393093__981_13
VSHRNARTTFHGRLLMVQRYRAGWFKARIAEAMGVSRKCVSTWIGRFEAEGMAGLLDRSS
RPHTMPTRTSAVLENQIVAWRRRQRCGPEEIAAKLGVSARTVSRVLRRRGIPYLRDCDPM
TGVVIRASKTTAVRYERARPGELVHMDVKKLGRIPVGGGWRAHGRGRGRGGNRNRRHGSG
FDYVHSLVDDHCRLAYSEILPDEKGATCAGFLRRAAAYFARHGIAGIEWVMTDNAWAYRY
SLGAVCTEIGAQQIFIKPHCPWQNGKVERFNRTLQTEWAYRQVFTSNAQRNAALAPWLKH
YNTQRRHGALGGLPPISRLQPTW
>266264.4:NC_007974_579550_580590__961_2
MHLRLHKNATTTPRIRAEIQVSKEPMRVLAQRFGVSVSTIARWKKRASVHDASHTPHRLQ
TTLTPAQESIVLVLRKSLGLSLDDLLAVVREFIHPTVSRAALHRMLKRHGVSAREALSVD
RPRTKPFKAYEPGFVHIDVKYLPQMADETTRRYLFVAIDRATRWVFVRVYASKSATNARR
FLKELHKAAAFRIRTILTDNGKEFTDRFITRGERTPTGRHQFDQLCEELGIEHRLTRPKH
PQTNGMVERFNGRIADILRTHHFHSGEELEATILRYVWLYNHQLPQKALGHVSPIQAMKQ
WQRSHPELFNRRVTNQPGHD
>296591.1:3634502_Cont19_3435_4460__943_2
MNIHKNASMTPKGRAHLVQEIARIGLKPAAAAAGLSPRTARKWQQRYAQEGRAGLLDRSS
RPLVCPQRSCASKIERAVRLRRTQRLTYERIAERVGLSRSAIARACKAAGAAKLPAFQNA
PPVVRYERASPGELLHLDTKKLHRFDKPGHRVTGDRTQNTPRAGSQALHVAIDDHSRVGF
SLLLPDETARCACAHLLAALRYYKALGVRVAQVMTDNGSAYKSKRFAKLLRRLGIRHIRT
RPYTPRTNGKAERFIQTLLREWAYAFIYPDSDARAHELEPWMHHYNFRRPHSATSHRPPA
SRLGFDGNNVVRNY
>314278.3:314278.3.fsa_15_187913_186853__967_2
MNIRLHANATTTPKIRRYIQRSEKTNRELAEELGIALSTVRIWRARQDVHDRSHTRHNLL
TTLSPAQEAIAVELRRTLQLPLDDLLVVVREFLNPGVSRSGLDRCLRRHGVSRLADLRPA
EQAKRPSKAFKAYRPGYVHIDYKYLPQMPDETARRYLFVVIDRASRWVYLELKADKSARS
ASAFLKAVREKAPFRIHRLLTDNDKAFTDRLQGKHRQASGEHRFDRLCAELGIEHRLAPV
RHPQTNGMVERFNGRISEVLATHRFDSRQDLEATLKRYCYLYNHHIPQKALDHRAPIQAL
KDWQHKHPDLFLRQVYNHPGPD
>388401.3:NZ_AAXZ01000001_168115_169114__933_43
MNKDQREIPRKLRVLRYAEEIGHVAKTCRYFGIGRASFYRWRKAYSERGEAGLINAQPIP
KWHANRTPPEREEKVLYLRRKYHLGPMRIVWYLARYHNIKISDATVSRILRRHGINRLPR
GTRMRKVHTKRYQKQVPGHHIQMDVKFLTFIGKEGEKVRRFQYTAIDDATRVRALKIYEK
HTQADAIDFTDHIIEKFPFRIREIRTDNGHEFQAKFHWHVEDLGIRYAYIKRGTPQLNGK
VERSHRSDGEEFYQLLSYKGDVDLEAKLDEWERFYNFHRPHGVHPGKTPYEALREKL
>398767.5:NC_010815_60521_61596__973_2
MTIRLHANATTTPRIRRYIQQSSKTDKGLAKELGISLDTVRRWRKRSEVHDHSHTPHRLP
TTLNEAQEAVVIELRRSLLLPLDDLLVVTREFIHPEASRSALDRLLRRHGVSRLADLIPK
EDETQAKPKTFKSYEPGFVHVDIKYLPQMPDETSRRYLFVAIDRASRWVYLELRKSKSAQ
AAKGFLERLVAKAPFKIHKMLTDNDKAFTDRFSTAGERKPTGNHLFDKACLKHNIEHRLI
PPRHPQTNGMVERFNGRISDVLATTRFDSAADLEATMLRYAHLYNQHIPQRALGHKTPVE
ALKSWQKSKPDLFHKQVRNHPGPN
>452471.3:CP001102_711423_712441__948_7
MGQLLHKCARTTEKTRREIQLSKESIATLARGYGVNRKTVAKWKNRTTCQDAAMGPKVRR
SKVLTQQEEGVIIAFRKLTQLPLDDCLYTLQETIPHLSRSTLHRCFQRHGCPKLEKVQTK
EKVAKKHFKAYPIGYFHIDIAQVQTAQGKLYLFVAIDRTSKFCYARLYPFASKSAAVGFL
QDLIAFVPYNIDKILTDNGVQFTNRKEGELGLEHMFDRICEQEGIVHRRTQLAHPWTNGQ
VERMNRTIKEATVQSYYYSSHQQLERHLNDFLLAYNFARTLKALKGKTPWQLIEEQWQKN
LTFFIKILIPSLRD
>551947.3:CAFK01000035_6_1053__964_41
MDTHKNAPLTPKGREVMVRSVIEGGLTKAAAALQFNVSAKTVTKWVKRFHEEGVDGLRDR
SSRPLSSPSQTLPATCAEVEALRRQRHTGKQIATEVGISPATVSRILRRLGLNRLRHLEP
AEPVRRYEREHPGELIHLDIKKLGKFNRVGHRITGDRTGQSSLRARGEGPGWEYVHVCID
DASRIAFSKVMKSERQGCAVAFLKAAIAYYTSLGVKVERVMTDNGSCYKSFAFRKACKRL
RLKHIRTKPYTPKTNGKAERFIQTSLREWAYARAYNTSKERAAELPRWLHRYNWHRPHGS
IGSMPPIS
>595537.3:NC_014931_5168011_5166993__934_2
MNSHKNARLTLEGRKLLVQRIAGMGLMPAAEAAGISPRTARKWLKRFQEDGVQGLHDRSS
RPARTRTSLDAALHERIEQLRRSRMPMRRIATIVGRSVSTVSRLLARLGLSSLKALEPIA
PIVRYEREAPGELLHIDTKKLGRIVQPSHRVTGDRRDATRGAGWEFAHVAIDDHSRAGFV
QMRDDERKGSAVAFLQAAVAHYAALGVTIKRLITDNGSAYRSRLFAKTCQALGIKHTFTK
PYRPQTNGKAERFIQTCLREWAYGRIWANSKERTTWLPAFLSYYNARRPHSALGYRPPAS
RLSGNNLLQLD
>652103.3:NZ_ADFI01000053_1_1031__949_2
MNIHKNARLTPIGRERLVQAVLSGQTPKAAAQAAGVCPRTARKWVARFKAEGRAGLADRS
SRPRRLYKPTPVATVEQVERLRRQRLTGKQIAADLGLSPATVSRILRRLGLNRMRDLEPA
EPARRYEYAHPGDMIHIDIKKLGRFDKIGHRITGDRTGQSNSRGVGWEFVHVCIDDASRV
AFSQIFADEKAVSAIAFLKAAIAYYASLGVTVRRVMTDNGSCYISTDFRNACHALGLKHI
RTRPYTPKTNGKAERFIQSALREWAYAQAYPTSTRRAEELPIWLHRYNWHRPHGGIKSQP
PISRLGLSEDNLLRLH
>661410.3:NC_012987_25839_24787__925_2
VRAAAKRHGISPTKVQKWRGRETVTDARMGPKEIRSTVLTLEEEAIIVAFRRHTLLPLGD
CLYALQPTSLHLRRSSLHRCFQRHDIARLPDTDGDKPKRSRFEAYTIGYFRIDIAQVSTE
EGKLNLFVAIDRTSKFAFVQLHEKATRRVAADFLRALIAAVPYTVHTVLTDDGTQFVDTT
PVSEEAEANAEAYWAERDEPRLYRWHPFDWACNQNKVEHRTTKPRCPWTNGQVERMNRTI
NDATVKRYHYGSHDALRPHLLLFVDAYNYRRRLKTLRGLTPYEFVCKTWTEQLARFKTDQ
SHHTMGPN
>993047.3:AEYZ01000386_1035_1__952_2
MDIHMNARLTPLSRAVIAHRVLMEGQRPMAVAAAFGVCVKTVYKWVRRYRREGEAGLNDR
SSRPHRLYHPTSQVTAARIETLRRLRMTGQHIAKETGVSPATVSRILKRLGLNKLKALAP
AEPVRRYERHQPGELIHIDIKKLGKFNRTGHRITGDRTGQSNSRGIGWEYVHLAIDDHSR
LAYLEILPDETRRSCLRFLFNALRFFKAHGVKVQRVMTDNGTSFRSHRYAKALRRLSIKH
IRTKPYTPKTNGKAERLVQTALREWAYAKAYETSQQRAADLPLWLHRYNWHRPHGSLQSK
PPVSRLGLIKDNLLRLH
>1001590.3:AFLW01000250_12497_13374__574_20
KLKKKH*NFMSALLKLELKEWQQMVALQELPKGAFTGPNPTDRGKRGIKRHILVDRRGAP
VAFVIAPAGTHDSKLLFPNLRNFRILRNSKVLKPEILSLDKAYANNAIKDKLKKRNIRYR
IPNKKNAKNPEWIAPLNPFRWTVERIFAWFNAFRAVKTCWEFKLKNYTALFQIAFAIILF
RMSCK
>1005462.3:AMTG01000100_8129_9323__1127_150
MSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFYPKAGNGRRPYPLETM
LRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQ
LFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAH
IGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWL
IAERPGKVRTLKQHPRKNKTAINIEYMKASIRAKVEHPFRIIKRQFGFVKARYKGLLKND
NQLAMLFTLANLFRADQMIRQWERSH
>1038927.9:contig24_8215_9445__862_239
DRTTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQR
DPEMHQTKKGNQWHFGMKAHIGVDAKSGLDPQALFQAEPCTKRAGLRISC*V*ICRFIGE
EPTHGPLREPIAGFTWMPHKQTRGLPR*GLDLADRRASRQGKNLKQHPRKNKTAINIEYM
KASIRAKVEHPFRIIKRQFGFVKARYKG
>1049920.3:AHNA01000200_1368_489__826_20
MKSELGHLDIPEEIWKRLRPLLPKIKTNPLKGGRPRLDDRVAMAAIFYRVRTGIQWRYIP
PMFGSKSTLHRRFQEWVAAGVF**KLKKKH*NFMSALLKLELKEWQQMVALQELPKGGLH
GSKSDGSRQKRH*KAYSRRSAWSTCSFCNRPSRNS*F*TIIS*FKKL*NIEKF*SFETGD
SFIR*GLC*QCN*RQIKKEEYSVSNSK*KECKKPEWIAPLNPFRWTVERTFAWFNAFRAV
KTCWEFKLKNYTALFQIAFAIILFRMSCK
>1079988.3:AGQQ01000024_166645_167611__851_69
VPALPSSIIDPLWCQFAALIPPVTDTHPLRCHRPRIPDRIIFDKLIQVLVLGASYAKIAD
TTCSATTLRTRRDEWITAGIFEQLEQICLEFYDRIVGLDLENLSVDGCIVKAPCGGEAAG
RSPVDRGKQGTKRSLLVDGAGIPLGCVVAGANRHDSPLLRPTLEKLGRFGLALPDQITVH
LDAGYDSSKTRSLLTELGCEWVISQKGVPLQAGARWVVERTNSWHNRGFKKLQVCTERRI
RVIEAFISLANAVIVVRRLVR
>1096546.3:AKFK01000027_865_5__489_10
PGQKRGSATGPNPTDRGKAGTKRHLVTDARGTPLGFRLSGANRHDSVMMAPTLDAIPPVR
NGRRGRPRHRPDKLHADKAYDAEPRRHECRARGIVPRIARRGIDSSERLGRHRWVVERTH
AWFSRFRRLPVRYERRADIYEAFTSLAASLITLNQIRRFC
>1109445.3:AGSX01000066_35680_36871__1127_150
MKQMTFADAEYAGKRKQTRKELFLIEMDQVVPWTGLVALIEPHYPKGEGGRPAYPLMAML
RVHLMQNWFGYSDPAMEEALYETTILRQFAGLSLERIPDETTILNFRRLLEKHELAAGIL
AVINGYLGDRGLSLRQGTIVDATLIHAPSSTKNQDGKRDPEMHQTKKGNQYYFGMKAHIG
ADAESGLVHSVVGTAANVADVTQVDKLLHGEENMVGADAGYTGVEKRPEHEGREVIWQIA
ARRSTYKKLSKRSALYKAKRKIEKAKAQVRAKVEHPFRVIKRQFGYVKTRFRGLAKNTAQ
LVTLFALSNLWMARRHLLTNAGEVRL
>165597.4:NZ_AADV02000009_924_2614__1495_32
GKLSPNNRWVIMAELIPWDDFEEEYAKLFSAEKGAPAKLFRMALGTLIIKEKLGTSDRET
IEQIRENPYLQYFIGLNCYQQEPPLESSMLVHFRKRIDGELINKINKKIVKREIDKSDKE
VKKKDCLQEKGEKIKNKGKLILDATCAPADIKYPTDLGILNQARIETERIIDNLYKPLRV
KLRKKPRTSRKIARKEYLKVAKKRKVSYQERRKAIGKQLKYLKKNLGNIEDLIQAGASLE
NLSKRQKNCLETIKKVYEQQQSMWENKTQSVPQRIVSLTQPHIRPIVRGKAGKPIEFGAK
LSVSCVDNYVFLEKISWENFNESCHLKEQVEKYKETFGYYPESVHVDKIYRTRENRNWCK
ERGIRISGPKLGRPPKNVSEEEKKQAHSDECFRNAIEGKFGQAKRRFSLNLVITKLPETS
IISIAITFLVVNLSKLLRQFLSLFLSLFTNNRTGELIKPPFINFDYT*NNFYVLKLIDLS
ENSWSKVA
>192.7:HE577328_1456793_1455942__471_10
EETGPNPTDRGKPGSKRHILVDANGIPLALRISPANRHDSKLLEALVDAVPAIRQCAGRP
RRRPAKLHADKGYDFAHCRQALRRRAIIPRIARRGIESSERLGRHRWVVERTLAWFARFR
RLALRYERRADIFTAFHNIAASLICWRFVQRWFC
>290633.11:NC_006672_55003_54100__840_268
MWTPAQRGRMAGITRKTKRYPSDLTDEEWERIAPLMPPANRRGRKRTTDFREIINALRYL
VRSGCGWEMLPVHFGPWQTVYWWFRRLMRRFLFQTIHDVCLMLDREAAGRETSPSGGVID
SQSIKAPHAKTRGYDAGKKIVGRKRHIAVDTDGRLLLVQLTTADISDSAGGQMILDAIRK
RWPWMKHLFAD
>313628.3:NZ_ABCK01000002_275758_278697__1474_8
MYKNTGSEPKMANLPYFLDGTLNINNRWVKLAAIIPWTDVEEIYALNFTSHTGPKALPAR
TAFGSLIIQVKLSLTDEETVEMISENPYLQYFLGFERYKQEAPFDSSMMTHFRKRFGAQG
IKDIDELLHTATRKKEEDSNDDSDNDPPSNKGSLIVDASCVPGDIHYPTDLGLLNKAREK
TEEVIDILWCHRSNTEDKVKPRTYREDGRKSFLSIVLKKRVSKKKRREVINRQLHCVRRN
LASIDELKKYADLTLLKPSLYRELLVIGTLYQQQQYMYDNKVTSVDDRIVSIHQPHIRPI
VRGKAGAHTEFGAKISISVVDGWTFTDTISFDSYNEGTELISQIEKYKERFGYYPESTHA
DKIYRNKENRAHCKKHGIRISGPSLGRPPKDEKLRKEQKDIQRQDEAIRNQVEGCFGVAK
RRYKLDRIFTKIKASSETLIALIFMVMNLDKALAFLSLFGQYYKQLLEHFLNFISLISQG
EHLKRRVIQ
>329726.14:NC_009933_118610_117701__826_38
MSKAYSSNLTLSQYELIAPLIPPAKPGGRPRSVNMWAVLNAIFYLVSQGCKWRDLPGDFP
CWSTVYTYFRNWRIDGTWVKIHDRLCSWVRADNDRPASPSQAIIDSQSVPTATMVNQAVG
FDRAKYTKGRKRHTAVDTLGLVLRVVVTAASLPEREGGKKVLTAVHQMAEAVQRLYLIWA
DGGYSGQPFLQWAMDNFRWVIAVVLRPEQTKGFVLLKKRWVVERTFGWFNWYRRLSKDYE
RLTDSSEAMIYICMIRLMVRRLA
>363754.4:AQHN01000086_79149_78219__854_81
MGWTDFTRRQYARRASRYASDLTDREWGLISPCLPGPRRLGRPRRTDLREVVNALLYIAS
TGCQWRMLPKDFPPFTTVQAYFYEWRAMGLWGRINHRLVMETRELEGRQASPSAGVIDSQ
SVKTTESGGISGYDAGKKLKGRKRHIIVDTLGLMVGLIVHGADIQDRDGAFGLLKSIRHR
WPWLRHVFADGGYAGDKLKGRLAKFGQWTIEIVKRSDKAKGFTVLPRRWVVERTFAWLGR
CRRLAKDWEKTIASAEAW
>381666.6:NC_005241_25891_22859__2959_2426
MKQMTFAAGADQEAGFEQYRKPTRRETFLAMMETIVPWAALCAVIEPYYPKAGNGRPPIG
LERMLRIHFLQHWFNLADLACEEALYDSASLRRFVGIDLGREPVPDASTLLKFRRLLEKH
QLAERLFAEVGRVLQTNGVKLKTGTIVDATIIGAPSSRKNEEKSREPEMHQTRKGKQW
>441620.7:NC_010725_2600336_2599446__837_16
MWTNADRETYRDRSSRYPSDLTDAQWATVAPLLGGYDPLTADLREMVNACLYLEKTGCPW
RYLPTDFGPWETVRTWHDRFRADGLWSEIAGLLTRAVRQKRGRPAEPRTAILDSQSVVSG
PQAGVRGTDGKKKVRGIKRHVLTCSRGFVLAALVTAANVHDTQAAGWLFDRAAQAGWAPE
RVKVDGIYTGARMDEAAARHGLDVQVSTRPPEVKGFEPLPLRWRIEATFGTLSTRYRRLT
RHWEQSPAAAEDAISIANCHRLLRAYHREQDCAA
>648885.3:AMXU01000078_360450_359526__828_13
MWTPAARAERARESLPYASSLTDTEWALIAPLLPEPSRAGRPWRWPLRAILDGIRSVLRT
GCAWRHLPLDFPPWSTVHRWFLRLSKAGVFERLAHALTLADRERTGREASPTGAILDAQA
ARSGGVGLKGERGYDPARRVVGRKRHALTDTDGRLLLAAVSTADRHDSHGGVALLQAARR
LWPFLAHCFADQAYQGERVGNATAITVEIVRPDKGQKGFAVQPRRWVIERTFGWIARCRR
LARDYEATPSSALAFVVLAAAMILVRRLAKPL
>68909.1:3634504_Cont102_24004_24879__814_53
VNRRAYPSDVDDETYHFLLPYLALSPEDAPQRKYPLREVLNALLWISRTGAQWEYLPHDF
PPPKVVRSQAKRWFEAHCFENAVHDLRLFSRIQQQRGQEPTAIILDSRTLQSTPESGHRA
GYDGAKRRKGTKVHLAVDTLGHLVALMTTPANEQDRAQVEALCLAAQETTGGMLELAFVD
QGYTGEQPLEAARKGNIELVVVKRPDASRGFVLLPKRWVVERSFAWLSRFRRLGRDLERL
SSTLIGFHFVAACV
>1000590.6:AGUC01000112_14118_13329__734_63
MNYFRYKQFNKDVITIAVGYYLRYALSYRDISEILRERSVNVHHSTVYRWVQEYAPILYQ
IWKKKHKKAYYKWRIDETYIKIKGNWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRL
IKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDYRHIKVRKTRY
QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
>1001989.3:AFAT01000119_1_820__757_56
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEK
RLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLG
KILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLK
RIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>1002366.3:AGCN01000011_843_32__735_58
MNHFKGKQFQKDVIIVAVGYYLRYNLSYRDVQEILYNRGINVSHTTVYRWVQEYGKLLYN
IWKRKNKQSIYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRL
VKQFDEPRVLVTDKAPSIASAFKKLQAHGFYQRTEHRTVKYLNNLIEQDHRPIKRRNKFY
RSLRTASTTIKGMEAIRGLYKKNRKEGTLFGFSVCTEMKILLGIPA
>1029825.4:CP002931_1796564_1795750__740_57
MAIDFKGAHFPKNVILYAVFFYVRYPVSYRDLQEILAERGIEVDHATLNRCVVRYSPQIA
TQAQMRKRHTAGSWRVDETYLKVRGKWVYLYRAVDRDGQTLDFMLSERRNVGAARRFFKK
AITSSGVPHKIVIDKSGANLAGAQAVNNILKITGADKLIEILQVKYLNNILEQDHRFIKR
ITKHMLGFKAFHSAAATIAGIEVAHMIRKNQFANDNCSPFKVFAELTA
>1053201.3:AHDV01000062_64720_65583__771_79
MKKETLFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSLAHTTIMRWVHQYGPE
LDKRIRRHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSEGNTIDFYLSKSRNHKAAKRFF
KKALRSFHVSKPRAITVDKNPAYPIAISGLKKEKKMTLGIQIRQIKYLNNIVEQDHRFIK
KRIRSMLGLKSFRTATFILAGVEAMHMIKKEQIDLRDQSVQNQKQFIHQLF
>1053233.3:AHFB01000152_6251_7058__743_72
MRYFKGKQFKKDIIVIAVGYYCRFSLSYRDVSEILKERGVSVHPTTIMRWVHEYGNLIYQ
IWKKKNKSAHFVWHLDETYIKVKGEWCYLYRAIDREGYTLDIQLRKTRDHQAAYMFMKRL
VKAFGEPTVLTTDKAPALLCALKKLKHNGFYVHTKHCTVKHFNNLIEQDHRHIKRRFAKS
AGFQTLRYASRIIKGIETIHAIYKQNQSSQPNFGFSTYNELQQL
>1205683.4:CAKR01000057_810_1__748_56
MPLIRNAFKRLHYPVDIIVQCVRWYLAYALSLRNIEEMMAERGIAVDHSTLHRWVIRLVP
LLDKAFRRHKRSVGSRWRMDETYIKIKGQWKYLYRAVDTAGQTIDFLLTAKRDAAAALRF
FRKAIRYHNEPEVVTIDKSGANTAALATLNADKAEDETITIRQSKYLNNLIEQDHRNIKR
RTRLMTGFKSFRRAQTILAGIELIHMIRKGQYRHLQSEGLSAAEQFYLLAA
>1310164.3:AQPS01000035_2_842__787_80
MGIFSGWQFPREIILWAVRWYCRYGVSYRDLEEMMTERGVPVDHTTIYRWVQKYAPELDK
KTRWYRQVPDWQARSWRVDETYIRVGGKWCYLYRAITAGGQTLDFYLSPKRNVAAAKRFL
AKTLRSNKSAGYPRVISTDKAPSLARAISELKAEGVCPSTVEHRRVKYLNNVIEGDHGRL
KRILGPKGAFKNRTSAYRTLKGMEAMHSLRKGQGTMFAYGHPNPDAVIVSRVFETA
>316275.15:NC_011311_57007_57867__795_58
MTNPDFKWKHFAPEIILWCLRWYGSTPMSYANLSDMLAERGISVNRSTIYRWFIEYSPKL
RKKLRRNYQFIKTDSSWQLDETYVKVKGKWHYLYRAINKQGETLDFYFSHKRNKEAAYQF
LKRCLRYYDIDNQPKTLNTDKHSSYANAIARLKKEGRLREDVEQRQVKCLNNGIESDHAP
IKKLIVAAGGFKLRKRAWSTIQGFESLRMLNKGQFDFWLRNDKRKTVVRERSAFINRLFN
VEVIFE
>319795.16:NC_008010_262071_261325__711_22
VTDRKPYRHRFPLNVIGYALWLYHRFPLSQRDVQELLHERGIQVSHATLRQWNMKFAPLL
TKELRHREPRRGSRWHLDEVCVKVGGVKHWLWRAVDDRGDVLDILLQEHRDTEAAKSFFV
RLLSEYDVPEVIHTDKLWSYGAAPRELPVLRTAEHVQVVSTSRCNNLVEHSHRPTRQQER
AQLGFKRRPRTQEFLAPHARVSNLHRQTRTTVPATHRRRNQTAALLLRPR
>326424.13:NC_008278_2716357_2717182__766_92
MRRRRGCPPVPVSEFAGFRFPPEAIVLAVRWYLRFALSYRDVEELLAERGLEVDHVTVYR
WVQRFVPLLAEAARPCRHRPDDRWFVDETYVKVAGRWTYLYRAVDQHGQVIDVFASERRD
QTAARRFFTRALSHGRRPVEVTTDKAAVYPRVLDELLPEACHVDAARENNRIEADHGRLK
ARLRPMRGLKRLRSVQTVSAGHALIQNIRRGHYELAIDAHPPLRL
>329726.14:NC_009932_40115_39270__768_61
MKTADLFKWRHYQSEIILLNVRLYCRYPLSYRNLEEMMMERGLEVDHSTINRWVLQYSPE
LDKRCRRHLKPTNDSWRVDETYVKIRKKWRYLYRAVDSDGYTLDFLLTAKRDTKAAKRFL
TKALNAVHTHEPRVINVDKNPAYPPAVEQLQEEERIPEGETVRQVKYLNNIVEQDHRGIK
RLVNPGMSFGSFNSARRTLKGYEAMNMIRKGQINNVGKDDVMGQISFINQIFGLAA
>398261.3:ARAA01000025_5557_6448__699_64
RYALSYRDIEEMFLERGMEVDHSTINRWVLACAPAIERRLRRFRQPHCGSVRVDETYVRV
RGQWRYLYRAVDKHGQAVDFLLTANRDLEAAKRFFRKMLSAEPLLAPDRIGTDGAGPYPP
AITESRKEGLLPRTPIHHVSKHLQQGIESDHFRVKRPMPRVGGFRSFATARRSIQGLEAM
LWLRKGFGFSGAWTVREQNQLVASCFGLAVTN
>460265.11:NC_011887_75799_74984__753_55
MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITVTYESIRRWVLTFGPTI
ARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVLDVLLQTKRDRRAAQKLMR
KLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKRANNRAESSHVPVRRREAKLQ
GFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFRAEAFAMWRGAAGVPA
>527002.3:NZ_ACCB01000059_12933_12120__751_56
MPLIRKAFRRLHYPHRYY*PECSLVSRLCPQPA*SRGDDSRARYYS*PLHATPLGHPSGA
LDG*SLPLTPTFNRALMAHGRNLHQNQRPVEISVPRGGYFRPDHRLSADRQTGCRRSPAF
LSQSHSTPEGEPEMVTLDKSGANTAALTTLNADKPEEETITIRQNKYLNNLVEQDHRNIK
RRIHLMLGFKSFRRAQTLLAGTELIHMIRKGQYQHPQNEELSPAEQFYLLAA
>1001736.3:AKUG01000001_114267_111972__1672_8
MIVALRTRAQAQKVAGLTSGVQLAGKPKLDGTQTLSRCVDVGADFEAHRTAVESVSVLFE
LYDGDATSYAQSGSPGAQLPTGWIVTAAKFEVDWPADEERAGLVRSHFGARRKAFNWGLG
RVKADLDAKSLDPGYESVRWDLGSLRKAWNRAKDEVAPWWAVNSKEAYSAGLADLAQALS
NWSASRNGTRQGRRVGFPRFQSTRRDPGRVRFTTGTMRLEADRRTITLPVIGGLRAKENT
RRVQRHVASGRARILNMTLSQRWGRLFISISYALRTPATARTPAQPTVRAGVDLGVRTLA
TVATIDTATGAETVVEYENPAPLKATLAARRKAGRELSRRIPGSLAYRAAKTKLTRLDRR
CVHLRREAAHQLSTELARTYGQVVIEDLDVAAMNRSMGRRAFRRSVSDAAMGLITPMLAY
KTVGHGSILTVADRWFASSQIHHGCYLPDGTPCRLVGKGRIDKHLICPITGEVVDRDRNA
ARNLRDWPDYASCGPVGTTAPSAPGPTTVGTGHGADTRTPDAGGASVRPRHAGPDAARPE
PKPRKGTPHERATQT
>1078763.3:BADQ01000012_47180_49069__1244_24
MARFEVPEGWCVQAFRFTLDPTEDQARALARHFGARRKAYNWAVATLKADIEAWRVTGIG
TVKPSLRVLRKRWNTVKDEVCVNAETGAVWWPECSKEAYADGIGGAVDAYWNWQNSRSGK
REGKTMGFPRFKKKGRDQDRVTFTTGAMRVEPDRRHLTLPVVGTVRTHENTRRIERLIAT
GRARVLAISVRRNGTRLDASVRVLVQRPQQPNVAQPGSRVGVDVGVRRLATVANEAGAVL
EEVPNPRPLDAALKELRYASRARSRCTKGSRRYRERTTEISRLHRRVNDVRTHHLHVLTT
RLAQTHGHIVVEGLDAAGMLRQKGLPGARARRRGLSDSALGTPRRHLSYKTGWYGSALVV
ADRWFPSLSVEPTVRPGLARLVAVKRGREAAAWLPNNPETGCKSRDH
>1005396.3:ANLH01000428_12540_11404__1016_24
RDE*RLMQKAIYKTHDKNYARRLTAMLMLHRSARVSDVARTLCCARSSVRRWINWFTLSS
VEGLKSLPAGRSRRWPFEHICTLFRELIKHSPGYFGYQRSRWSTELLAIKINEITECQLH
AGTVRRWLPLVGLVWRRAAPTLRTRNPHKAAIHKALDECSAEHPVFYEDEVYIYLNPKTG
ADWQLRRQQKHVVTPGQNEKYYLAGALHSGTGKVSYVGGNSKSSALFISLLKHLKLTYRR
DKPITLIVDNYIIHKSRETQRWLKENPKFRVIYQPVYSPWVNHVERL*QALHDTITRNHQ
CRSMW*LLKNVHYFMETVSPFPGGKYGLLKV
>1144320.3:AKIU01000001_34253_35402__1049_306
MPIKAPISRIERRLMQKNIHKTCDKKIMPADSLPC*FWTGRLCQRCYQNALLRTFIHRLL
D*GFTLSGVEGLKPLPAGCSCRWPFEHLHTVT*TDKAFSRRFWL*RSNWSTQLL*IIINE
ITGYQLHVGTVRRWLPAAGLVWRRAVPTLRVSDRNKDEKMAFIRTALDECSTEHPVFYED
EVAIHLNPKICADWQLRGR**CVVTQGQNKKYYLAGALHSGTGKVSYVSGNSKS*SLFIS
LLRHVKST
>1169371.3:ANZA01000092_5045_3913__701_24
KINEITGCLLNAGTVRRWLPSAGIVWLRVVPALRIRDPHKDEKMAAIHKALDECSTEHPV
FYEDEVDIHLNPKIGADWQLRGQQNG*SRRDRMKNIIWPERCTAGQVKVSHVGGNRKNSV
LFISLLKRLKATYCRAKTSTLIVGNNIIHKSRETQRWLKENPKFRGIYQPVYSPWVNHVE
RLWQTLLDTIMCNHQYRSMWQLVKKVRHFMETVSPFPVGEHGLAKV
>1306162.3:CAVM010000100_4_1157__1053_46
MPIITSIPRNERRQMKKAIQKTRDKDYARRFTALLMLHEGSTVSHVSRTLHCSRSSVHRW
VNWLTLYGLEGLKSLPAGRPAIWNLAPLFTVISFLLQHSPQHFGYLRSRWSLELITLKIN
ELLNTSLSQSTLYRYFCRTGIVWRRAAPTVKLPDPEYDEKMAKISETLSNASEKHPVFYE
DEVDINLNPKIGADWCFKGQQKRVVTPGKNQKHYLAGCLNAKTKEITYVGSLRKNSDLFI
KLLDEINNQYVNAKTITLILDNYCIHKSRKVRVWLAKNPKFNLLFLPTYCPWLNKIERLW
QSLHETVTRNHCCQFMWQLLNHVKIFMETASLQQQK
>1005395.3:AMWJ01000198_12874_9918__2121_616
MTCATDFLPDDIQALKALVTAQRGEIEHLKLMIAKLRRMQFGRRSEQLDGMLDQLQLTLE
ELQVSQAALASPPPAQSRPRTPVRRKPLPEHLPREIHVHRPDAQCPGCGGELRHLGDDVA
EVLEYVPARFKVIRHVRPKLACRCCDGIVQVPAPSRPISRGLAGPGLLAHVLVSKYVDHL
PLYRQSEIYAREGVSLERSTMADWIGEASRLLQPLVSRLRQHIMAANKVHADDTPIAVLA
PGQGKTKTGRLWTYVRDERPAGSSTPPAVWFAYSPDRKGEHPRAHLRGFAGTLQADGYAG
FAQLYASGTIHEAACWAHARRKFFDLHKALASPIAAEALQRIGALYAIEAEIRGQPPDQR
RAVWQRRASPLLAHMHIWLNHTLTQLPPKSALSGAIHYALARWQALTRYCADGRIEIDNN
AAERALRAVALGRKNFLFAGSDAGGERAAAIYSLVGSAKLNALNPQAYLTHVLERIADYP
INQLDDLLPWNIALPTLEHEAA
>1005462.3:AMTG01000093_36170_38701__1644_34
MSQKYLIRIAELERLLSEQAEALRQKDQQLSLVEETEAFLRSALTRAEEKIEEDEREIEH
LRAQIEKLRRMLFGTRSEKLRREVELAEALLKQREQDSDRYSGREDDPQVPRQLRQSRHR
RPLPAHLPREIHRLEPEESCCPECGGELDYLGEVSAEQLELVSSALKVIRTERVKKACTK
CDCIVEAPAPSRPIERGIAGPGLLARVLTGKYCEHLPLYRQSEIFARQGVELSRALLSNW
VDACCQLMTPVNDALYRYVMNTRKVHTDDTPVKVLAPGQKKAKTGRIWTYVRDDRNVGSS
SPPAVWFAYSPNRQGKHPEQHLRPFRGILQADAFTGYDRLFSAEREGGALTEVACWAHAR
RKIHDVYISSKSATAEEALKRISELYAIEDEIRGLPESERLAVRQQRSKVLLTSLHEWMV
EKNGTLSKKSRLGEAFSYVLNQWDALCYYSDDGLAEADNNAAERALRAVCLGKKNFMFFG
SDHGGERGALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVDELLPWNVVLTNK
>1005531.3:AKMJ01000525_25019_27722__1602_34
MDTSLAHENARLRALLQTQQDTIRQMAKYNRLLSQRVAAYASEINRLKALVAKLQRMQFG
KSSEKLRAKTERQIQEAQERISALQEEMAETLDEQYDPVLPSALRQSSARKPLPASLPRE
TRVIRPEEECCPACGGDLSPLGCDVSEQLELISSAFKVIETQRPKLACCRCDHIVQAPVP
SKPIARSYAGAGLLAHIVTGKYADHLPLYRQSEIYLRQGVELSRATLGRWTGAVAELLEP
LYDVLRQYVLMPGKVHADDIPVPVQEPGSGKTRTARLWVYVRDDRNAGSQMPPAVWFAYS
PDRKGIHPQNHLAGYSGVLQADAYGGYRALYESGRITEAACMAHARRKIHDVHARVPTDI
TTEALQRIGELYVIEAEVRGCSAEQRLAARKARAAPLMQSLYDWIQEQMKTLSRHSDTAK
AFAYLLKQWEALNVYCSNGWVEIDNNIAENALRGVAVGRKNWLFAGSDSGGEHAAVLYSL
IGTCRLNNVEPEKWLRYVIEHIQDWPANRVRDLLPWKVDLTSQ
>1038927.7:NODE_595_length_27042_cov_16.682974_7336_4766__1644_34
MSQKYLIRIAELERLLSEQAEALRQKDQQLSLVEETEAFLRSALTRAEEKIEEDEREIEH
LRAQIEKLRRMLFGTRSEKLRREVELAEALLKQREQDSDRYSGREDDPQVPRQLRQSRHR
RPLPAHLPREIHRLEPEESCCPECGGKLDYLGEVSAEQLELVSSALKVIRTERVKKACTK
CDCIVEAPAPSRPIERGIAGPGLLARVLTGKYCEHLPLYRQSEIFARQGVELSRALLSNW
VDACCQLMTPVNDALYRYVMNTRKIHTDDTPVKVLAPGQKKAKTGRIWTYVRDDRNVGSS
SPPAVWFAYSPNRQGKHPEQHLRPFRGILQADAFTGYDRLFSAEREGGALTEVACWAHAR
RKIHDVYISSKSATAEEALKRISELYAIEDEIRGLPESERLAVRQQRSKVLLTSLHEWMV
EKNGTLSKKSRLGEAFSYVLNQWDALCYYSDDGLAEADNNAAERALRAVCLGKKNFMFFG
SDHGGERGALLYGMIGTCRLNGIDPEAYLRHILSVLPEWPSNRVDELLPWNVVLTNK
>1038927.8:NODE_508_length_27066_cov_18.442364_19761_22355__1056_34
GPRITCPRVNGKILRTXXXXPLYRQSEIFARQGVELSRALLSNWVDACCQLMTPVNDALY
RYVMNTRKIHTDDTPVKVLAPGQKKAKTGRIWTYVRDDRNVGSSSPPAVWFAYSPNRQGK
HPEQHLRPFRGILQADAFTGYDRLFSAEREGGALTEVACWAHARRKIHDVYISSKSATAE
EALKRISELYAIEDEIRGLPESERLAVRQQRSKVLLTSLHEWMVEKNGTLSKKSRLGEAF
SYVLNQWDALCYYSDDGLAEADNNAAERALRAVCLGKKNFMFFGSDHGGERGALLYGMIG
TCRLNGIDPEAYLRHILSVLPEWPSNRVDELLPWNVVLTNK
>1078033.4:AGTK01000212_14684_11807__2088_514
MNIHA*CHIIHRMDISLLSTTSDPEQLRALAIAMVQKVMAENAELQNRIRILEEQMKLAR
QQRFGKKCESLAGMQRSLFEEDVDADIAEISAHLDKLLPQTGDEEKTTTRPVRKPLPSPL
PRAEKVIPPAEERCPDCDAPLHFIRDEVSEKLEYIPAQVVVNRYIRPQYSCPCSEKVFSG
KMPAHILPKSAVEPSVIAQVVISKYTDHLPLYRQQHIFSRMGVELPVSTMADMVGVAGAA
LAPLAKLLRHELLTRDVIHADETSLRLLDTRKGGKSCSGWLWAYVSGERSGPPVVCFDSQ
TGRALRYPEAWLQGWHGGTLVSDGYNVYKSLADNHPGITSACCWSHARRGFANLYKASRE
PRAAMALRKIAGLYRIEKLIRERPVEKIRQWRQRYSRPIVNDLFAWLEEQEPCCPPEGPL
NKAINYILNRRDELSCFLGDGAVPLDNNICERAIRPVVMGRKAWLFAGSLMAGNRAAQIM
SLLETAKRNGLEPHAWLTDVLTRLPEWPEDRLEELLPLEGFTFSG
>1081940.5:AGCS01000021_15036_17418__1567_35
MTFSPNLDQMTPEQLRALAAQALQLQSQVEAMSRKIQNDEILIEQFKFEIALLKRHKFAK
RSEQISPAQSSLLDDLLDTDLEAIEAELKQLLPAAPQSEPRQSPKRAPLPPQFPRTVIRH
EPENTQCACGCQLQRIGEDVSEKLDYTPGVFTVEQHVRGKWACRQCETLIQAPVPAQVID
KGIPTSGLLAHVMVAKFADHLPLYRQEKIFGRAGLAIARSTLAQWVGQTGVRLQPLVDAL
REAVLNQGVIHADETPVQMLAPGEKKTHRAYVWAYSTTPFSALKAVVYDFSPSRAGEHAR
NFLGDWNGKLVCDDFAGYKAGFEQGITEIGCMAHARRKFFDLHVANKSQLAEQALHSISG
LYEVERQARDMSDEDRWRIRQELAVPISKTLHEWMLAQRDLVPNGSATAKALDYSLKRWV
ALTRYLDDGAVPIDNNQVENQIRPWALGRSNWLFAGSLRSGKRAAAIMSLIQSARMNGHD
PYAYLKDVLTRLPTQRASEIGQLLPHQWVPA
>1090946.5:ARDP01000019_2561_1__1663_65
MTRAGTPTVAELMALLAANAAENVALRAERDALEQRVFKLEEELALAQLHRFAPRSEKHM
DRVFNEAENAALEADADEGLADCDDTDATELPDTGLPEVEKPEGRKRGRKPLPANLPRQR
VEYDLADDQKTCPCCRHPLHRMGELVTEQLHIEVKATVLQNARAKYACRNCERTDISTPV
IIAPMPAQPLPGSIATASTLAFALVHKYVDGTPLYRLAQAFERAGVPVSRGALGHWVIGS
SEKHLVRIYDALKQRLLSQSVIHGDETTVQVLKEKDRKATDESYIWAYRSGKDSLEPVVL
LEYQPGRGQVHPQTFLGDYRGILMSDGYQGWRTLKGATHVGCMAHARRRFVNAFKAGKKQ
SGPPAQALKFFDQLYRIERQVRDEKPDDGETQADCIRRLRQKHSVPVLDALKEWLDRMAP
KVVPDTKLGDAISYTRNQWQYLTRYTEDGRMPIDNNLLERDIRVFATGRKSWLFCDTVDG
AKASAVIYSLMLTCRACGVEPFAWLRHVFSESPQRPDGANIDDLLPFNFAKST
>1120929.3:APPY01000048_8734_13229__3620_2454
MNTLPDLSQLTHEQLLEFTRQLAMQHQSLAQSNQQLDARVQHLEVTNQQLDSKVQHLSIL
NQKYEHELALFKQHKFGSKNEHLTAKQIHLWDEAVEEDIAAVDLELERLNADKTNAATQK
AKTNKPKRRPLPDHLHTIRIEHEPASTQCACGCQLRRIGEDVSEKLHFRPAKFYKEQHVR
GKWVCDQCDTLTQQAMPAYVIDKGIASPELLSHVLVSKYADHLPLYRQRLIYQRAGIDLS
RSTLSDWIGRCGVELEPLANALKQVVLQQRVIHANETPVTIIRMGENEKKPKKGYVWAYA
TTQYNPVQAVIYDFQDSRSGQHAEEFLNGWQGHLVCDDYSGYKARFKSGQVIEVGCMAHA
RRKFHELHVTKKSQVAEQALVLIQKLYAI
>1194707.3:AKZZ01000195_7778_10902__2196_625
MPLRPDPLPQDAKQLTRIILSLDAENADLKARVAFLEGQLFGPKSEKMTTIDPTQAVLDL
GDLSDIPVAANDDVAPIVDQASQARRAPSRNIGRLPKHLPRYDEIIEPESKVCPCCSFDL
HCIGEDISEALDIVPAIVRVKRTIRPRYACRACESVVVQAPAPARVMDGGMVTTAFAAHV
AVSKFAWHLPLHRQAQMLASCGVVIDRGTLGAWVTRVAWWLELLYDALTAFILSQPRVFC
DETPLPRLDPRRKRTKLCQLWAQAVDDRPWNGPAPPAVAYTFAESRSAREVEGQLSSFAG
VLQVDGYQAYKTLAKRRGKSNVAPMRLAFCLAHARRKFVDVVKLTGSSEALSILARIAEI
YRIEAKIRGESADTRLRVRRREAAPIMSELKAQLTELSDEVSAKSALGKAVTYTLNHWNG
LAAFLEDGRIEVDSNVVERSMKSVALTRKNSLFVGSARGGETFAVLASLINTAKLNGVDP
EVWLADVLERIISGKVKANRMESLLPWAWKAEREDIADQERRAA
>1262469.3:APHV01000298_10449_13066__1655_51
MPATTDPLPTDIETLRAIIAAQASELAAERRRREASEAELAAAKAGLVAKALEVERLKVQ
LARLRRIQFGRSSEKIDREIDQLELALEDLEAAAAAEGMPADPAEPRASSPESRTRAGRR
KLPEHLPRTEIVHAPFDACPSCGGALRQVGEDVREVLDYIPARFTVIRHVRPALSCRCCE
GMVQAPMPSLPIERGLPSAGLLAHVLIAKYCDHLPLYRQSAIYARKGVELERSLLADWVG
KAAALMAPLAEAIGRHVLAGSVLHADDTPVLDPGRGKAKTGRLWVYLRDERPHAGQDPPA
VLYRYTPDRKGEHPQRELAGFRGHLHADGYAGFDALYEAKGGHPAAVAEVACMAHVRRKF
FDEHAETGSPLAADALKRIGRLFDIERPLTGWPAEERRRVRQAQAQPVLNELAAFLETTL
ARIPGKGDLAKAIRYARSRWTALTRYVDDGRLEISNNAAERAIRPLAIGRRNWMFAGSDV
GGERAAAIYTIVESAKLNSLDPQAYLRHVLGRIADHPINRIADLLPWIITIPDQG
>187272.10:NC_008340_1751870_1749551__1630_41
MKSAAIQPDRDVSRLQRQVAELEKKLAEKDALLATKEAHWAARECSMFEQIRLLLDSRFG
PSTERYHVDQQQLQFDEAEQYADAPVTEPEAEAAQAGETAPSVPAKRRNRGGRVRLPAEL
PRVEVVHDIPEAQRYCPHGGSELTCIGEEVTEQLDVIPARVQVRRHIRRKYACRCCEEGV
HTASMPPQPLPWSMASPGLLAYIATAKYEYGLPLYRQAKGFERKGIPLPRNTLARWMVGI
GELLTPLGQALQDHLLAQPLIHMDETTVQVNTEPGRTASSTSYMWVQRGGPPGEQVVRYD
YDTSRSGRVPRRLLGDYAGVLVTDGYEGYAQVVRENGITHAGCWAHARRKFVEAQKVQPK
GKTGKADWALSLIGKLYRVEREGKTLDPEDRLVLRQRQSRPLIDKLQRWLEKSITQVPPK
TAIGKALRYLQTQWPRLTRFLDDGRIPLDNNPAENAIRPFVVGRKNWLFSHTTQGASASA
MIYSVIETAKANGLEPYEYLEDVLTRLPAADTDQAIHALLPWNWGKTIQA
>216591.1:Bcep436g06.p1c_191290_193739__1589_39
MNPADLDALNPEQLRALAAQLIAEVKEKEREASERDRELRFRQTRIDQLTHEVSILKRQQ
FGRRSEQLNSEQMNLLDEAIDGDLVAIEMELEQLEPTRAERQREQPKRALLPPQLPRTDV
HHEPDSTTCQCGCERIRIGEDVSEKLDYTPGVFTVERHIRGKWVCKACETLIQAPVPPHV
IDKGMPTAGLLAQVLVAKYGDHLPLYRQEQIFGRAGLAIPRSTLGAWVGRCGVQLQPLVD
ALGQAIRQQAVLHADETPVQMLSPGKGKTHRAYLWAYTSTQFSELRAVVYDFAESRAGAH
ARTFLKGWHGKLVCDDYSGYKASFQHGITEIGCAAHARRKFFELHANHSSQVAGQALPFF
TALYDIEREAAALDADERQRLRQRRAKPVCDALYEWLMAQRKLVVEGSAIAKALDYSLKR
WDALTRYLDDGNVPIDNNWVENQIRPWAVGRSNWLFAGSLRAGQRAAAIMSLIRSAQLNG
LEPLAYLKDVLTRLPTHKANDIDALLPHRWQPLSAAA
>216596.1:rhiz758g10.p1k_44257_41758__1498_26
EARNADADERIERLTQILKAFDRARFGRRSERLASSTVDDEQHAFVFEEIETGIATIKAQ
VTKGRGSADSKRAPRPRKGFAPHLERVEVVIEPEELPEHAGKTKILIGEDVSERLDVVAA
KFRVIVTRRPKYAFRNEDGVVQAAAPAHIIEGGIPTEALLAQIAVSKYADGLPLYRQEAI
YARDKVELDRKLMAQWMGKLGFELNILADYILDEIKKAERIFADETTLPTLAPGSGSAKT
AWLWAYARDDRTFGGSGPPMVAYRFEDSRATECVARHLNGYRGILQVDGYAAYNKLVRKD
GGNNSAILAGCWSHSRRKFYELHVAKSSKVATDTVERMARLWEIEERVRGQSPEARVAAR
QEISAAIVRDLFTLWQATLPRVSGKSKLAEALRYAISRRDIFERFLTDGRIELDSNIVER
AIRPQAITRKNSLFAGSDGGGRTWATIATLLQTAKMNAVDPQAWLTQTLERLANGWPNSE
IDALMPWNYAA
>240016.6:NZ_ABIZ01000001_2016787_2019232__1526_45
LIAELRGELAAVRLENKLLRLKLDALSRRMFGKSSEKLDAEQMQLLLDGIEELTLAEESA
RQTRPGREPSTPEPARERKPRIPEHLPVKEVFIDPEEVKACPEDWVHIGEEVTEQLEYTP
ASFERLRIIRRKYVRKDQRHLPPVVAPLQPCLQERCVAAPSLLAHSMVSRYRDHLPWHRL
EGIYAGLGVEISRQTLANWSGMTAEACGLLMREIHQSVFASGYVQLDETPIEYLSPGHGQ
TKTGYLWVAHSPLTQETFFQWHTGRAAFCLESLVPAGFEGIIQCDGYAAYASFAQSRERA
GTIRLAGCWAHARRKFFEASTYCQDALWVLVQIRELYAVEEELREIRAGPEQRQAAREAR
SRLVMGQVYEKLEQWQQQRKHLPKSPTGAAIRYALNQRASLEVFLEDGRVEVDNNLVENT
IRPSAIGKKNWLFVGDAQAGVRAATFYTLLDNAKRAGADAYEYLKDLFTKLPAMTNQQMK
EITPRAWMARRADQ
>266835.1:NC_002678_5064915_5062208__1751_102
MSAPIDLSQFPDLPAEVVNAFAAVQFELSVERAARQHEQAVVAEKDAFITELKELIEKLE
SQVQDYRRTKFGPKSEKLDPTQMELALEDLETAIAETQAQIAFVEEKIAASTANCEKTAS
RRQRKARALPQSLPRVEQVIEPDSIACPCGCGNMVRIGEDRTERLDHIPARYQVIVAIRP
KYACPKGRTGVVQARAPAHLLEGSWPTEALLAQIAVSKHSEHMPLNRQAAVMARHGVPID
RTVLADWLGRTGAVIAPVVDHMAMILKQGSSRLYVDETTAPVLDPGRGKTKTGYLWAILR
DDRGWNGSAPPGVVFHYRPGRKGEYAAGILDGFNGTIQVDAYGGYSHLATPKRTGGDPLR
LAFCWAHGRRKLIKSQPKKGSPIVDEALLRIAALYKIEDSIRGCDPDHRRAVRQHLSRPL
VDEFFTWLTVQGARVSRKSDLGEAMAYMLKRQVGFRLFLNDGRVDIDSNLVENAIRSPAM
NRRNALFAGHDEGGRNWARFASLIGTCKMNRVEPYAYLRDLFISLANGHLAKDIDALMPW
AYAQRISASQ
>288000.5:NC_009475_141053_137942__2203_644
MSDLPDELPSDPAELRVFATALLDRCARLERLLKLAKDAQFGRSSEKLDADQLQLVLEDV
EGAVAALETAEDRANPRTSEKRAAERRTNRGQLPEHLPRIVETLMPAETCCPSCKGDLFE
IGRDESQRLDVVPAQYRVIVTRRPKLACRACHGVVLQHAAPERLIRGGLPTERLVAHVID
AKYHWHLPLYRQAQMLATHGIAIDRSTLAFWVGYAAQELKPLWHRLRQLLLASSKLCVDE
TPAPVLDPGRGRTKTGYFWALSRDDRPWAGPDPPGVVYAYAPGRGAVHGLRLLEGYRGII
HCDGYQAYKTMTRETRADALSGTLAFCWSHLRRQFVKIEREAAPAPAPVAREALERIAQL
YAVEKALRGRSDAERRAGRQAHARPLAAALKQWFEAKLDHLAQKSDTAKALRYALRHWDG
LTLYLDDGRIEMDTNAVERAMRPIKLNAKNSLFAGCDEGAESWAVLASLIETCKLNSVSA
EHWLADVLAKLVNGWPATRLDELLPWASIYTMHAHDRLAA
>314230.3:314230.3.fsa_39_51256_48651__1747_65
MSTDALSQLSREELIALAERERETFALQAESQAETIRRLEQQQETLATKLELQTQTIQEL
QRKREQLEHRLALALKQLYGQRRERFVSPDQLMLFSVEDIEQLAQEAEAELRAQQQEKLL
ARRRGKKQVGHGRRPLPEHLPREVIRHELSAEERSCPCCGEARAEIGCESSEQLEFIPAS
FKVLVHERVKYACRACQENVAIAPPASKPIEKGLPGPGLLAQTVLSKYGDHLPLYRQEDI
VARSGIVLRRSTLCDWIAAAAVLLTPLYRRMCELVLASRVLYTDDTTVSLLDPLACKAKQ
ARFWAYLGDDQHPHVVYDFTESRKRDGPAKFLTGFAGYLHADAYGGYDGIYAGGGAIEVA
CWAHARRKWFEARKTDPARAHHALALIQKLYHIERDARRASDEERHAARQEHSLPILAEF
KTWLDAEREQLLPKSPIGQAATYTFNQWTALTRYCESGELKIDNNAAERTMRPVAIGRKN
WLFVASRTGGERAAVLMSVVQTCKRNQVEPWAYLRDVFEQLPSLGENPTRENLDQLLPNQ
WLKANPNHVWRIQQLREQDDA
>314253.3:NitroNb311A.contigs_31_2_2490__1546_17
MTALADALPDDPGTLKAMLLAERARAERLEQIIRELRRHRFGRRAETLPEDQLLLGLEEV
EQAAASSEAAGEAVAPAERARHAVRHRMNRGSLPAHLPRIEMVADIEDHSCPCCRNALHR
IGEDRSERLDMIPAQLRVLVVRRPKYACRACEEVVVQAPAPARLIEGGLPTEATVAQVLV
SKYADHLPLYRQSQIYARQGIILDRSTLADWVGRAAWLLRPVHERLLATLKTSTKLFADE
TTAPVLDPGRGRTKIGQLWAYARDDRPWGGADPPGVAYLYAPDRKAERPIAHLAGFTGIL
QVDGYAGYRALAERGDVRLAFCWAHVRRRFYELAVAGPAPIASEALKRIVDLYAVETQCR
GRCADERRALRQEKSRPILEALEPWLRAKLDLISQKTKLAEAIRYALSRWEGLTRYLNDG
RIEIDSNIVERSIRPIALNRKNALFAGSDGGGEHWAVIASLIETCKLCSIEPHNYLADVI
TRIVNGHPNSQINDLLPWAYTAALDTREVA
>394.7:NC_000914_425105_428585__2563_908
MISKPVDLPVDVVGAYLALRGEHEALQAKHAIAVAEAANAQAMLSDNEALIVALELKIEK
LRRELRGQRSERTARLLDQLELQLEELVAAATEDEVAAQAASARTSSVRSFTRKRPVRKP
WPDDIERERVVIEPPTTCTCCGGSRLSKLGEDVTETLEEIPRRFKVIETVREKFTCRDCE
AISQTPAPFHATPRGFIGPNLLATILFDKFGMHSPLNRQSARFKCEGIDLSTSTLADQVG
YATAALMPVFDLIEAHVFAAERLHGDDTTIPIQARDKCTTGRIWTYVCDDRPFGGTAPPA
AIYYASSDRRGEHPQKHLAGYGGILQSDCYNGFEPIAVAATKAVPITFAFCHAHARRKFF
ELADIQKNARDRKRRGKPISPIALEAVKRYDELFEIERQINGLSAEERLAVRQEKSKPLF
DDMHEWLTKERAMLSRSSEVIEPIDYMLKRWEGFALFLKDGRVCLTNNAAERALRSVALG
RRNWTFAGSQRGADRAAVMLTVITTCRLNDIDPKAWLADVLARIADHPVTRLYELLPWEW
KRASAATVMLAA
>411468.9:NZ_DS499711_74517_71774__1694_81
MAGNSKDSKILAYKDMINQLNKTIAAQTELIQSLQKTLEADRLEKETLRQQIEYLTKKLF
GTSSEKRKDIEGQLNLFDEAEQEADPAWNPELPDGIIVPEHKRKARRTHAELFKNVPSCD
EIISLPEEERNCPACGTQMECIGKEFVRHEFRFTPAKGKVVNIYRETYKCPECAISAEHP
DDQTFVKAPVQEPLIPESYASESVVAWAMHQKYQNGLPLNRQEEDWKQLGVPLNRATLAN
WIIYCTENYLRHVYDYFHRQLLVRKYLMADETRVQVLNEPERNPETDSWMWLFRSGEDGL
PPILLYHYTETRAKFHAESFLQGFSGYLETDGYQGHHNLPDIKRCSCWAHVRRYFTDAIP
KGKEYNYSLPAVQGVQFCSKLFDCERYSKAKNHTAEQRKQFRLEKEKPILDVFWDWLDQQ
HPNKGTRLAKAVNYAQNRKDTLMTYLEDGHCSFSNNLSENAIRPFTVGRKNWLFSASPKG
ATASAIVYTMVEMAKANDLNTYKYLTYLLSQRPNDKMSDEQLEQFAPWSKAAKANCQN
>457387.3:ADCL01000010_108859_106316__1676_108
MTQTETLELLVATLQQANSSQSESIERLTRQNEQLQNKLQELLAQVAWLNRQLFGRKSEK
LAHLDPNQLSLFDPPVQPLEHEIPEEAAAQEPVCSTTPKKKVRQNRNMLDGLPVVEIVIE
PEGVDPDKYKRIGEERTRTLEFEPGKLYVKEIIRPKYGLKDNISLPQGHQGSVIIAPLPL
LPIYKGLPGASLLTEILLQKYEYHVPFYRQVREFHHLGLKISENTLQGWFKPACELLKPL
YEELKKQVLKADYIQVDETTLPVINKQNHKAVKEYLWIVRAVMDGLVFFHYDDGSRSQET
AWKLLQTFKGYLQSDGYAAYNIFEGKKEVCLVGCLAHIRRHYEVAKEENESLAGYVLAQI
QQLYRIEQIADQEELTYEQRMLRRQEQALPILEQLEKWMETAYPKVLPKSRMGQAIAYAY
QLWPRMRNYLKDGRLKIDNNLAENAIRPIALSRKNFLFCGNHEAAQNTAIICSLLASCKA
SNINPREWLTEVIALLPYYAANKEKDLKELLPHCWESGNSKEL
>555088.4:NZ_ACJM01000001_419245_421769__1610_78
MSASEQLKKLENRISELEQENKKLHDTVDHLTRKLFGKSSEKTSSLPMGQMSLFDETEIT
ADPKAPEPDLKEVQGYRRKKFPGQRAELLKDLPRDKRLCTLVEMDRFCEECDTTLIFVGE
EFVRTEIEFIPAKVRVIDYYRETFECRTCRKDGKPYMEKSPMPDPVIQHSMASPSTVAWV
MHQKFVNALPLYRQEKEWQTLGVSLSRATMANWIMVASRDWLLPLVELMRKKLLDEHYLH
VDETTVQVMNEKGRKNTTDSYMWVYSSGKHAEHAIRLFEYQPGRSGKYPQEFLKDFKGYL
HSDAYVGYKKIPEVTRCLCWAHVRRKFVDALPKDIHRPEATLASEGIAFCNKLFEIEKAL
EELSSEDRRLERVRQEKPVLDAFWAWIHSNKDKVLPKSKLNEALHYALNNKEELMNYLKD
GNCSISNNLAENSIRPFTIGRKNWLFSGSPKGATASAAVYSIIESAKANGLNPYKYLHFI
FSQLPGVLFRQHPEFLEDCLPWSQEVQENCK
>82789.3:NZ_AECL01000060_2798_1__1915_356
METAPLDSQDELTALRALVAEQAAKLESQEAEVIKRDSIIGLLRAQLELLRHRQHGASSE
KIDRKIEQFELMLEEIEASRAEAELRAGKTPLPDLDDAPDKPKRKPLPDGLATEELIYEA
PCNCPTCGGTSFLKAPDRVVQVLEHVPASVKIVRHVEKRMICRECDTTVAGEMPTLPIER
GKPGPGLLAHIMVSKFDDHIPLYRLSEMYDRLGIDISRSVMADWVGRVSALLTPIILLIR
AHIAALDRIHTDDTPVDVLDPGRGKTKTGRVWVYVFDGSGYQSATPAAIAYYYSPDRKGA
HPADHLASFSGVMHADGYGGYKKLYGNQIVEAACMAHVRRKFHDVIKLKSSPIAEEALSR
IGALYDIENRIRGMSADERRTLRQHHARPVLDELKAWIEATLSTLPQKQKLAEAMRYALS
RWAALSVYIDDGRVEIDNNIAERAMRPLGIGRKNWMFAGSDKGGERIANILTIIETGKLH
GHNPEVYLTDVLTRIRDHPKDRLEDLLPWNWASAKARHEA
>101510.15:NC_008269_475138_473778__1309_170
VQSEVLEWSAGFTAFCARFAHRFSRVESRRRMAAYVRGLLGEVERKNGWTLAEAAGDTGP
EGMQRLLNFYSWDCEGLRDDVREVVVETIGDADKGVLIVDETGFLKKGTRSAGVARQYSG
TAGRIENSQIGVFLAYASDRGRALIDRELYLPRAWTEDRDRCRAAGIGDEVAFATKPELA
QMMIERALDAGVPFGWFTGDEAYGQVGKLRLWLESRGVAHVLAVPKSQMVISMELRQRRA
HAVIADLPATAWQRINCGDGAHGPRLYDWAVVDIRPLRERGSGHWLLARRSITDPDEIAY
YICYGPADTEPAELVRVAGSRWAIEECFQTTKNETGLDHYQVRGYPAWYRHITLSMAAAA
FLTILRRGAQKGDLKPVPEI
>101510.15:NC_008270_142261_140913__1261_176
RISGRFARSEPRSRVREYVTGLVAGLERKNGWTLAERAGEISPDGMQRLLRRADWDVDGV
RDDVRDYVVERLGDPAGVLIVDDTGFLKKGTRSAGVQRQYSGTAGRVENCQIGVFLAYAS
GAGHALIDRELYLPESWTSDRDRCRAAGIGDEVEFATKPRLAQRMIERALDANVPFSWVT
ADEAYGQVKYLRVWLEERDVSYVLATRCNDDVFTPHGRSGRADEMIAAVPAKQWRRISVG
DGAHGPREYSWVRIPIRIAWAPGRGHWLLARRSLSDPTEIAYYICAGPRRTTLTELATIA
GSRWRVEECFQQAKNEAGLDQYQVRTYRAWYAHITLSMLALAWLAGTKTEAVKGESGSKI
RA
>1037409.3:AP012206_8444286_8442841__1385_150
MIHGWSALGGLTMPGWEDELERWLMPFLDRLGHKTRQRMCPLYVAGLIGPGDRKSVQPMA
ERLVTSNYDQLHHFIADGVWDATPLETELLNQADRLVGGRDAVLVIDDTSLPKKGERSVG
VAAQYASALGKTANCQTLVSLTLARGEVPVMVALRLFLPDSWTSDMPRLKRARVPIEHRT
PRSKPEIALAEIDRAMAANMRFGCVLADAGYGLSAPFRQGLTERGLAWAVGIPRHQKVYP
VDVKLIWPITKVRGKPRKHHVPDILSIAAEQMLASAKWKTVSWRSGTKGRLKARFAALRV
RTADGPPQRIWDKGQQHLPGDEVWLIGEQRASGESKYYLANLPATTDLRTLAATIKARWI
CEQAHQQLKEELGLDHFEGRSWQGLHRHALMTMIAYAFLQHRRLAYAGRKKR
>1086014.3:AGFH01000030_23699_24799__1045_20
VIRRIKHASTATCTLPIYMGFLMTEPNSISCTQLAETYNISHDSVNRFLEREDYTPHDLY
QEAIQHIDNNKLIVSIDDTVLDKPYSQHMDLVSYFWSGKHHRSVKGINLITLYATDQNGQ
NIPINFRIYDKSEGKAKNDYFMDMLSEVLSWGAKIQFITGDSWYSSTGNLKTIRKHGIRF
MFGIDCNRKVSPEKGQWFQLRLLPNFHQGQVVWLKDFGFVQLFKTQLKEQQRFYIVHQDE
DDLLSFEGFHELHSSHWKIEQYHRVIKQVCHIEKFQVRRSKLILNHIFSALMAYVEIQKN
QFERIFENVYRWQKKLFRPVIKNFIDDFILDKNHLLPQRIYK
>1094188.3:AJGT01000039_667_2039__1246_32
MPDIIIEQSQEVINYINMLKLPISGALKNHMVHMISGIITTEGNKNISNVYSRLTCNRNR
SSGSRFLGEYKWSNEYVDYKRINHSLKTVRENVPEGTVGFFIVDDTLSKKDNSTKKIEGL
DYHHSHSDGKTMWSHCVVTSHYKISEYSLPLNFKLYLRKQFFGQKAKKLFKNKQELAMQL
IDEFTPVTETTYLLVDAWYTSGKLMLHALKRGYHTIGRIKSNRVIYPGGIKTNIKEFATH
ICSNETCIVTAGDDNYYVYRYEGKINDLENAVILICWSKKALSDTPAFIVSTDVSLTTST
IVGYYQNRWDIEVSYRYHKNSLGFDEYQVESLTSIKRFWSMVFMTYTFLELFRVSKKRSL
KLETIGDTIGYFRKQYMVCIAKFAYSCAEKGVSLDDVVAKLGVAA
>1185653.3:AJYB01000086_15843_14492__1227_61
MNRLSYQQEIDNGFADWNLGFYFSKPVLKHLVHFTDGILSIGFTGKLTEIHTASRNENHR
TLLGHFLKQGVWNEQFLLGQTQQHILRKVAKDEPLFVLIDDTICKKTKPSSRAKSPIDAC
GFHYSHADGKSVWGHQGVEMMVKSAGRAFPFDFRLYTKETGESKIQLADDMIRQLPTLKQ
TAYVLFDTWYTASSLIKAARSKNLHVISALKSNRIIYPNGIRIQVKEFAASIQEVDTDLV
TVGKATYRVYRYVGPLSDGTTGTVLLSWTPDQPMDPKLMRCFFSTDATLTSEQILRYYGE
RWSIETYFQTVKKQLGFAGYQIRNERAIRRYWTIVQFTYVFAMYLRDEVFQIAIRQLRRQ
KMGSLIEFVYEECQNGVALDHIKNELQPA
>1200349.3:AKWA01000139_2_1389__1246_32
MLTTILNHNEAINNYILELNLPYSSALKNHMINLVSGITVTEGSKNLSSIYSKLTCNRHR
STGSRFLSSYSWNHEYVTDERIFHAISEISSTSKDDDVGFLIIDDTLSKKDISTKHIEGL
DFHNSHADGNKPMWSHCLVTSHYTINDCSIPLNFKQYQRKKVFKNNPKKFKDKQQLAIEL
INEFTPATKTNYLLIDSWYTSAKILLHGLVNGCHSIGRIKSNRVIYPAGIKIGVDKFSKH
IMPNETSIVTASNNKYYVYRYEGKLNDIENAVVLMSWSKQDLSDNPCFLISTDISLDNQT
IISYYEKRWNIEVSYRYHKSSLGFDEFQVESSKSINRYWSMVFLTYTFLEIFRVKNSKTL
KLKTLGDTISYFRNNYLVQIVSFAHACADNGIGLDSVISKLGLVA
>1212546.3:ALJT01000017_117050_115690__1271_66
NYPQGGSCLMNRLAHHQGIHKFFITLGLALYFSKPVMKHLVHIVDAMITKGFSGTLTDLH
HGSFHPNHRTTLSHFFTKSPWEEETLLRKLQQWVLHRVERSSKRENQPIFVSIDDTICQK
TKPSSRATHAIQGCDWHYSHAEKKSIWGHSLVWLMVHTMTQAFPFAFRLYDKTAGKSKGE
LAIEMLSSLDVSRPVYVLMDSWYPSKTLVGACLKKEFHVIAMLKTNRILYPKGTAIQAKE
FSKSMEPRDTRLVTVGKERYRVYRYEGALNGLKDAVVLLAWKADQPMTLKHLHCVLSTGR
ELSDEEILRYYAARWSIECFFRQSKDQLKLDGYRVRHVRAVKRYWILVQLTYVYSMFESN
GDFSTGLDLLRTNKAHRLVEFIYGAANQNIPIDAVKKQLHVA
>1267580.3:AMCM01000035_13668_12305__953_66
NPIFVSIDDTICQKRSPRHGQHTPFKGVIGTILTQRKSRSGGHSLVWLMVHTMTQAFPFA
FRLYDKTVGKSKGELAIEMLLRWM*VDPFMCSWTLGYPSKTLVGACLKKRVPRHRDAEDE
SDSLSKRDGHSSKRLPNLWSHGIPASSRWEKSVIGCIATKGALNGLKDAVVLLAWKADQP
MTPKHLHCVLSTDRELSDEEILRYYAARWSIECFFRQAKDQLKLDGYRVRGRRAVKRYWI
LVQLAYVYSMFESNSDFSDGLDLLRKRKGHSLVEFIYRAAKQNIPIDTVKKQLHVA
>1267580.3:AMCM01000066_3101_4455__1115_498
RDFREQLTDLHHGSFHPNHRTTLSHFFTKAHGRKSALLHKLQQWILRRVERIAKQENQPL
FVSIDDTICQKTKPSSRQHTRFRDVIGTYSLREKIDLGTILLFGSWFILQPRRFLCLPAS
TTRRREKAKGTRNRDAFFVGCTPSRIMLMDSWYPSKALVERLSEKGFHVIAMLKTNPDSL
SERRCRQAKQLARSIEPNDTHLVTVG
>1291534.3:BAON01000026_33522_32104__1370_123
MIQNEMNSTASVEDVLTLTLEALRDTKARMRPVFGQERIAASAGRFLEMLLSNEPRKTGW
MRAEAAGDPGPWRQQALLGRARWDADALHDVVRDHVVDHFGDPDAVLVVDETGFLKKGTA
SCGVSRQYTGSAGKITNCQIGVFATYVSSKGHAFLDRALYLPKSWTDKPERLAAAHVPDG
IRFATKPALAIAMIGRVLDANIPFAWVAGDSVYGVGDLEMALRRAGKGFVLGVNANHWFH
SWRPDVMWVGEAREIIKTLPDETWVRCSAGHGTKGERWYDWLYCPMANLHASEYSDTLTG
TWTRGLLVRRNPADGDLRYFTTWCPQGTPLETLARVEGARWRIEEGFETAKNEFGLDHNE
TRSWHGWHRHVSLVMLAHAMMAAVRSQANVLTLKKRPLPTRKSLSNGQFRKSGASP
>137722.3:NC_013855_62011_60627__1308_19
MTEMTEAAEWSDALEGLVGGLRSFYSAAGRQRALRYVRGLLAPLDRKNGWQLAEAAGDCS
PAAMQDFLARTRWDADAVRDDLQAYVIERLSDDEAVLVLDETGFVKKGTRSVGVKRQYSG
TAGRIENCQIGVFLGYASRRGRVLVDRALYLPEDWAGNDERRRMAGVPNAVGFATKPKLG
RAMLERAVAAGLPCRWVTADSVYGGDYALRLWLERQPLGYVLAITSKQRAPMGFDTVKER
TTGFTATDWQRLSAGDGAKGPRLYDWAHKTYASLREGWCRGLLVRRSIAEPDKLTYYLTF
APEGTPVATLVRVAGSRWTIESCFEAAKGEVGLDQYEVRSWTGWHRHVTLAMLALAFLTV
VRTAAIGGRGSTRPVRRSSALDRARDPHPPGRLDRPAPRATHRHYRLVHLAKTPPTASTA
LPLETTHPNR
>203124.1:NZ_AABK03000050_3376_4744__767_138
KQK*KSVEEMILNAINNKKIPFKTLLMDLGMQHKD*WD**IMIEKFTTVL*KVIACVDDT
RGAEKYKKVQDLNWNEAEKKSGKIIQIKGFPLCQKVKIFWIRCICQLQQNILSLMT*LNH
HSYDVEFESQTRWKIEEFNREIKQLTG*GFCQCRLRIIQKNHIVCAMLVWNFFKRFATKI
GKSIYQVKHKLLSKYLRDQLKNSSIKMKVI
>272564.4:AAAW04000003_882298_880935__1247_60
MSHSTILPKNEAMFNFFKSHRLPLYFSKPVLRHIQEFIVAATAKGYRGKIVDIAEWSSVH
RTSIGHFLSHGVWDESYIQKIVKQESLQFVVAHSQKTEQPIFVIHDDTVCNKTKPSSQAQ
RPIEQADFHFSHLEGKSVWGHQVQATLVQCGDHSLIHDVHQYDKTKLSKIDDACELAKTM
PIPPKSGYALVDSWYTCAKLINTYAARGYQLIGALKTNRILYPQGIRVRLDTFASYVNPK
EVHLVTVNGSSYWVYRYEGALNDIENAVVLFCWPKDAFQVSKALHAFLCTDVSLETQTIL
AYYSKRWPIEIFFRQAKGNLGFNGYQVRSIRSIERFWALLSFTHLYCTMGLGKPLLFGEG
LRKVRKEVKGQYIRWIYECSRNGVPLEDVLKRLKAA
>319795.16:NC_008025_1381234_1382627__1364_177
MARPSAAPLPRRWLTDLDKLHQRIAPRFARSEQRQRALAYLQALLSPVERKNGWQVAEQI
GEHTPNGVQRLLSTAQWDAQVVRDDLRQYVLDHLQTPEAVLVLDETGFLKKGTKSAGVQR
QYSGTAGRIENCQIGVFLAYATPSGTALIDRELFLPKTWIDDPARREAAKIPDTVRAVTK
PQLALAMLERAFDGGVHAAWVTGDAVYSAYKVRAFLEQRQQPYVLAVASNFHVWAWQAGG
PAQVHVADIAGQFQPHHWQTLSAGSGSKGERLFDWAWVSVTELMGPAVAAGLGPILPAGF
ERWVLARRSLKDPSDLAYYIAFAPSSTTLSEVVRAAGSRWAIEVAFEMAKGEVGLDQYEV
RSWVGWYRHITLAMLAHAFLTVVAAREKKGGRPTRI
>354.1:NZ_AAAU02000059_786_2216__1363_161
MTHASIETTLELWVSSLRDVKQRIRPLFTQERVAASAALFLDGLLGAEPRKTGWMRAEAA
GDPGPWRQQAILGRGRWAADALRDLVRDYVLEQLADDEAVLVLDETGFLKQGHTSCGVAR
QYTGSAGKITNCQIGVFAAYVSRHGQAFIDRALYLPRDWTADPERLAAAHVPKGIGFSTK
PRLAQDMIERAIAANTPFAWVAADSVYGVGHLETALRRAGKGYVLGVKGTHAVKAWIDRP
WLSGTAEQAARALPSSAWRRCSAGEGTQGPRLHEWAYLELADLEASDYAPSATGVWTRGL
LIRRRLVDGELAYFTTWAPAGTSLKRLAWVEGHRWSIESAFETAKGELGLDHNETRSWHG
WHRHVSLVMLAFALLARVRHQANAPAPPKTIQRLIALTYPG
>441620.7:NC_010725_4237485_4236073__1347_79
MVGRPSEQDLDAWLAPFLAAMGRNTRRIWAPLYLRGLLDPGDRKSLQPMAARLGLPGHDQ
LQHFIASLAWDDGPLWAELARTADRLVGGSDACLVIDDTALPKKGIRSVGVARQYCGALG
KKASCQSLVSLTLARDEVPLPVGLRLFLPEDWTADPARCALAGVPEAATAPQSKGEIALS
ELDRLQPMGVRFGVVLADAGYGCSAAFRHGLDARGLTWAVGIAKNQKVYDPEVRLVPPGG
RARKAVPDQEPQKAEAVLAALPWRRVTWRRGTKGALSARFAMARVRVGDGPVWANNRHLP
GDEVWLVGEWRASGERKFYLSNLPSRTTRRVLGGTIKARWIREQAHQQIKEELKLDHFEG
RSWTGLHRHALMTCIAYAYLQDLRLAEPYRTDRGKKGRQPTGAAAVSEPARRASGHHRPT
VRG
>457427.3:NZ_GG657754_8753213_8755073__1244_603
MSRIAGRFARVEPRRRVRRLVLGLLSDLPRKNCWTIAEWAGERTPDGMQHLLGRAKWDAD
QVRDDLRDHVVEHLHDDQAVLVVDETGDVKKGTGTVGVQRQYTGTAGRIENAQVAVYLVY
AGRRGHGAVDRELYVPRSWTADPDRCRDAGLGQDTAFATKPELATRMITRFLDAGHHISW
VAGDEVYGGNPKLRAALEKRGTGYVLAVACSAEV
>546414.3:NC_012528_93046_95252__2158_785
MTVPHNWQRAFRGFLSPYLETLDNAKQRVCLPRYVRGLLAPLERKSTQPIAEHVGMPYQR
LHHFVNVSHWDAEQIEIRLKRQAQRLCGGKNAVLIIDDTALPKSGDASVGVAYQYCGALG
KIANCQSLVTLTLSDGSLFAPLSMRLFLPGSWAGNPERCQGAGVPVVRQHYRSKGEIAME
ELDRALDAGVTFRVVLADAGYGINKDFRQALSQRGLTWAVGIVGIQKVFSLDVTLRDPPQ
KTGGRPGKHPIPSEIARPVKDVLHEIPPYRWHTVKGAKSSRWLVVRGRIADGLPNKRGLH
LPGEAVWVVGEKRRGGEIKYYVTNHAPSTSMAQVVRDIKARWACEVLHLQSKEELGLDHF
EGRSLLGLEHHIVLVLLTMMFLQTLRQQQCSVAAEIPTLPELRRTTSRALEQIWFGRCPH
CGEVVQVGSTPLPGLKVRISNPYRRKKTLSLSDNFNTP
>661410.3:NC_012987_50340_48931__1386_61
LSWWRCAMTRVTRADVADWAQGLEEVLERIAVRFGRAEPRRRAGAYLRGLLAPVERKNGW
QLAEAAGDASPDGVQEFLSRVRWDADAVRDDLQGYVAEHLGDPNAVLVLDETGFLKKGVN
SAGVQRQYTGTAGRIENAQVGVFLGYAGRHGHALIDRALYLPRSWTDDRARCRAAHVPDD
VPFATKPALGLAMLERARAAKLPFAWIAGDSVYGGDRAIRRWAEDHRIGYVLTVTSGQRL
AMRPVAEWLADQVEARPEDAPSVWQRLSAGDGAKGPRLYDWACLPYRGAAPGFQCALLVR
RSLADPDETTFYLTHAPTGTPLADLVRIAGQRWTIESNFEQAKGEVGLDHYEVRSYPGWH
RHVTLAMLAHAYLAVLRRTAIGGRGHHGPRPRPPAADRARDPASAGRSRRPASARHRRGP
ALVRLAKAPSAAGKTRSLAPSD
>886293.4:AGRX01000079_8134_6777__1255_20
MPGIIEFPKLVEAALTQHGDLFANECQRRHFAEYLTGLFVADRKTVLGIHDEFAQTTDQS
CLNRFLTAAQWDPETLNDRRLEQLQKEPSTRYSVQGVIPIDNTLVDRDGMLIPDANWFWD
HTEERNKIAQDYLFVNYVCTSGKHYPLEFRLFRKQEVCEALDEPFRNHTALCCELIDWVC
ERGIPGDFAMDCYFTNAEVLNHIDGKQDRLGRPHGYVGDLKTNRKLEWKGGILKANELAA
SIPVEDRKAMRIGDRRQWYFTVTVRIPGVNHKVRIVILWHYRNDGTCCKILVTNRITWEV
SRIVRVYRHRWTGTETFHRDGKQQLGLGDCQLRDVQGQTRHMYLVMLAYSLLMSELKQGR
AKEWALHRLMTIGEACRAMTREALRTTLSWAIEQVTQFEQPYEHVVAQLGLS
>940265.3:BACG01000043_5155_6565__1366_119
MIQDMMSGGASVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAFLDILIGNEPRKTGW
MRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEEGVLVIDETGFLKKGQA
SCGVGRQYTGSAGKITNCQIGVFATYVSTRGHAFVDRALYLPKDWTSKPERLKQAHVPDD
VVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTLRRAGIGYVLGVKGNHWFG
SWATNPLIAGEARDIASDLSEQDWRRLSAGHGTKGERLYDWAYLPLADLDAEEFDYPIAG
PWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTRWRIEECFETAKNEFGLDHNE
TRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTHRRTR*SSSVGPFRKSGVLS
>993516.3:AMWG01000174_134541_132999__1454_177
MDVAELEQLEDRLNAYLARFGDCFRRSDTRAHLTTYVRGQLSDLDAKSVEPIALQAGTPV
RTLQEFIAQHRWDEDGLRRRLIHIVRDEHVTKNTVAIIDETSDVKKGDKTPGVQRQWCGK
VGKQENCIVTVHLAAANEDFHCMVDGELFLPESWSNDRERCAAAGIPEEMVYRPKWQIAL
ELLDRSKEEGIEYPWLTADEGYGGKPGFLEALADRDQKFVLEVPRTFSVWEKHPEVTEQP
YRKGGRGRGRKTPRVKSGESSPRSVETVFWHGEAMKAKRWKRYRVKDGEKGPIIWEAKRV
RVTLKGSDGLPGLSLWLVVARNVLDGELKFFVSNASEFASMAMLLQVAFQRWRVERCFED
QKQEVGLDCYEGRRYLGLKRHLIITSLSYLFLSQTCQQEREKKSGVDDSANSRRGRRNRC
QLVTPS
>1005463.3:AMTN01000224_912_1968__980_60
VAKQKFKITNWPTYNKAPINRGSITFWLDDEAIQAWYESATPSSRGRPQRYSDLAITTVL
VIKRVFRLTLRAAQGFIDSIFSLMNVPLRCPDYSCVSRRAKSVNISFKTPTRGEIAHLVI
DSTGLKVFGEGEWKVKKHGQECRRIWRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLI
RQTHRKIRAASADGAYDTRLCHDELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMT
GSNARWKWTTDYNRRSIAETAMYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGM
PESVRIA
>667120.5:AFJH01000060_17078_16081__922_161
VAKQTTHWRNDSKASVNRGAITSCVG*RDDPPSMSQYPPHHGGDLCAILTLPSSPSWQLS
IYSDSPSGSHRALLIHFSLLDIPLHSPDYSRVSKCIR*VNISFTTPSRGEITHRVIDASV
LKIFGDGEWKVQKPGKERYRIWRKLHLTIDVNTHDIICATPLVEPTQGPQRTHPTDSQEN
QVSRG**HLQYPVMSR*TAS*EH*SPLPPRKGAGYCPVEYAEHNRGVANQRLSGSHARWK
*IIDYNHHSIAGIA
>1000951.3:ALEA01000207_1163_187__937_17
MLFLDGVYVEQSHGSARFRWVKAPTSPELTQLTHTIAHRVGRYLERQGLLERDVENSYLA
SDAVDDDPMTPLLGHSITYRIAVGSQAGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGV
AARADERKKLERLCRYISRPAVSEKRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIAR
LAALVPKPRVNLTRFHGVFAPNSRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQ
RLKRVFNIDIETCSGCGGAMKVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAE
LLLGLFD
>1005567.3:AMUQ01000001_7342_9030__1330_176
TANQCWTSFLDAGGLRDIEVEAVTKMLACGTRILGVKEYNCDKPDCPHVRYVTNSCGSRA
CPSCGKKATDLWTATQLNRLPDCDWVHLVFTLPATLWPVFESNRWLLNDVCRLAVENLLY
AARKRGLEPGIFCAIHTYGRRLNWHPHVHVSVTCGGLNKHGQWKKLSFLKDAMRSRWMWN
MRQLLLKAWSEGMAMPESLSHITTESQWRSLVLKAGGKYWHVYMSKKTADGRNTARYLGR
YLKKPPIAASRLAHYNGGASLSFRYLDHKTGETATETLTQRELVARLKQHIPEKFFKMVR
YFGFLANRVCGEKLPKVYRALGMDKPEPVAKVCYAQMVKQFLSRDPFECVLCGGQMVYRR
ALAGLNVSGLKKNARDISLLRYMPA
>1050617.5:CP002894_61700_63528__1377_100
MLPRFADIFQQGNRWLNWLEKQPEGSVRPVVTESVTKIMACGTTLMGYTQWCCSSPDCCH
TKKVCFRCKSRSCPHCGVKAGAQWIQYLLSLVPDCPWQHIVFTLPCQYWSLVFHNRWLLA
EMSRIAADVILEICHQTDVEPGIFTVIHTWGRDQQWHPHIHLSTTAGGVTSGHTWKNLHF
YARKVMSMWRYRITRLLSRKYPELVIPDELAVEGNSKRDWNCFLDTHYRRGWNVNISRVM
DNATHVAVYFGSYLKKPPVPMSRLEHYAGQDEIGLRYNSHRTKREEYLLMSGDEFMERFS
WHVADKGFRMVRYYGFLSPVKRRLLEEVVYVITETVRKTAMQIRWRGMYQRLLKVDPLKC
ILCGSQMRFTGLKRGYRLAELVLMHERLGTTAGVRLRAAEGKLRPFYRKRSKKPPFIPCI
NQCHPV
>223283.1:NC_004578_14331_16708__1411_185
MKPAYPPLLLQMSPAYTPRPLKNLFTANQCWAHLIEEGGLRDIEVESVTKMLACGTSILG
VKHYTCGNHSCPHVKYLCNTCSCRACPSCGKKATDQWIANQQHRLPECTWQHLVFTLPDT
LWPLFFHNRHWLDALCRLAVDNLLYAGRRRGVEVGVFCAIHTYGRRLNWHPHIHVSVTLG
GIDDAGVWKDLSFHPSALRRRWMWNVRQYLLSQWEHTTVPPENAHLQSENDWRHLVLNAG
GQHWHIHLSKKTKNGKKTVNYLGRYLKKPPISGSRLAHYTSGATLSFTYLDHRTKTYQQE
TLSQTDMLRRVVQHIPEKHFRMIRYFGFLANRVCGRQLPRVYEAIRMERRGKAPKLYFAQ
MSKAFLHRDPFSCVLCGARMVYTAAIAGLTVQGLINNAQSIAQLRYVPA
>316275.15:NC_011311_47728_49080__1319_141
MYDPNHFKHLFTLGRCFYKAYKDNYPFRTVELEAVVKYLSCKTDRLGKLTYSCRNNACSH
VKYVFSTCKSKLCPSCGQKATERWIAAQSEILPDCKFRHITFTMPGQFWPLFQLNRWLLG
DLFSISANTLLTQAKTKKLTIGIFAALHTYGRKLNFNCHIHLALAELGLDKHENLKKFSF
KFASLMKQWRYGIIKLLRDNYDRLIFPSELSDEAKNTQSWNGFLNTQYNRHWNVNIAKKT
SHKKHTAKYLGSYVKKPPIAASRLKEYANGEVTFTYLDHNSKKHKELSLTQTEMMLRVLS
HVPEKYFKMIRYFGFLSTRLRGDMLPIIYEKLEQKVNKPMVFSFASMMKALMKVDPFECI
LCGSKMFFSGFIRGPKLGQLVSSIENLALLRPM
>316275.15:NC_011316_3532_2098__1360_170
MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTAAFGSREYHCCNPDCT
HIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFTLPNTLWPIFRHNRWLL
NKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHLSVTRGGICERTGLWKPI
YFQMKTTEPCWRAAIVSLLGKAYYELDLSSEECPYIRNKTDWSRFLSSQYNRRWKLHFAK
KTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLDHRTGTTDSLTLSPEEMIRR
IVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIEAEPKMPGYAAMLKGYVKVDP
YECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA
>1000589.3:AFIN01000209_2149_1188__874_14
MSHLQYTAKSHHLQWNVTQLSTICHQLYRDYCPEGLKHRRNISLSKVSDESLLVLLVLQA
ELGIKSQRHFYRICQLFPCGHLLERSRFNRRARQLIWLVQVIRQAMNARISPDTIVIIDS
FSLPLCQPVRNHRAHIFKGVADIGYNTSKHLWFYGFKVHTLVTLSGYILNYVVTPASVHD
IKAVHELLEECDQSIILADLGYLSRELKNNLEQKGYQLWTPLRQNMTGAKQHNHWRVMAM
RRTIETRFSELCSLFDIEHTLTRGVTGLQLRIEQIILAYNLKYVEFN
>1002339.3:NZ_AFHU01000129_8017_9042__925_47
MDNLTELYCHIDDFYQQFKPEFDAHLIATGRQRLRACQISVAEIMTILVLFHQLRYRQFK
AFYYHHMLGMMKREFPNLPSYSRFIELVPRSIMPLCSYLQSMMGDCTGISYIDSTKIAVC
HNKRIYRHKVFEELATRGKSSMGWFYGFKLHAIINHKGELISVKVTAGNTDDRVPVKDMA
TSVFGKVFGDRGYISKALNAWLTKHSDTTLITKLRRNMKPQLLEPMDEALLNHRSLVETV
FGELKNLCQIEHSRHRSVTGFITNLLSGLIAYCWFPYKPTIKNMPQQGQVATL
>1002339.3:NZ_AFHU01000206_5499_6478__891_13
MPIDEFIINIYLMVEQYYKIVVTKPLRSAGYAPKLSDPEVICMEMVGEFLHLDQDKQIWQ
YFTQHWQDWFPAIGSYPNFAKHWANLWQVKQQIQDKVSELEGRDNIHFMDGFPIPVCHYG
RAYRHKNYQDLAAFSYCAAKQERYYGFEGHLLVNLSGMIKGFTFAPANVDERAVAPEITT
HIHGLLGADKGYISPSLTSYYDAQGVDLQTPLRANMKEDRPKPVVRRLMKARRIVETVIG
QLSERFNIQKVRARDLWHLSHRLIRKILSHNLCFVLNKKLGNPPLQFDLLISS
>1046595.4:BACO01000083_20493_19510__850_14
LQGNYHYFYQLCQSLYQRYCPRYVTQRRNVAHVKIDDCRLLALLCLQTTLGIQSQRRFWR
LMTAFMPQKITISRSRFNRRALQLLPVVNAIRTGLTREAAQPGQIAIIDSLPNPLCEPVH
KFRARIFAEQANIGYNATKQMSFYGFKTHMLVTTDGYILNYVVTAASVHDTKVAVSLIDD
CPCPIVLADVGYVGKRLGAGFKQLGYTLWTPYRSNMKGAKEHNKRALKALRRTIESRFST
LVSDFGIETNLTRSAFGFQLKIELAILVYNLGFFNFVTN
>1053233.3:AHFB01000181_7130_6104__927_94
MQSPKYTNNYTDTYTVFKQILEIVVKLYKKCIPATIKNRKNVDKLVQPDTVIIACVLWGL
MLVYNSQRATYRAVRTILFFTEFPSRTRYTRLCASLTYAIKIIRFFFVKQKTKNVTTAIV
DSFPSPFCKEIRNRRAKVLGSIAEVGYNSTKEIYYYGVKISAAVTESGFPIAYVVSSPKI
HDVQLLETLVNEAPVSHILGDKGYISGSIQEKTARKGVTITTPLRKNMKAADKINDTLLS
KRRKKIETVFSSLERLGIQDFRSRSTLGFESRLEAFYL
>1071395.3:AFWM01000210_6883_7884__901_410
MQEHFHFTTDRAKLQKQYVSILCFVSAQLSSIQIHLQRRNLHLLKQKDEVIIAVHVLGKL
LGFTSERAWHRFVIGNLFSKDLFPERSRYNRRCRALGFAIKWMRHRLAKRRQHHTYAVVD
SLPIELCHSAQMYRAKQFRGIADMGYRASKKIACYGLKLHLQVT
>1086014.3:AGFH01000026_26691_27664__891_13
MSIYEFIISVFLIIEQFYSAIVIQPLRSRGFPPALSDIEILTIQIVGEFLGLDSDKNIWF
YFKHNWFEWFPKLGSYPNFCKHCAKLWHVNQQIMSQLKSVFGLDNIHFIDGFPIPVCRYA
RAKKHKNFKESAGFSYCAAKQEKYYGFKGHIVINFSGMITGYTFAPAHCDERDVAPEITQ
DIQGLLGGDKGYLRPELKHYFKYQDIDLQTPYRKNMTDSRSKEAMARLMNARRKIETVIG
QLTERFHIQKVRAKDLWHLTHRITRKILSHTIAVILNTRLGNPPLQLESLIQS
>1104325.3:CP004063_943826_942787__929_24
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGI
INGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGI
IDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPG
VHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLL
GKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSL
GY
>1120928.3:ARFU01000043_104359_105330__882_16
MFNSTELFCVIDDFFLKFEATYWKFLKQSRHSIRIRPAQLSLSEINFIAIWYKCSHFSNF
KAFFTWLTEDKSHLFKTLPCYQRMIHLINMHQLALHALHVALMKGQRSQYLWVDSTTLPV
CKNQRIQRHKSLAKIASRGKSSMGWFYGCKLHIGMNQLGEITCSALSNGHISDIKMVEHL
VEGLEAKLYADRGYISQELKSRLKSQGIDLITYHRKNMQSVQLCVSDEYHLKQRNKIETL
FSLLKGQYNLVTSKARSIHGFLRGIYASLCAYQLTQRNKPKIQIMESLA
>1120929.3:APPY01000044_39301_38327__886_11
MYDFTEIFCIVDDFFKKFEPIYWQFLKQENKRQRIRQATLSLSEIVAISIYYKTSQVHNF
KMFFNLLCQFESKLFKDLPCYKNLITLINQHQLAIHALLYALSQKDESSYLWIDSTPLPV
CKNKRIPKGHHALDEIGSRGKSTMGWFYGCKLHLLMNQEGEIVNSDLSNGHIADLKKVED
LVNGLSATVYGDRGYISQPLKETLKEQGIDLITYPRKNMRVTLLPFSDEFHLRQRKRIET
LIGLLKEKYHLVTSKHRSIAGFLAGVFSSLCAYQLCQKNKPKIHVIKSLAYP
>1181234.4:AKFO01000018_34662_35660__909_22
MTYNSTLPKVFVYLLTTIETLYQTSVPLEVQNRKNVHLATSDCLVITCYLWGVLHFSETL
KAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVEGMSVSIIDSFPIPLCQ
PIRNFRSKVLGDYANVGYNATKGQYFYGCKCHALVSESGYVIDYTITPASMADSSMTEEV
LSQFGTPTVLGDMGYLGQSLHDRLELKGIDLITPVRKNMKQKKILFPNFSKRRKVIERVF
SFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLEPETLRYSIGYQVMAK
>1231377.3:AMQS01000049_1_994__896_6
MQNNFITPFNELLKRVSDLYKTFAPNEVKNRKNIHLAKQSDEVILACYLFGLLHSCSTLI
GIYRLSSSMFGDDFPSETRFYRTINNLKPTIELMNQGLLKDNVSEEEKLGIIDSLPIPLC
QPIRNFRAHGASEIADIGYNATKKIWFYGLKFHAIVNPSGLILNFVLSSASFHDAKVCED
CLTDFHLPILIGDAGYVGQALAGRCAEKGTALLATPRSNMSKTGIDYRSVKAIRKSVETV
FSSLQGFGIEQLTAHQSYQIMTRVQLLILLYNLLEVEAHKIKPMTLKFSLGIKQLAS
>171440.1:Phot3-217d01.q1k_144831_145706__541_17
ICHNIRIARH*VFEGSTK*GKTSMGWFYGFKLHLVVNPLGEILALKVTAGNVDDREPVRE
LTKELTGSLYGDKGYLSQELADDLAKTGVTFITQKRRNMKARMLAEWDKIMLSRRFIIET
INGQLKTLSQIEHSLHRSITGFLLTVLGGVIAYCLKLKKPSLKVFYSEDDLPVMA
>203119.1:NZ_AABG03000001_219761_218611__1043_99
MMELDKNYYIKEIENLKDFVTVAYIIIDDIYQKVTPPHIANRCNINNSVMSDSEIITICI
VGELLTIDSEKAWLGFCKKNMRDLFPKFCDRTRFNRTRRNLHAVIEEIRKELSNLTGYAQ
QPYRIVDSIPIPVCKFGRAKFHKTFRGFGATYGKCPSKKEIYLGYKLHMLATLDGFITDF
AITPANVDDRAGVWDLIDSYRRITLIGDKGYIGTEFAVELKEEKEIEILPVKRSNSKLQF
PKAIRQLIFKLRRRIETSASQLTQQLNIEKVLAKSYWGFLARVKTKLLAYNLCYYINKLI
GRDINFSRIKELVFG
>203275.8:CP003191_2621393_2620323__682_17
HILSLINRFVELQSRVGFKLIAFLNMCCLGQCTGISFIDSTPLKACHIKRAHGHRTMRGW
AQKGKSTMGWFYGFKLHIVINDRGEIINYQITPGNCDDREPLKDGTFTKNLFGKLIADRG
YISQNLFDRLFVDDIHMITKIKKNMKNSLMHLYDKVLLRKRALIETVNDMLKNVCQIEHT
RHRSVNNFVTNLISGIIAYNILPKKPELNIEIIRNPNFPISA
>211586.12:NC_004347_1044878_1043884__892_17
VEVFCDVDDFCAVFIPEWEKTLLTDGTRKRQRAGRMTMSEVMTIIILFQMSHHRDFKNFY
IGYLAHFYKSAFPNLLSYTRFLEVMPTALVPLCSDFTCLKSEPTGTEFVDSTRIKVCHNL
RIHRHKTLAGLACRGKGTMGWFYGFKLHLIVNHQGGIVAAKVTPANVHDTKPMNEMVRSD
MDKLYADKGFISKALSSELQEKGVTLVTNVRKNMKEKVMSLWDRAMLSRRFIIETINDQL
KNISQIEHSRHRSGHGFMLNMIAGLIAYQLKDNKPQLNITSAEFNAIAVMAR
>264201.15:NC_005861_904960_903943__895_20
MDVTELYCTIDDFWKSFKQEWEKHLIDSGKHKKGPESVLSPAEMMTIIVLFHQSNYRTFK
HFYNYINFYLRNEFPKLISYDRFVYLKKNMFVPLFAYLMHRKGKVTGIAFIDSTSIAVCH
NKRISRNKVFAGLAKRGKNTSGWFYGFKLHIINNDSGEILAFQLTPGNVSDVSMAETLSK
GLFGKLFGDKGYISGKLTESLLEQGLELFTSVRANMKQKLMTFNDKILLRKRSLIETVND
QLKNISQIEHTRHRNIGNFLVNMLGGLAAYSHQRKKPSLNFREEKFCVAIAA
>319795.16:NC_008025_1160735_1159829__853_41
MCRPDLSLLPIPEALQHLTVWLTPQMPPKLIHPHEKISDGELVAVALLQRLYKAPYFKGW
WKLNHCPHFPSEVQARTRLERLTPVMERLATEVQALDFVAVDSEPLPVCTFKRAPRCKFK
GARHGFSTAGPVYGFKLHAWTTLNGKIAKYEIRPANEHDFTVGCVMNQDWPAYGRNGVLR
GVRSRRTGPKQIGDKGYQSGTYLTPPKKNAKRSDPRWKEEYAAARKIIESAFSVLVGSGL
RWGQVKTLVSLCLKVALLVLAHNLKFLDLSP
>326298.3:NC_007575_1794229_1795144__842_6
MEENIITIFCLVDDILKAINVKDDVRAKICNAEILTIGYMAVRYFHGNYYSAHQFFMSMK
PSYPIDYSRFIRRLNNLHNAIDYAFQLLSEVFYKTAKSTIYSVDSFPVEVCKIERSSTCN
IYNHKDMKGYNASKKRFFYGFKVHMVVTTNKEPLHCYISYANEHDATAAKRYLPAMKANS
SVIGDKGYVSKKLATFLTKFGVNLNAIQRSNMGEDKDCFIKRRLRKKVETVFSIITGRFG
NVIKATSIDGFLTKLKLFITAYSMDCFLKLSDDEKQLSI
>430556.3:NZ_DS264140_259491_260454__873_442
MINQLISTSCRIDDFCIIYHKELQSKSIDHQKKKVGFKPSLSLSKIMTILIMYQAVRYKD
FKTYYVEFIKIYWKHYFPKAPSYNRFV*LIDITMLPLIAFISSNHANHTDLYFIDATKPP
VCHNLRESRHKVFKGLAAKGKLVF
>440496.3:NZ_GL531740_135599_136558__826_14
VSFKDLVIICRHWYRLYAPAEFTHRRNIDQIKTTDSLILALLIWQAKTGIESQRRFCECF
NCLSHSRFNRRSRQLLQLIYQIRQEMNKKVDLNGHFLIIDSFPVPVCQPIRNYRAKIFRG
YANIGYKATKKIYFYGFKVHVIVSDDGYILDYVVTKASVHDARETVELLENTHPSNYYLL
GDEGYLGKELHQQLKQMGYELWTPYRKNMTGAKKHNDHQLMAIRRTIESDFSLLTYYNAE
NNRARSLIGFQSRLEIAILAYNLAYCLERFN
>457412.4:NZ_GG696071_5_1116__1021_113
MLKFQDNNTTVIATFEDFILTAYVIIDELYHQFAPPEVTRRRHILNAKLSDSEIITISLC
GELAGVDSENAWFSFVKRNYRHLFPQLCSRSRFNRTRRALMQTTELLRQKMISVFPIPVS
SYYIVDSFPLAVCKFGRARYCKAFRGHGADYGKCPSKKETYYGYKVHALITLEGYIASFE
ITPASTDDREGLRDLADHWSNVTILADKGYVGKNMKQEMQEKNICLFALKRSNSKENWPK
SVRQLIFKLRRRVETVFSQLSGQLNAERVLAKSFQGLCTRLVNKVLAYNLCIALNSIFGE
TCE
>491076.4:NZ_GG669817_270682_271494__673_14
VSFARLNVICRSLYKLCAPDELKYRKNIDQVKLLDSSILAMLIWQTEIGIESQRRFCKFF
VGLSHSRFNRRARMLLPLMRCIRQDWNQEVKTAGEFLIIDSFPVPVCQPIRNYRVKIFRG
ISDIGYKATKKIYYYGFKVHAIVSDDGYVLWTPYRRNMKGAKKHNDHQLMAIRRTIESDF
SLLSYYNAENNWARSLAGFQQRLEIAILAYNIAYCLERFN
>573061.3:NZ_ACPD01000136_4_1160__1043_105
MPEFNKDFIITINNLKDFIVVTYVIIDDFYQKVTPAFIMNRRNIDKSVMSDSEIITLSLV
GELLTIDSEKAWFGFCSKNLRDLFPNFCSRTRFHRVRKSLFRVTDAIRKEFMKFLNYQYD
RIRIVDSMPIPVCKFGRAHFHKSFKPKAAYGRCASKKETYYGFKLHALVALDGYITDFSI
TAANIDDRDAVWELIDNSVVNTLIGDKGYIGQKIASQLKEIMDINLLTISRNNSKIKLLK
PLRQLIFKARRRIETTFSQLSEQLNIQRVLAKSTWGFATRIVNKILAHNLCYFINKILNI
GIDTAKIKTLIFG
>857108.3:AHTD01000038_5400_4452__495_13
VCCPARNYKVRIFRDQATISYNPSKKMWFYGFKAHMLVTLSGFIVNYVVTPASVHDRQVA
EDLLENTPFPIVLADLGYLSQVLKQHLTQRGYHFWTPLRRNMANAKKHNHWKLKAERRTI
ETRFSVLCSDFDIERPLARSLKGLDLWLEQAIFAYNLRFFN
>880633.7:AEIR01000001_39338_38378__825_19
VSFKDLVIICRHWYRLSAPAEFSQRRNINRVKATDSLILALLIWQAKTGIESQRRFCECF
NCLSHSRFNRRSRQLLQLIYQIRQEMNKKVDLNGQFLIIDSFPVPVCQPIRNYRAKIFRG
YANIGYKATKKIYFYGFKVHAIVSDDGYILDYVVTKASVHDARETVELMENTHPSNYYLL
GDEGYLGKNCINS*NKWVMNFGHHIVKI*QELKSTMIIN*WLFAEQ*KATFRF*PITMPR
TIEHVV**AFKAG*KLLILAYNLAYCLER
>1000951.3:ALEA01000107_39025_37700__1153_29
MSESINPFMHFQIIKDYRQESKVEHKLSDIILLTICGVLSGHDGWDGIIDFGHARLDFLK
RYGHF*AGMPSADTLSRVMGMINPVALQRSFITWMKDCHTLTDGEVIAIDGETLRGSYDR
SKGKGTIHMVNALATANGMSIGQLKVDSKSNEITAIPKLLDLLDVKGCLITIDAMGCQKK
IAQKILDKEADYLLAVKGNQGMLEQAFDDYLRMDMLHDFDGSSYSTQEKSHGRIETRVAL
VNRDLSVLGDIEHEWPELKSMGTVASIRQESAVATEQDVSIRYYICSKELEAQTLLEATC
SH*GVEVMDWSLDTAFCEDNSRIRADDRAEAFARIRQICLNLLKSEPTFKGGIKRKRMNC
AMNEKYLSKVLESLT
>1004153.3:AFET01000001_1632501_1631211__1123_47
HISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWEDIEDFGETHLDFLKQYGDFDNGI
PVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKDVIAIDGKTLRHSYDKSRRKGAIHV
ISAFSTMHSLVIGQIRTDEKSNEITPIPELLNMLDIKGKIITTDAMGCQKDIAEKIQKQG
GDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDSYAISEKSHGREEIRLHIVCDVPDELI
DFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTVRYYISSADLSAEKFATASRNHWHVENK
LHWRLDVVMNEDDCKIRRGNAAELFSGIRHIAINILTNDKVFKAGLRRKMRKAAMDRNY
>1030843.3:NC_015571_2014765_2012216__2487_1888
MYHSLFESLCMVPDPRIERKKIYPLDFLLLIVFLSTLSGNTSWYEIEDYAEEYEEELKSL
YEMLTGHQLMHAMPSHDTLNRSISLLDVEAFEGAYKRWIEGFISATSGKHICIDGKTMRG
VKKLSFDTQSHVVSAFSPQDMCSLAQLYIDRKTNEIPAIHQLLDLLDLNGAVVSIDAIGT
QTAIVEQIIDKGGNYVLCVK
>1035116.3:AFSX01000048_38058_36818__1079_27
VTYCLFEVLFGSLCAVIAGSKGWFDIREYILGHHDWFKRNGLFVNGIPVDDTIARIISTI
EPESFHGCFINWMSSIHTLTQGQVVAIDGKTLRGSYNREDRSSTIHMISAYASSNKLVLG
QLKTEQKSNEITAIPDLIKMLDIKGALVTIDAMACQTNIAKAIVEQGGDYLLAVKSNQGK
LRQALEKAFSSQRANVVDTISLEQGHGRIESRQCYVFASTKLDGDFSRWKGLKSIVMVEN
FRFEKGKSVELEYRYYISSKGLSAEQAALAVRDLWGIESMH*VLDVTMNEDACQIYKGHG
AENLSCLRHMSLNMLRAEPTKLSIVGKQKRCMMSTTMLEAVLSAGFSHVVK
>1138874.3:CAHN01000013_1_1316__1221_91
MIDFIISIDDCAVELNSRQSWKIRYPLSTILFLVFVCQLAGIETWKEMEDFIEMNEPLFA
TYVDLSEGCPSHDTLERVISLVNSDRLKELKVQFEQSLTSLDAVHQLISVDGKTIRGNRG
KNQKPVHIVTTYDGGHHLSLGQVAVEEKSNEIVAIPQLLRTIDIRKSIVTIDAMGTQTAI
VDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEELQENAQYYQTVEKSRGQIEVRE
YGVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQENRYFIFSFKPDVLTFANCVRG
HWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKMCLYFLKVMVFPKKDLSYRRKQRY
ISVHLEDYLVQLFGERG
>1194706.3:ALAA01000012_23425_22260__1082_9
MSRFAACFEDLPDPRGRNARHPLMSILFIAVAAIVCGAESCTDMADFGVAKKKWLKTIVP
LPYGIPSHDTFSTVFRHLDPDAFDAAFRRLTASFAQGLEGVVAIDGKAVRGAYRRAAKAT
PLHFVNVWAAGPGLVIGQKLAPGRNEVQGALDALALLALEGSIVTADALHCRPDTARAIL
AAGGDYALALKANQPGLLAQALARIEDAGHVESIQIAAETAHDRIETRRASVVAAGDINF
PGLQAIGCVETTSRHTNGHLTSHVRYFLLSTTMSPSALIEVVRTHWQIENNLHWVLDVHF
REDAARNRKDNGPQNIAFLRKIALNLLRSHPDKASIRRKIKKAGWDDEFLTSLIAHMR
>1201295.3:AKZL01000037_43709_42492__1130_33
MSLFDHLKLIEDPRSYINLEHNLVDIIFLVLAATASGCHGWLEIEEFGHEHLSWLQRHRP
FAKGIPTRHSIARIIKAIDVEMMVLALFRWTNSLRASAGKPLIAIDGKTLRGAVNQNGTE
QALHLVSAFDTEQGLVLYQQDTKTKGSEVATVRELLHMLDIQDAVLTFDALHCNKETLAQ
IVKRKGDYVVQVKGNQPTLRKAIEALFQPHWETNAVDIPMFEESNKGHGREERRTTFQIP
ALLPKELAKQWPSAKSIIAVERERKRKGTTTIDTHYYLSSLDIEVELAARAVRQHWHIEN
QQHWVLDVTFKEDMSRIGDRDNAKKMALFRRIVLNLLQQHPLKVSKPSKMRKAAWNGDFR
SEIFFG
>1224744.3:AMCE01000039_1_1180__609_19
MPSTFKKTVETVLATGNHLLVQLKGNHPKLLAAVRTLCQSQPHAEQHYTVDLGRRNRIEQ
RTVRLWPLPPGSGTDPWHDHSQTVIEGQRQIEVFNPYHRRFEPRQESPAYYLATCTASAA
TLAQVIRGHWAIENRLHHVLDVSLGEDSSRIRRNPGVFALLRHFALNLLRHNGQANIRSA
LYDNAICLHRLLAYDGI
>1229493.3:BAOH01000005_92228_93453__1142_9
MPDSFLQHFEAIEDPRIDRCKRHELLDIILLAVSAVLSGAEGWEQIEDFGTHRLDWLRRY
RPFEYGIPRHDTIARVICRLKPEEIESAFQSWMSCLIESTGSDVIAIDGKTARRSFDTRG
RRNPLHAVSAWSSQHQLVLGQVVVDEKSNEVSAIPRLLTLLDIENCIITLDAMGCQKDIA
KQIVKGKADYVLALKGNHSGMKAELEAWWHKSMREGTTSETYDEYCEVSVGHGRIETRQC
EQLIVDRNWLGKDYRWDGLQSVIKVTATVEEKLSGKQSKETRWYISSLTLNAQQALDAIR
SHWQVESMHWMLDVTFREDESRIRRGTGALAFNVLRKIALSLFKQDTSKSISMVRKKKIA
AIDDEYRSVLLKTGIKML
>1234381.3:AMXD01000001_89952_88652__1137_22
MSYLDEIDDPRKPSNGTLHDFREILVILIAAVLSDCDTVEDITFWARTKEAWLRRFLVLK
NGIPSEETFLRILRALDPKQFENMFRRWVGGVVGALSDDAGLAGTIAIDGKTVRGSGSGG
ESAIHMVSAFATELGLVLGQEKVAAKSNEITAIPELLEALSIKGLLVTIDAMGCQKSIAK
QIVAKKGDYLLMVKGNQPKLLEAIETAFIDQHGVESVDRSSLVERGHGRTVGQIASVLSA
KGIVDLADWPKCVTIGRIDSMRVVGDKQSDLERRYYISSRALSAEQLAAAIRAHWGVENR
LHWILDVSFSEDASTVAKDNAPQNLSLLRKIALNIIRADKTDTRKSSLRLKRKGAAWDDG
VRERMLGIRAIC
>137722.3:NC_013855_1074464_1073202__1153_26
MAEGAGKSLLDHFSALEDPRQAWKVVYPLPEILLLVLCATLGGAENFVEIEEWGEDRLDF
LRRFLPYRRGIASHDTLNDVMNALDGELFSSCFTAWVDGLREGEPDIVAIDGKTSRRAHA
RAQGRNPLHLVSAWASRQRLVLGQQACEAKSNEITAIPLLLERLALTGALVTIDAMGCQT
KIAQAILDKGADYLLAVKGNWPILCGEIERYFSEARDGVSDTFTTTDGDHGRIEVRHHVV
SHDVDWLSTDRRFPGEPRFPALTSIAMVEADVEREGKPSRERRYFLSSARLDARLLAHAV
RCHWHVENRLHWVLDVVFHDDLSRLRSGFGPQNMAAIRHMAINLIRKAPGKQSLTVKRKK
MSWNADYLETVIRQRG
>137722.3:NC_013858_306057_304725__1248_22
MSSIEAGFGEKSRLKALLEHFSRIDDPRAPWRVAYPLPEILLLAVCGTIADCEDYEAIAA
WGEARLDFLRRFQPYHHGVPSGRWLTVFMNRIPPGLFQDCFLSWVREAWPDRPELVAIDG
KTSRRSHDRSLGQAPLHLVSAFATTSRLVLGQEAVEDKASELAAIPVLLERLATEGGLKG
AIVTIDAIACNATIAQAVRDAGADYLLAVKANQPTLRDEIESFFTSAPPETLDHAADIDK
GHGRIEQRAVTVARQVDWLSGARRFPGEVRLPAVAAIVRVVSKTELKDRCRTDTRYYITS
APLAAQAAAEAVRGHWRIENQLHWLLDVVFNEDQSRLRKGHGALNMAVVRHFAINLVRKA
AEPARPRSGLRRATKKPAATPRPTSIKLRRKLAGWDTDYLNAILDVNIR
>165597.4:NZ_AADV02000131_11235_9739__1331_201
MKLRPKTAISDFFSDIEDPRVERHKKHQLIDIITNTICAVISGVEHWTEIESYGKVKQKW
FKKFLKSPHSIPSHDTFSRVFQILNTEELQRCFLNWTQSVFELSESEIIPIDGKTLRHSY
DTASEKKAIHMVSAWSTKNKLVLGQLKVDKKSNEITAIPSLLKKLKIKGCIVTLDAMGCQ
KKIVEQIIEQDADYLIALKKNQSSLYEASEELFIKALAFNSSGLNPESFSEDNFSHGREE
TRAITVLNNSSYLVDPKSKWKNLKSIIRVDSLRVDHKGKVKFEQRYFISSLVLDAKSFAK
IIRTHWSIENQLNWVLDVQFNEDDSRIRKENSPENMAIIRQLALSLLNQDPTSKKSLKSK
QNKASWDNDYLLQILAV
>243265.1:NC_005126_4460712_4461964__1126_32
MSIFNFISKIEDPRSDINKKHELMDVIFLAFSAVLCGASGWKSIQEFGELQSEWLKQYTH
FTHGIPRRHCIANIIKMIEQDALVEAFYAWINQRRVRAGKSLIAIDGKTLRGTCKGTLFE
ALHVVSAYDVESGVALYHQAAESKGQEGPVARQLIELLALDGAIVTMDALHCQKETLALI
TQRGGDFIVGLKGNQKTLHEWVKSYFASHYESDELVEFTQKNSGHGRTEFRHVMQIRAVL
PEVLRRQWPSIQSVIEVVSERSVKGQPPHRNSRWYVSSLPLEAEIVAKAIRKHGSVENEL
HWVLDVTFREDAISLKDPDGAAQMALFNRIALSVIKQNTSIKDSQAAKRRRAIWSGEFRS
QLIFD
>314230.3:314230.3.fsa_23_167605_166343__1193_24
LIAAKRLSCRELFSMSSSSRASIQEHFADLTDPRTRKVTYPLVNIVTMSLCAVLGGADDF
VAITDWAEDKKEWLSQFLDMSTGVPSHDRFNAILGALKPAEFEKCLLSWITSLQEITDGQ
IIAIDGKTLRRSFDAASSKAAIHMVSAWATANHVSLGQVATDAKSNEITAIPKLLEIIEV
SGCLVTIDAMGCQKEIAAKIVNAGGDYCLAIKGNQRYLHQAIRDHFAAAMEIDFAKMKVH
RHETHEKGHGREESRYYYLCPIDADDFPYASRWTKLKAIGMTINIVKQNGKETSEVRYYI
VSKYLTGKRFAEAVRGHWSIENSLHWQLDVTFGEDQSRIRKGHADVNFSLLRRTSLSLLK
NNKTAKVGVKNKRLKAGRNDAYLLEVLLGT
>319224.13:NC_009438_262735_263974__1114_14
MLKHLDNITDCRSHINQEHDVIDICFLVLSAVISGAQSWSACHEFGTLELEWLRKYRPFT
NGIPSQQSIGRIFRGVSKQSLLDALMSWVNEYRVNTGQSSIAIDGKVLKGAKASASSAAL
HMVTAYDTGSGLVFSAKSGASKKSELKLVQELLTCLDLKSELLTFDALHCQSQTLDYIAK
EGGDCILQVKGNQPKLYEALQAQFTDYIENNPDAECFTETNKGHGRVEKRITFQCPLNLP
AEIKMKWSQLKTLIAVERHRKVGNKTSIDTHFYVSSAVLTSEAFGRAIRAHWQTENNQHW
LLDKLFQEDKQKMYDEDGASILAILRRWALNLVKLHPAKTSQTQKFNRACWSDDFREEII
FGTGQKV
>320771.5:NZ_ABOX02000008_44598_45828__1159_17
MQKHHRQNLIEHFKEIRDPRVKGRCDHELVDVLMIGLCCLLCGGETFNDMEDFGKAKRKW
FKTFLRLRHGIPKHDTFNRVFAALKPEAFLDCFMRWTQSVRATVADEIVALDGKALRRAL
EQGQSPRVIVSAWAAGNSLVLGQIQVPDKTNEITAVPQLLRVLELSGCIVTLDAMGCQKE
IAREIVEADANYVLALKGNQGQCHQEIKAYLEDAVARHDQERPVEKNAVALAYKETTEKD
HGRLETRRYWQSGDVSWLADRQQWAGLRSVGVVESVRQVGQQAPTVERRYYLSSLNVDVE
KFARAVRGHWSVENSLHWVLDVQCGEDRNRARSGHAAENLATLRRLALNLLKRESTKKRG
IKGKQLNASWDHDYLLRLLSF
>329726.14:NC_009925_5054939_5053677__1177_26
MTSSPFASIIEHFSDLDDPRAAHRIEYSLEDIIFITLCAVLCGADNWVEVANYGCSKAQW
LKQWIALPNGIPSHDTFEWVFARLKPQQLQQCFLNWTQAIYHLSAGALIAIDGKTLRGAI
ATGEQRSLIHMVSAWASHNRLVLGQRTVEEKSNEITAIPELLKILELEGALVSIDAMGCQ
TAIAETIIEGQGDYVLALKGNQGDLYNDVVQLFDHACQTQFQGIEHDSYQTVEKGHGRIE
HRTYWTMGQTDYLLGAERWAQLKSIGCVESCRRQPGHPGTLQRRYYLLSIESDAQRFADA
VRSHWGIENQLHWILDVGFREDKLRACQGYSAQNLSVIRHIAANLLQQESTAKCGVKAKR
LKAGWDDDYLVKILSAAAKGIPAS
>360117.3:NZ_AAYJ01000004_2113_790__1166_24
MEKTTCKSLKNQYLFHCFLSIKDPRVPGRCIYPLINILLITLCALICGVDTWKGIADFGK
KRYRWLSQFVNMRCGVPSTLTFARVFSLIEPEQFQHCLSAWMSQFFQLLRFDMIHLDGKS
LCGSARRGKAQKATHIVNAYLPKEQVTLGEVRVPDKSNEIKAIPILLNSLNVQGCIISID
AMGTQKGIANLIRLKQADYVLALKKNHTRFYRYVERLFSCSDERDYQGMCYRTEETKDYG
HGRIEERSYCVLPMMYFHKYKKYWRDLQAIVRVQSKRHKGNEIETATRYYITSLPFAEHR
RMSQAIRQHWAIENQLHWKLDIGLGEDASLITRGYADQNLATLRKMVLKMLENENSSKQG
IAGKRIQAALSTRYLRKVVGF
>386429.3:BADY01000112_1202_1__1127_33
MSLFSHLELVKDNRSHINQHHNLVDVLFLIITAVTSGCESWQGIEIYGESKLNWLRGFRS
FKNGIPTRHSIARIFRTVDTDSLLLAMYSWVNQNRVKSAHPVIAFDGKTIRGASKHIADK
LHLVSAFDCEAGLTLFHQTVGSKTNEIPAVRDLLKILDINNTVITLDALHCQKETLKQLI
SRHADYLVQAKGNQKKLYSAIQDAFTHQYESENSEILSHVTQDEGHGRKEVRTIDCLDAR
LLPSEIKESWPSVRTIVAVQRERTKGNRTSIDTHYYLTSLTDNILINKAIRQHWLIENQQ
HWILDVVFKEDACQIHEPLSAQHMALFRRVVRNMIKQHTKSKGSIRSKCVRACYDDAFRE
ELLFG
>395961.4:NC_011885_82166_83427__1198_68
MPPTVNRESLSACLEQYFGEITDPRVERTRAHQLLDIIAIALFAVLAGADSWVGIETYGQ
AKRAWLETFLALPNGIPSHDTFARVFARLDPEALETRFQHWVKGVVSTLGAQVIAIDGKT
AKGSYDREGGVKALQLVSAWASEHRLVLGQCAVDTKSNEITAIPVLLEQLALAGCIVSID
AMGTHQTIAAQIHKQQADYILALKGNQPTLFKQAQQWFEEFQTGSNAGAEYTQHQQCETA
HHRIESRRVFQVPVEQVFTPKQGRDWAGLRSLVVIQSQRCLWNKDTTETRYFLSSLSTDA
ATFAHYIRAHWGIENQLHWCLDVVFNEDKSRIRKDHAPRNFSLLRRLTLNLLHRDSSKGS
LVMKRYRAGLDDQFMMQ
>404589.10:NC_009675_684052_685418__1355_30
LRACGPHPQDGRTRANEKRPGGRRSCRSPKHKPGVPCGTPTSPGTGRSTTPERTRGSFTT
TSVSWAAWPPRSPSGAGACAARRTSSRTSACALGLGRGKPCDTTLYRLLAEQSPAGLEET
VFAQVKDLIARKVVRNDLLALGVVSFDGKGTWSRTDGEKVKGAQQSAYDAEGSSLQTFGA
LRAALTSSSVCPCVGQRLIGSKEGESTAFRRLLPAISEQLGGQFRIVTGDAGLCARENAE
LVTSLGRWYVFGLKDNQPYLHDIARDYGQYDLGTPLARTAERYRGHTIVRELYARDVAGN
PAAAIEAAQQLWYVCQTTTDRRGEIVAVEQRYFVTSIPTGTLTRDQELALVRMHWAIENG
CHWTMDVMLGEDEGHPCQASRASIETVSWLRLIGYNAVSAWRTLAPRKDGRPVAWARAME
TLRDALLAAEVTDHRELASAVT
>46234.3:CP003285_193123_191517__1413_283
MKLPPKITIVDHFKDLEDKRVERTKRHKLIDIVTIAICAVICGVDSWVLMEAYGKKKEKW
LKQFLELPNGIPSHDTFARVFARIDPQQFQNCFLSWIKSINKITEGEVIAIDGKTLRHSY
DKGKDKGAIQMVSAWATSNKLVLGQCKVEEKSNEITAIPELIKVLDIAGCLVTIDAMGCQ
KEIVKSIAEKSGEYIIALKKNQGNLYKNVEEIFKEAISKGFEGFKYSEFHTKEDKHGREE
IRHYLMLSDIEERIDTDKKWVNLQSVGMVEYIRKVNGKTKVETGYYISSLTNNAKLLGES
VRTHWGIENSLHWVLDVAFREDDCRIRKDNAPQNFAVIRHIAVNLLGKEKSQKLGTKSKQ
FCAGWDDEYLEKILECI
>497965.6:NC_014534_168809_167180__1417_245
MKLKPKTTIEDFFGKIEDPRIERTKKHKLIDIITITICAVICGADSWIDIELFGKCKYKW
LKKFLELPNGIPSHDTFARVFSLLEPEKLQQSFLKWIESISSLTQGEIVAIDGKTIRHSY
DKSKDKSAVQMVSAWATTNGLVLGQSIVDEKSNEITAIPDGQLTVRRATAHPCPQLLKVL
SLSGCIVTIDAIGCQKEIVKQITEQDADYVITLKKNQVNLYEKVEALFKKALINNFEGFI
KSEYKVKDEGHGRQEVRYYQMLSNVAEEIDPDWQWLNLNSIGYVDYLRVENGTDKTSLDR
RYFISSLNNNIKLFSKAIREHWCIENQCHWVLDVQFCEDDSRIRKDNAPANIAILRHLGL
NLLKQEKTQKVGVKAKRKKAGWDENYLLKVL
>878320.4:CACP01000129_1212_1__1144_32
MQEARAMTLIEHLTLVEETRSEINRKHNLVDVMFLVISAIMSGAEGWNDIETYGDSKIDW
LRQHRPFANGIPRRHTVARILRCIVIDTLLEALLCWVNEQRTHQGKPIIAFDGKVLRGSF
RGNAKDALQLVTAYDTENGLVLSQKATPNKKGEIETVKDMLDILELKGAVVTLDALHCQR
ETLEKISEKKAHVVVQVKNNQPKLYQAVQSQFQSLFDAQKEKIVVEHKESGHGRQEERYV
FQLKAKLPPELTEKWPTIRSIIAVERHRSANGKGTVDTSYYVSSLSPKHKLLGHYIRQHW
RIENSQHYILDVVFNEDASRIAMEDAVENMALFRRFVLNIVKQSNCGARSQRNKLKRAGW
NDDYRAQLFFG
>993516.3:AMWG01000023_160279_161580__1198_23
METAMLSQIDVFHDCFDQVEDPRVPGRTTHPLNSILFLVVAATIADADGPEEIECFGNER
LDWLSRFADFPHGIPSHDTIGRVLSLIKPKQFQQALLNWHTQLCQQYRDSEDKRDRDEEQ
SLPIHVAIDGKTARGSCTNAEKSNAIHFVSAWASKHGVTLGQTEVDSKTNEITAIDELLD
FIDVRGTIITLDAIGAQKSIAEKIHRNDGDYIFAIKDNHPKLANAIREHFELVHEEGLKA
NGVKSKKTVGKRSGRQEERFYAVCPIPPEMKAMTDLWAGATSIGQAITQTERNGECHVEV
RYFLLSRPARVGEFAISVRSHWSVESMHWVLDVVFHDDASRIRTKNATANFTFIRRYVTT
LLKQDTTKRSLKQKRKKAGWNTDFLDKLMFSA
>103690.10:NC_003267_17443_16109__1260_31
MSDNQVVESIQDKYDSLKPYLNEKTRRVWAAIEARSLGWGGISQVALATGLSRTTIHAGI
RLLLEASEEETSNGDSNRIRSSGAGRKLLEEKDAMLLSDLESLIEPVTLGDPESPLKWTS
KSVVKLAAALNIGGHRTSPKSVYNLLESLGYSLQSNRKTRDGSSHPDRDDQFLHISKQVL
HFQSQNEPVISVDTKKKELIGDFKNSGTEWCEKARPIEVKMHDFVDPKLGKAIPYGIYDL
TSNQGWVNVGIDHDTAEFAVESIRHWWYSMGKEVYPKSQHIMITADCGGSNSYRSRLWKL
KLQELATETGKTIHVCHFPPGTSKWNKIEHRLFCHITQNWRGRPLTSLQVVINLIRNTTT
TQGLEVEARLDPNLYKTGIKVTDQELETIAIERNSFHGEWNYIIKPKVGT
>106370.11:CP000249_1322900_1321177__1661_15
VERINEVVLAEKFAVLLPHLDERQRRLVLGADARAFGHGGIRLVARAAGVSVDTVSRGVA
ELGAGAASTGRVRAPGGGRKALREKDPELVAALLALVEPDQRGAPESPLRWTVKSTRRLA
EQLTARGHPVGADTVGGLLRAEGFSLQGTSRTTEGARHPDRDDQFRYINERVKEFTAGGQ
PVVSVDTKKKEVLGDYAVAGREWHRKGQPVRVRAHDFPEKGAQKAVPYGVYDLAADTGWV
SVGCDGDTAAFAVATLRRWWDGEGRHRYPTATRLLITADVGGANGYRVRAWKKELADLAR
TTGLQITVCHFPPGTSKWNKIEHRLFSRISTNWRGRPLTSHEVVVNTIGATTTRTGLSVH
AELDPGSYPTGLTVPDEVMDALPLTAHDWHGPWNYTLAPAPPRAVSTPASRYVETGQPDD
RAPDWLHHPTITGMNGGEYATLLASVEQYILDHPPISLHPKRARHRVLRRGPLSLSDRLL
VTVIHHRWTTQQQALTRLLGSPRGAVGDAIHEMTPVLDGLDRRIQPAPITAPTVQDLTTL
IHNIKNGPY
>1116232.3:AHBF01000036_88630_90376__1625_48
ERQQRLTLGAVARVLGHGGIRVVAGAAGVAESTVSRGKRELEHAEEPAGRVRAPGAGRKP
LREADPGLVPALLALVEPDQRGDPESPLLWTVKSTRNLAGELTRQGHRVGSDTVATLLKA
EGFSLQGTSRTTEGARHPDRDAQFRYINDQVTAYLAEGQPVISVDAKKKETLGSYAVIGR
EWHRAGQPVQVRAHDFPEKGAQKAVPYGIYDIGADTGWVSVGCDGDTSAFAVATLRRWWN
GEGRRRYPHASRLLVTADAGGSNGYRVRAWKKELADFAYETGLEVTVCHFPPGTSKWNKI
EHRLFSQISVNWRGRPLTSHEVVVSTIGATTTRSGPSVHAELDPGVYPTGVTVPDTVMER
LPLTPHEWHGTWNYTLRPEPLAPELSPPSAGFGRFPTGDKLPMWLRHPSLTGLEPAAFGD
LAARYQAWCAEHPPIFLPGKRPDGGPGAGSGRLSVADQLVVFLLTKRWSMARTPLAEATG
LAKSRIGATLREATPVLTALGYTVPVGALTVTTAQQLAEIAGHDLT
>1165867.3:AJJH01000153_33346_31176__2108_18
VSEVDGRLRERFEVLLPHLNERQRRLALAAEARSLGHGGVRAVARAVGVSETTVRRGVFE
LEAGEQPAPTGRVRRPGGGRKGADALNPQLVPALLALVEPDERGDPESPLRWTTKSLRHL
AEELTRQGHPVSAPTVGRLLRDNGFSLQANAKTLEGEQHPDRDVQFRYINEQVKAHQDAG
EPVISVDSKKKEQLGQLPTPGREWRPQGDPVRVVDHSFFTGPNADRAIPYGVYDLTTDAG
WVNVGVDHDTAAFAVASIRRWWQARGAADYPHARRLLITADAGGSNSYRYRLWKAELAAL
ATETGLAITVCHFPPGTSKWNKIEHRLFSQITMNWRGRPLTSHEVVVKTIASTRTRTGLR
VDAELDTGDYPIGISVGRDELRALPIRPHAQCGTWNYTIEPTHADAAPVPGRDREGERVA
AVAMLADSRLTGMTGDELDELTARLAPAQAARAEQRRWHQRGGRRRNAPGAGGRRLLSDA
AALLITVVYLRQVCPQRVLSDLLGVNPNSIGEIIAETRMLLDEHGHHVTPTIGLRFSTAA
DLAGFLRDGTAPDPTPNRPLPEALSHPALTGMSRRQLGDLVERLAVRQAAMVERRRYAQR
GGERMPGGRGGIFLQKITDAERVLATVLHIRQLCNRAVLAELFQVSPRTIGNALLDVRPL
LEQDGYTPAPATIRYRTAAALLAAIPPREGDTPESAH
>1242864.3:ANAH01000114_157902_159190__1217_18
LETVIRTKYEAISPVLDERARRLWAAAESQAIGYGGDAIVSAATGLARATIRAGRAELEQ
GVTATKRVRQPGAGRPNIERTQLGVKKALERLVSPLTRGDPMAPLRWTCKSKAHLADALS
KEGFSVSATTVGHLLHELGYSLQAMRKSQEGTSHPDRNAQFEHINEMAADFQQRNQPVIS
VDTKKKELVGDFKNAGQEWQPKKTPEKVQVHDFPDDAIGKAIPHGVYDMARNEAWVSIGL
DHDTPAFAVASIRQWWRTMGLQSYPHATELLITADAGGSNGYRPRAWKLELQRFADETGL
HISVCHFPPGTSKWNKIEHRLFCHITQNWRGRPLISYATIVNLIGSTHTATGLHVKARLD
RKGYPTGGKISNAEVKRLALKKSKFHGEWNYEISPRKLAN
>1297569.3:CAUM01000027_8659_9982__1236_19
VIDDSAIRLRFGALDPLLDERGRRRFAAAEALAAGHGGVMAVSRATGIARSTITRGLAEL
REEAVLAVPLDRVRRAGGGRKSLTATDETLLGDLQALVDPVTRGDPMAPLLWTAKSLRNL
AAELQACGHRIGHNVVATLLRELGYSLQANRKTLEGASHPDRDAQFHYINDQVKAALAAD
QPAISVDTKKKELVGDFKNNGREYRPKGDPEKVRVHDFKIPELGRAAPYGVYDIADNAGW
VSVGIDHDTASFAVNSIRRWWQTMGQQRYPNARQLLISADGGGSNGSRVRLWKIELQSLA
NELDIDITVCHLPPGASKWNKIEHRLFSFITQNWRGRPLVSYQTIVQLIAATTTKAGLTV
RSELDTNAYPKGIKVADADIDALNLHRHDFHGDWNYTIKPQPNMVR
>1316445.3:AROY01000426_5728_4032__1643_18
MRIPDEINTQLTVKFTVLFPHLDERQRRLLMAAEARVLGHGGVRAVARAASVSETTVRKG
VFELEAGEEPLGRVRRPGGGRKRAADLDPGLRPALLALVEPDERGDPMSPLRWTVKSTRT
LARELTRTGHKVSADTVADLLREEGFSLQANAKTIEGSEHPDRDAQFRYLNGQARNHRDA
GQPVISVDTKKKELVGEFKNNGRERRPAADPVPVNVHDFPDPQLGKAVPYGIYDLAANTG
WVNVGTDHDTAAFAVESIRRWWSGQGRAAYPQATRLLITADAGGSNGYRTRAWKLELARL
AAETGLTITVCHLPPGTSKWNKIEHRLFSHITMNWRGRPLTSHEVIVQSIAATTTRTGLR
VMAELDTNTYPTGVQICEAEMAALPMTRHPFHGDWNYAVHPQPCPAIPAPRAPQKPAPEW
DHALLSDPSLTGMSRQQLSDLTGTLAVDGDVKRGRRPRLTFPDQVLATVLHLRVALAAEP
LAVLFGSSRTAMHRTLLKIRTLLKAHSIVISPAATPPSALTALQARVRALSGDPSSMIKT
TC
>378806.7:NZ_AAMD01000019_9311_10614__1188_19
LRSVMDERVRRYWAGAEALALGRGGVSVVARATGLSRMTVRAGQEQARGKKPPEELVRVR
RRGAGRPRAEAAQPGLMEALESLVDPATRGDPESPLRWTHKSTVQLAGELERLGYKARRQ
KVGELLRGLGYSLQAVHKTLEGESHSDRNAQFEHINAEVKAFQKRGQPVISVDTKKKEWV
GEFKNGGREWQPKGAPVLALTHDFPDTAEGKVIPYGVYDVGTNSAWVSVGVDHDTPVFAV
NSMAAWWSKLGKACYPEAKELLVMADSGGSNSAKSRVWKAQLQKLADATGLSISVCHFPP
GTSKWNKVEHRLFSHLSINWRGRPLEDYETVVQLIGATTTRKGLKVKARLDKRRYSTGLR
VSRAEMKKLHLVRSDVHGEWNYRIEPNSAN
>443255.6:NZ_DS570638_46138_47956__1736_51
MEAIEDIAVALAAKFTVLLPHLDERQRRLLLAAEARSIGHGGIRLVARAAGVREATVSLG
VTELDSGEAPLGRVRRVGGGRKRVVDLDPGLRPALLALVEPDVRGDPMSPLRWTTKSTRH
LAAELTRQGHRISADTVADVLREEGFSLQGNAKVIEGKQHPDRDGQFRYINDQAKDHQAV
GDPVISVDTKKKEVVGPLKNGGREWRPAGDPERVSTHDFPDRELGKAVPYGIYDLAANTG
WVSVGTDHDTAAFAVESIRRWWKARGTQDYPQARRLLITADAGGSNGYRTRAWKAELASL
ALETGLHITVCHFPPGTSKWNRIEHRLFSHITMNWRGRPLTSHEVIVQSIAATTTRTGLK
VHAELDSATYATGVRVVDRQLDALPLARHEWHGDWNYTLRPEEYCRDGTPPIPPQDLPGP
DRAWLVHPDLTGLQPDQWDRLITQLRAARELQREEDLHQRRGGDRQKVPAAGLYTGRRPG
LTLVDRLLATILYQRFKLPQVVIAPLFTVTPVTLNRAISQTRRLLDQIGHTIEPATTPLA
TLDDLAHLAARLDTAPTTKIKT
>465541.3:NZ_DS570384_208361_210112__1609_17
MGAEARVLGHGGIRAVAQAAQVSETTVRKGVDELEDGAEPLGRIRRPGGGRKRAAEADPE
LRPALLALVEPDMRGDPMSPLRWTTKSTRRLADELTRQGHRVSADTVADLLREEGFSLQA
NAKTLEGAQHPDRDAQFHYINDRAKEHMGAGDPVISVDTKKKELVGPYKNGGREWEPKGA
PAQVKTHDFLDRQGPGKAIAYGIYDVAANTGWVSVGTDHDTAAFAVASIRRWWQARGSHD
YPQAARLLITADAGGSNGYRTRAWKTELATLAAETGLEITVCHMPPGTSKWNKIEHRLFS
HISMNWRGRPLTSHDVIVNSIMATTTHTGLRVHAELDPGTYDTGIKVTDTDIDALPMHRH
RFHGDWNYTLHPQHGDTAGAAEDPRSAEGLPPQSRASGLRNPELTGMTEPALDELVDQLS
QKLDELREHGRSQQRGGDRIRARGAGAKDKLTTADRVLAAVLYLRKLGTRDLIAQLFGVN
GSTITRAVHHIQPLLADHGCTVRPSTARFRTPADVTAFLTNSNPTEIKSAC
>485913.3:NZ_ADVG01000001_2458934_2460220__1235_27
MKEEVAIKQRFEQVSGKLNERSRRLVAASEALALGWGGISAVSRATGLSRKAISHGIKEL
REEEGGREGRIRRTGGGRKTTVSKDASLREDLEQLVEPVTRGDPESPLRWTCKSVRKLAE
ELRKRGHQVSHELVSQLLHGLGYSLQANRKTREGGDHPDRNVQFEHVNAQAEDFLAAGEP
VVSVDAKKKELVGEFKNPGREWGPQGQPEEVRVYDFPIPGLGRATPYGVYDLGQNAGWVN
VGMDHDTAAFAVESIRRWWKTVGQHQYPDAKRLLISADGGGSNGSRVRLWKWELQQLANE
TGLAITVCHLPPGTSKWNKIEHRLFAWISQNWRSKPLTSYAVILQLIAATTTKAGLTVQC
QLDSNRYPAGRKVSDEEMATLSIVPDPFHGEWNYTIYPKESSN
>653045.3:NZ_AEDI01000110_20288_22025__1684_2
MTSCLSGRVAARALRAKFDQILPHLDERRRRLYLASEATVLGRGGIVRVAAVSGTSTATI
ARGMAELASCPPPTLRVRAPGAGRKRLTDTDPGLLPALESLIEPHTRGDPVSPLRWTTLS
LRALASTLTTQGHPVSASTVGHLLHTLGYSLQGSAKTTEGISHPDRDAQFTHLNATAAAF
LNDAQPVIRVDTKAKEWLGNRDRPGRTWRPGKSAIKVDCHTFTTNDQPMAIPYGIYDIAN
NSGRVNLGTDHDTAQFAVESIRRWWQHRGRADHPNATRLLITADSGGSNDPRRWTWKSNL
ATFARESGLEITVCHLPPGTSKWNKIEHRMFCHITANWRGRPLTSYQVVLETIAATTTRT
GLTIGAELDTGSYDLGISVTPAEFHALAITPNTFHGDWNYTLSPVPPRAPDAPATTHRTD
PALTAMLTDPALTGMSRTAFEHLVAVSEPFLGGLGRSSIPATLPPPAQLPPPTDQQRGPH
PPAPGSHPPPPQSGDHDVPGPTTGRQPHQPVHPVPGRKTAPGPAPDPHHADTRIASPHIG
TATRPNTPRGNPSLTVIEIRA
>698760.3:AEJB01000361_446008_447767__1706_48
MPIPNEVRDQLALKLGVLLPHLNERQQRLALAAEARLLGHGGVRAVAQSAGVSETTVRKG
VFELEGGEDPLPDGRVRRAGGGRKSAEELDPLLVPALLALVEPDERGDPMSPLRWTTRSL
RSLAGELTSQGHAASAPTVGRLLRENGFSLQANAKTLEGAQHPDRDAQFRYINGQVKDHQ
ADGEPVVSVDTKKKEVVGEFKNAGRQWRPAGEPVRVDVHDFPGDALGKALPYGIYDLAAN
TGWVNVGTDHDTAAFAVESINSWWNGQGRLDYPQARRLLITADAGGSNGYRTRAFKTELA
AFAARTGLAVTVCHMPPGTSKWNKVEHRLFSGITMNWRGRPLNSHEVVVQSIAATTTRTG
LTVHAELDTGAYPIGVKVSDAELNAVPVTGHAFQGSWNCTVHPHPASPAGPTGPTLGPTA
VFDRGALSHPALTGMTCTALTELTETLTVDWQTLQKQDPAARRDGGERRRAPGGGRKAKL
DLADRVLVTVLHQNLALPPTVLAHLFAVSKDTIRHTTSEIRRLMDQHAHTLRPPAAHLNT
VAGLLVHAAAHGV
>743299.4:NZ_AFJD01000039_2510_1228__1229_543
MEADVLIAARHQALEGILDERQRRLHAAVEAKVLGHGGVKRVSEATGVARGSILAGLKEL
KDPENTLPKGRVRRPGGGRKKLVDRDPDLLAALERLVDPAARGDPQSPLRWTCKSLKQLA
RELGEQGHRISHVSVGILLKELGYSLQGNRKTLEGTGHPDRDAQFQYIQEKTQQALDAGQ
PVISVDTKKKELVGNYKNAGQEWRPQGEPEAVQMHDFVDAELGGLIPTG
>88274.4:NZ_ADZZ01000006_2642_1308__1266_34
METQQKEALINQVKQRFQLMVAHLSEKDKRIWAASEANTIGRGGDTIVCQATGISRVTIG
RGKKELTGKADGVKRRIRKPGGGRKRLSDKNPALIKDLDMLIDPLTRGDPESPLRWTCKS
TYKLSEALRKKGHNVSQKTVYLMLQKMGYSMQANRKVKEGKQNPDRDAQFNFIYKQVKDF
QNDGQPVISVDAKKKENIGQYKNNGMEWEPAGQPTNVNTYDFPDKEKGKACPYGIYDLTR
NEGWVSLGISRDTAQFAVESIRRWWSEMGCFRYPVATRLLITADGGGSNGWRVRLWKKEI
QSLANELGISISICHFPPGTSKWNKIEHQMFSFISKNWRGRPLDSLGTIINLISNTTTKK
GLKIEANIDDAQYEKGLKVGDDEMAQLNIERASFHGEWNYKIMPQEVMYEA
>88274.4:NZ_ADZZ01000067_28360_26970__1337_15
MENKIEPIVNEKFNTLLPILDEKGRRLWAAAEAKSLGRGGILFKIMFLG*ISLENPYF*G
RSALPTQNLFLKVYISAVSKATGLSRTTIYQGLKEIEPSNAAKPATNRTRARGGGRKPIT
KVNPIILRDLEGMVEPTTRGDPESPLRWTCKSTRQLSRALQVMGHKIGRQKVSELLADLG
YSLQANRKVREGSRHPDRDAQFRYIYNQVKVFQENNQPVISVDTKKKELVGDFKNAGREW
QPKGQPDSVRVHDFADKNLGKVNPYGVYDQTANVGWVSVGIDHDTSSFAVESIRRWWKRM
GQQTYPEAKQLLITADGGGSNGYRIRLWKIELQRFADDQGLEISVCHLPPGTSKWNKIEH
RMFSHISMNWRGKPLTSHEVIVNLIANTTTRQGLKIQAEIDSNSYPKGIKVTDTELENVN
LFKADFHGEWNYSIRPKCSSY
>886293.4:AGRX01000073_24887_23553__1266_25
MYDPLVIAQIQRKFHLLSPEMDERRRRQWAAAEAKELGWGGVSLVAHATGLSRPTISAGM
RELERPIAQRTVEGTRVRRPGGGRPTAAKSDPGLMAALESLLDPVTRGDPESPLRWTCKS
TRRLAEELSRQNHGVGPRTVATLLHEAGYSLQANRKTREGVAHPDRNAQFEYINASVGRA
LARGQPAISVDTKKKELVGDFKNGGREWHPQGEPEEVRVHDFLDKTLGKAIPYGVYDMVN
DQGWVSVGIDHDTAQFATHSIRRWWQEMGRERFPRATELLITADGGGSNGHRTRLWKVSL
QALADDLGLMLSVSHFPPGTSKWNKIEHRLFSFITQNWRGKPLVSHQAIINLIAATTTKS
GLIVKAVLDTNHYPLEIKVSDTELAALCLERHEFHGDWNYTIAPRIKKSRFQKL
>ISC1200
MLNFQGEKVDKVAKTLISACLWNDSVENKSRAYDVSPQTVRNYVEKQGMEVIEKLLERAR
KISLEILKGVKEIDLSIDWTTKTWYGKPVKGSSEKGNSWNYATTKYKGKVLLLAFIPQVN
GMTKDEIVKVLVEQVMAMGFKIRLITLDAGFYTVDVLNFISQFKYIIAVLVGDVKVYEEF
DGDYTTNSKRHRRDEQVKFRFLVYSKEEVRRKSLVYFARATNLDLSKREVLDLYNKVRGP
IETSYRNIKAFLPFTGSTKFVFRTLIFVLALVLYSLYTIFKGEVGREEFRLLLILLFPDL
FNPENFTFNAIETLIYTIDLFLRR
>ISC1359
MKHENTTKPAKFNRDFARSALKIIYSVLTKILFPEELLSALLKASGSYLSRLGKDGRRAL
RKLNAVQVEDVRDALRKMGRMTLRGVRDRRVAVDFHAIPQYHADKSFLSRIKPTKGTSWG
LVQAAIFLLGRTRSFLDVIPVTVKNVAEGFKAVMEVIVKELEEDKLRLVMVFADREFAVN
EVIRFLLELGLDFVISAKAQMYKKYKGMLQDVDVSFGGVRYTGFLCVRHGSGAYLIILRK
EDGKIIAFLVRKEMDLYDAIVLAEMYRERWGIENAFRSLEEFRIRTRTCDVRKELVLVLL
SYLLLNVWFLIRSWRKVKLWEFSVSLSNLLDREVRVEQERAFREVKTSFPQTPANPMHLL
PAT
>ISC1439A
MQTIQVSKTELKSLAINLATNNINVISQDLDPEIVKAAPSLLTGNRGKYYLKVVRRGEKV
ISKGQRTFKFYPIYREVKGEINVVAVDETGLTVGEKEQEKAEGFLLYNWKRKGVKMRSLD
LVYPLRLPLLVEVADLRSDSPSQFLLRSVREVSQYMEIDYVVADAGFLNLGVIKEMPVKT
IVRGKSNLKGFKELSNVPLVEKRYEVKDKVYVAYRVLKFEGLYYYDVVYVKGKPRHFMFV
TNFEGDPYELAELYRLRWQVEEGFKVRKARIRYVRKLSNKIFLFLYYTVLDSAWNLVNHL
LFNFKSTCKKVLSFDSFVKLL
>ISFac1
MNNKTIPPKLNANKVKKFYSSQMYNIFSNNIHVQSRYNSGDIVNTVRDAIAHKMYVETYV
RNYHRIHTPSGDTVFKRIYEAAVNHGIDLLTMLIDNTVKMAMELNAFNSYVNVAIDEHDE
PYTGKDNPYLIDAPFHRFRGTDMAYRFATLDCVDNNRFTLAAMVKHPLDVINNAKEVRMV
IEHALSLGIK
>ISH20A
MQQPEADSKIEEEHLLNFVVNSLDEELAIDLGENVEVTTEKLYEVLAGASAGGTSINHVC
ETTEDSPHANTVRGHLTDQFDLDSVEAVGDTLLQRDALETLPDRPVEVCADLHLDPYYGD
EDETEALYFSQAKRGTTTFHAYATLYARVPNKRYTLAVRQLVAGDTTSDVLTEFLELLNG
LDLGVKAVYLDRGFYNSTCLGLLYAHNYAYVMPIVKWGETIQDELSRGWSREIEHDLAGE
VAFPVFIDCVYQQGRYDEHGVARHGYAADAPFIDTPRDAREHYSKRFGIESSYRLAKQSL
AFTSSQDAGLRLVMFVVSLLLQNSWRYLHWKYVAAPRRGGRRLWNWSFTEFCEMVLRAAW
TALGVRRAVPANQSLDDRFFR
>ISH27-1
VSTTQQADGEIHEDQLLNFLVNALDEEVALTLAENAEIDAEDIYEVLVGACVHGTSVSTL
CEKSEDAPHENSVLYHLRTKFDLETLEQVGNALLQKDVLDVLPQQVEVVSDLHLRPYYGD
EDGTDGLYHSQAKRGTTAFHAYATLYARVKNKRYTLAVRRLEDGDTASSVLAEFLGILRR
LDLDVKAVFLDREFYDSKCLTLLQAHNHAYVMPIVRWGQTIKQELSEGWSRVIQHDMTAK
LDGHSWTVEFLVYIDCTYQNGRCDEHGVARHGYAADAPFIESPRDARYHYAKRFGIEGSY
RLSEQSIATTSTQNPVVRLLYVVVSLLLQNVWRYLHWEYVRTPRRGGRRLWKWSFKEFIN
MIQRAAWTALATRRAVPANRPPDDRFTR
>ISHla8
MFTIPDPDEYLSASDVKDVAEEVITPLPLPGVEGSPLDPGDIWLVVILACTNQNSIWDTC
NDTEGTPCDDTVLRWLHTLNRQWLEVVANLLLARLAMTIFDPDRSRTVSIDFIDNPYHGE
HHAEKGELCSMAPKDGTTTCHRYCTAYVVSNGKPVTLAMTYVRSDEDEADAVERVLARVE
NYPFEIDLLLADSGFYNERVIRRARDIAPTVVHVPKKGERMKDKLETHKSYMTTYRMYKD
SERELRFPLAVAVSYQNGDRGKHGEVVRGYVACGVTDRSAKQVEHRYRKRSGIETTYRLL
RQARGITTTRDPVVRFAIMLVAALLENLWLVLRWAVVARPRRGGRDLPEEFTFKTFCDWI
RHELEEELRRRWKIKANGVGVPASQATAAG
>ISHwa12
MCDVNLPKLKRILTDPDEFISNSQLKSLSMELLELIPMEGIEGSGLDSDQIMEVVLRAAV
DQTSVNGVTTSTEDTPNRETVMDWLHTLEKETMLDAVNDILALVAMTVLDRDGSRTICID
FMNNPFHGCPDDEDEFRRMSARDGTTKCHRYCTAFVLAQGKPLTLAVDPVDGKDSKADAV
ERVLARVETYPFEIDQILMDRDAFCGELIGVLREAAPPVFPVRTGKETLEEKLTTGSSYM
TEEIICEGKEHEQTYPLAVNVTYQNGDRGKSGLKQTGYAAYGLEDRTPRQVAQVYNHRAQ
IEKSYETFRKARALTTTPSTTIRLFYVGVGFLLEQLWVVLQWAVLARPRRGGRALPTDFT
FNDAFLHGVEEVLDDELGWKDEHQTNDQGLPAGHEHGLG
>ISMba14
MPTKNDSMTLDTASLLAVSSELISKYNIITLPESANYKCQDTLNILLHAATFSTNSLESA
SNDLQRKNPDLRIPSADTIFNYINENKIEDILSSFRKMNLELFKMMKLENKIHDIAIDFH
DISYYGDKNTPGIRGIKLKNGSSWGKSFCTLDIIGTSHLTLDVIDINSLNKNYSLLIESL
FKRLQTIGVKTGTVYLDREFFNTDVIPKLDELKVNFVIAVKSTQVINRELKNHQKEYGNT
STIFEYQFQKGGPSFNVVAIYNDEKKKYLLFATNKKAESIEKFEKMIPEEYRKRWNIETG
YRVKNEFKIRSCTKSPVARLLFFIIQCIMYNVLNMLKSVLKITAYELKSLINEDINKVVR
YGLKSLNFIPVSVLLDCLRWVNEERNRVLRTRLTII
>ISMbu7
MLSRLELTPAHCIKTVLPPLLDNIPISINGSLTPKDLFTNILGMSTDKLSIHSIGKQYHN
TPCETSMRYHLHKIDFDQLIENNAKILLQSSHKTLDSNKKYDLAIDYTNDPYYGEVNYVN
ENYVIRGQAKKSTNSFYSYISLCIINKYTRFTISMLPVEKGKTKTDYLKYFIDVVDKINL
KINILCLDREFYSRDVFTFLQENDIPHITPVVRKGKRIKDILDGNNKRYEKYVMKNKKGD
VGLDIAIDVKYLKGKRGKNGCENLGFVVYGIDWEPGKISTIYRKRFTIESSYRMRNVVKP
KTSSRDPMLRYFYALISFMLKNAWVSIQRMHFMKVKRGPKTIEEDVFRFDLFVHFVEEWV
KKRLKVKLVVKCYR
>ISMma1
MKSFAMTPKNDSMSDVDTASLLALSSEFFSIVDIITLPDGANYSYQEFLNVLLHAATSST
DSLESASNDLKSKVPNTRIPSADTIFNYIKSNSIEYILSSFRKINNEIFRMMKLKNNVHD
IAIDFHDVEYYGCRDTLCVRGIKPKNGTSWGYSFCTLDVIGNSKLTLDVIDINGLSKDYS
ILMESLFERVEKMGVKVGTVYMDREFFNRKVISKMEKYKVDFVIAAKSNKRIKEMLERHR
KENRDTSTVFEYKFQGEEQTFNIVAVWDKEKEYSIFATNKKVSSIDTFVKQIPEEYRKRW
NIETGYRVKKDFKIRTCSKSPVARTLFFVVQCIMYNILNVLKSVLDITAYQMKSVINQDI
IKAVKEGVNSLSNITVRSFLECLTRYNKERRRALRARLRDL
>ISSto8
MKGNEDKGTKSYNRDFVRSALKLIYTFLTNILFPEELLKTLLKARGTYLSRLGNEGRRAL
KLLNNIDVDDVRKALREMGKKVLRETRNRRVAIDLHSQPQYHKDKSLLSRIKPNKGTSWG
LAQIAIFLLNRKSIFLDVLPITVKNIAEDFKMVMQVVLEELDKFDLRLVRVYADREFAVN
EVIKFLLGLGVDFVITARYQMYKKYEDKLRDVDITYCGVRYTGFLCVRHVSGAYLVILRK
GDGIIAFLVSGEVDVRTAVVLAEDYRERWGVENAFRSLEEFRVRTRTCDVRKELVLILLC
YFLLNVWFLVRSWRRVRLWEFCQSLVDFLVLKEMREVITQGLPQVGELFFVNFS
>1029822.3:AFMN01000001_505633_503909__1637_603
MPTIKDALDIIGKLTVAEQESLKTMLLSPAFVKSLNIEDFVAKERFANGRVCPLCGCIHV
VRNGHRKDGTQRYVCKDCGKSFVIATNSIVSGTRKDLSVWEQYIDCMMNGLSIRKTAVAC
GIHRNTAFLWRHKILDALQNMADDVTLDGIIEADETFFAISYKGNHSKSKTFAMPRKAHK
RGHSTHIRGLSQEKVCVPCAVNRNGLSISKITNTGRVSTRDLHHIYDGRIKTNSTLVTDK
MNSYVRFTNANGIDLVQLKTGKAKKGIYNIQHINSYHSQLKRFMRGFNGVSTKYLNNYLV
WNNLVNYAKESDMEKRNIFLTFVLATLKTAKCRDLSNRPAVPLVA
>1046724.3:ARCR01000032_4040_3015__956_6
MKTIQFSQWIAQLSILNPEQRDQLRSRLSGAGDLPLDVIKAPSRCPHCQSRERRSWGSSG
DLPRYRCKACAKTSNALTSTPMARLRKRHRWQDYAEALTQSLSVRKAATHCGVSKNTAFL
WRHRFLSRIADHQAQHASGIVEADETFFLESFKGQRDLPRPPRKRGGSAKRRGLSAEQIP
VLVVRDRSGQQADFKLEKLDARHVGERLRPLVDADAILCTDSAGVYAHFAKAEGITHRPV
NPSQKRRVDGAFHIQNVNAYDSRLKNWMMPFHGVATKYLTHYLGWRRLLERYKARLNPLI
CLGESLGYTNVQQLTET
>1053189.3:AHDJ01000061_2328_3863__1447_422
LSKAFSNLLKHIDNLSHTEKEQVFQWVKRYVESSSSVGGRLINEMRETRFKEGFECPHCA
SEHVVRFGKHNNRQRYRCKCCSKTFTDTTNTVLYRTRKGNEWITFVDCMFKGYSLRKSAE
IVGVTWVTLFYWRHKLLSALKQLDFEKFEGIVEVDETYFLYSQKGQRGISERKPRRRGGK
SKHRGISHEQVCVLVARDRTKATVSKIACMGRVVKTKVDSMIGSK*TSDNVLVTDAWRAY
KTYAKEKGIEHYRIKSNDGKHVIKGLYHIQNVNGLHSRMKQWIDRFKGVATKYLDNYLAW
FLFINSKSNESTKHNIKEFLLTSFVFEMTDTYDSLRLSKFSV
>1073382.3:AGWT01000005_129318_130349__965_6
MDTPAFQHLLSLFPQLTLRQRRVAQQELTAPHTITSLNNQLPACSGCPHCQADVTQLAPW
GWSRGLRRYRCKLCLRTSTVLTKTPLARLRKAQCWEDYAQALIEGLTVRQAARRCGVSKN
TAFLWRHRFLRAMATHQATREEGIVEVDETFFLESFKGQRGLPRPPRHRGGKGRTRGTGP
DYIPVMVVQDRAGHHADFQLEKIDAETVIAVLKPLVSPDAVLCSDGAGVYACFSKEQGIT
HQVVRNRQGERVVGAYHIQHVNGYHHRLKEWMERFHGVATHYLKNYLGWRRMLERYGKGV
NIKACLHEALGRPMQHVIGT
>1232673.3:AMQA01000013_94979_93947__845_6
CPHANAALTARPRPHNWLPGAGLEGCAVIAASSVCAPVPFSPTRLSPDFASHNAGKTMHM
PSSTV*PSGKRRCAAGFVKTPPFLWRHRFLKAMASHQAVREEGIVEVDETFFLASFKGQR
GLPRPARHRGGKGRTRGTGLDYIPVMVVQDRAGHLADFQLERLNARAVKAVLEPLIAPDA
VLCSDGAGVYASFSKGQGITHQVVRNRAGERVVGAYHIQHVNGYHRRLKEWMERFHGVAT
HYLRNYLGWRRMLERYGREVNISRCLHEALGRPMQHVIGT
>272562.1:NC_003030_1640824_1638987__1324_728
LGKGYVDGVIEADEVFFTESFKGTKPSNMPRRSRKIGKQVKKSGISKEQVCITTAIDRQG
NLIMELACKGRITSKELEKLYDGHISNESILCTDSRKSYIQFANDLSLEHKRIKRGKHKE
GLYHIQHINVLHSNLRKWMNRFNGAATKYISNYIKWFKWLQIFDTHKEIIKAKNFIVQSN
VAHAYIKVKDLKYREPICV
>357809.4:CP000885_1872814_1874420__1507_464
MPDIKDVFTLYTQLSPQEQKKLYSMISYQLPIDNDFEQFVKDERFTSGFVCPHCGCIGHI
SRNGHIYKTDKDGNKTIDKQRYVCKDCGKSFTVLSNSVASGTRKNLSIWESFTKCMLNGF
SVRKSANICGIHRNTAFAWRHKLLDALQQPAEKTRLDGIIEADETFFRVSYKGNHKRSSF
KIPREARKRGGLAHKRGLSKEQVCVPCAIDRKGHSYGKIASLGRIATKNLHAVYDGKICS
ESTLCTDKMNAYVRFAKSKNIQLIQLKSGKEKKGIYNIQRINNYHTKLKKFMDKFNGVAT
KYLNNYLVWHTWFDLKGHTQLEKADLLLAKAMTSILSFHFRQLSMRPS
>439292.4:NZ_ABHZ01000008_31751_33385__1549_509
VRTTDILKTIQKLNPAEKHRLREYLIDALTASSSTGTVLEEISERKHKDGYRCPDCESEH
IVRFGNYPIIADGEEVKKQRYRCKACRRTFTDLTNTALYRTRHLNRWMKFIECMIEGYSL
RKSAELIGGVTHVTLFYWRHKLLSALKQTEISNFQGIVEMDETYFLYSEKGQKKIEDRKP
RKRGGSAKKRGISNEQVCVLVARDREKVTFSQALGMGRLTKEQLDKSIGHKLSKENVLCT
DGWRAFKVYAFEKEMDIYQFKSDGNIRTKGLYHIQNVNNYHRRLKGWIQRFNGVATKYLN
NYLAWFQVLESIHHQRNEVTMKDMIIKGNLIPNKETYDTLRLSKFTV
>445973.7:NZ_DS499569_122237_119615__2523_1480
MSKIDIKAMIKDLKKNELTELISVAQEVLSTLFNSSEIRDNVKESRFSKGYECPKCQCKD
VNKNGKSNGRQRYICKRCRTSFDEFTMSPFSNTKLGLDKWLKYCELMILGLSIRKCAEEV
GVGVKTSFYMRHRILDVINLSLKNDKVEGIVEVDECFIKESFKGNHSKSTTFVMPRNPRK
RGKGKNDKKKRGISKEQICIETAIDRKGNILMGAVCNGRITTNQIVNFFDNKICEDATFC
VDSHKSYMGIKDKLNIELKQVPRGKSMIDSVYHLQHINALHSSFKRWLMTFNGVSTKYIN
NYLAWFKFLQLSKKNKKNDRIKDMLVNVATKDTYVTRATIRNRFIELT
>1005705.3:NZ_AFNN01000005_10214_11624__1290_37
MRPIKNTTELIGIKDQNIKISLIFETDTHIEIQAKLDSPAPLCPHCHGKIIKYDFQKTSK
IPLLEQAGTPTLLRLKKRRFQCKSCKRVTVAETSIVEKNCQISNLVRQKVAQLLTDKVSL
TDIARRLRVSTSTVYRKLDQFTFKEHYDKLPAVMSWDEFGFKKGELAFVAQNYETNQLIT
ILDNRRQTTIRNYFLKYPLKARQKVQFITMDMSGAYIPLARRLFPNAKIVLDCFHIIQHL
GRAFLKTRIAIMSQFDKKSLPYRSLKNHWRLFQKDSRKLSLNSFYSKTFRQTLSPHEIIE
KTLDFSE*LTDYYTLYQLLLFHFQEKRVDEFFELIEENRSKVNHYFQTVFRTFLRHKQYI
KKALETDYSNAKLEATNKLIKDVKRLGFGFRNFINFRKHVFITLNIHKKRTYPVLSRC
>1008452.3:AFQT01000036_1836_424__967_38
KIAQKLIEKTSMTDIAHQLSISTSTVIRKLNDFHFKHDFSRLPEIMSWDEYAFTKGKMSF
IAQDFDNLNIITVLEGRTQAVIRDHFLKYDRAVRCRVKIITMDMFSPYYDLAKQLFPCAK
IVLDRFHIIQHLSRAMSRVRVQIMNQFDRKSHEYKASKRYWKLIQQDSRKLSDKRFYRPT
FRMHLTNKEILDKLLSYSEDLKHHYNLYQLLLFHFQNKEPDKFFGLIEDNLKLVHPLFQT
VFKTFIKDKEKIVNALQLPYSNAKLEATNNLIKLIKRNAFGFRNFENFKKRIFIALNIKK
ERTKFVLSRA
>103690.10:NC_003272_3289446_3288031__1237_20
MKFPVEQILNLPDMKVLDFQELEGEEIIITIEKSVNYSTCPWCGQMTHSIHQNHWRIIHD
LPWNKKPVLLKINRRQFKCHKCKKVFSEQLDFVDKSKGYTKRLATDIVQQVLNSNIRSVA
QRNGLSDEEVESMLKKQVSHILNINLSQVKKLGIDEIALVKGKGNYLAILVDLDTHKPIE
IVQSRRIEDIREVLVSWGVEILNQIEEVSIDLWLPYKNLVEELMPNANITADRFHVMKQV
NDELDTMRKAENKAAISLDNKSEKERILEALNKSKYAIIKNEDSLNEKQREKLKSVQEVS
PNLAKMHSLKEQFRDIFETTKSWGDSIIKLLDWMYDALSYFPKSIGTIVRWFGEIVGYFD
GRTTSGAVEGINNKLKLIKRLGYGFRNFTNFRLRSLLNWHFTINSP
>1037908.3:AFQL01000073_39031_35660__1348_62
MTELPDNILHLPQYQVLGCKSTDDEMHFQVDVPDPIACEECGVQGEFVRFGKRDVPYRDL
PIHGKRVTLWVVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHEYVEKESFNHPYTFVAA
QTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRYRCILTNIEERTLLDLLA
TRRQDVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQARIVVDKFHVVRMANDALE
RVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIMETWTGAFPQLLAAYEHKERF
YGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGNWREETMTYFETDMPVTNAYT
ESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTAKVSPFYKKTIGYGLPDFAEEL
NYGVDLSTI
>1042404.3:AGFN01000258_2501_3923__1346_375
MTYNEKCSNYHFRKTHMEQLNLITNFLRIEDKNITITDEYDMGTHLELHGHLDDTAPKCP
K*KGQMAKYDYQKTSKIPYLETAGYPLLIRLRKRRFKCKDCGKMAVAETPLVKKNHQISV
AVNQKIAQLLIENQAMKHIAHRLSISTSSVMRKLNEFKFETDWNTLPEVMSWDEYAFKKG
KMSFIAQDFDSLNVIAILDGRTQATIRNHFLRYPRKVRNRVKVITMAWICLVPIINLLNS
FFRMQKLYSTAFISCNTLVVL*TVSVFKL*INSTEHRRNTEP*NVTGN*YNKIVVNSAIN
DFIDLCFECI*LTREILEKLLSFS
>1043205.3:AFYF01000051_35675_34278__698_30
RFFDKLGPDRCTQLTHISADGAEWVSTVVADRCPQAVRCADPFHVVAWATDALDEVRRDA
WNSARGAVTQRRAARASGHAKTLKGARYALWKNPENLTEGQQAKLAWVAKADPRLYRAYL
LKEGLRTVFRLDLKDAEEALDRWVSWARRCRIPAFVKLQRKILRHRRSILASIEHGLSNG
RIESVNTKVRLITRIAFGFRSPQALIALAMLSLGGHKPALPGR
>1072576.3:AFWZ01000054_3681_5194__1378_86
MNDSIKKMLRLIDKDLMITKVSYEIFHKEKTLVINAILSPAPRACRSCGSTVVDGNGKAT
VVKNGKKEIIVRFEQYNHMPMIMRLKKQRYTCKNCRTHWTAQSYFVRPRHSIADHVRYKI
ASLLTEKVSLSFIAKSCQVSLTTVIRTLKEFKSYLPKPTKRILPKVLMVDEFRSHTSIED
KMSFICADGETGNLIDILPTRKLPRLTNYFLGCINPEEVKFLVTDMNAAYFQLTKRVLPN
AKVVIDRFHIVKHMNQAFNELRIREMNELRKAGQKSHAEKLKKNWRFLLKNRANINHYEY
KTWKSFRAPKYPFLTEAMMIDRLLSFSTPLKVAYPFFHELVEAFRDKDPDLFFSLLAELP
ETLDDGFREKLQNLLTYKEGIANAMIYPYSNGKIEAKNTHIKTMKRVSYGFRSFENMKIR
IFLTNQLIKVR
>1105117.3:ALCO01000003_13812_15231__725_63
RNHFLRYDRAVSLSSRKSLRWICLVLTMTWLNSFFRVLKSF*IVSILSNISAVP*VVFVF
KL*ISLNENLMNTRLSSVTGNSSNRIVVNSAINVFIALLFAYT*QIKKFLTRF*AIQKT*
NTTIRSINSYFFTFRTKTLRNFSDSLRTI*SRFILFFRLSLKPF*RTKKKLVNALQLPYS
NAKLEATNNLIKLIKRNAFGFRNFENFKKTDFYRSEHQKRK
>1116215.3:AHBL01000065_9630_8132__1373_87
MSYTHLIKETLDILDLSVTFNENCLTKEKYKGQICHIYRGNLIYTAQECIHCKHQIASDI
VRWGTTTVRLLMNDVSEYRTYLELKKQRFKCKACQRTFVADTSVAKKHCFISEKVRWSVV
TRLKKNTSMTEIAAQKNLSVSSVYRIMKRFYRPLNPFRTPLPKVLCFDEFKSVRGVSGAM
SFIMMDGQTQRLLDIVENRQLPFLKRYFSHFSREIREAVEWIVIDMYAPYVSLVKKLFPK
AQLIIDRFHIVQHIGRTFRNHRIKETNQLLKSKEQKHYQLGKQLKRYWKLLQKDERKLDY
TRRLWRPGFKAHLTETDIVDRLLKGSPALRVGYQLYQDFLYAVKERDYVSFEELLTNNIM
LPEGYQTTLRTFQKFLPQIKNALQQSYSNGPLECLNNHIKVLKRNAYGFRSFYNFKLRIM
IRHGNALIF
>1138877.3:HE663067_1472739_1474247__1363_32
VRNVRLFRALLGVDKRTVIEDIEFEEDDAGDGARVIARVRPRSAVLRRCGRCGRKASWYD
RGAGLRQWRSLDWGTVEVFLEAEAPRVNCPTHGPTVVAVPWARHHAGHTYAFDDTVAWLA
VACSKTAVCELMRIAWRTVGAIVARVWADTEKRIDRFANLRRIGIDEISYKRHHRYLTVV
VDHDSGRLVWAAPGHDKATLGLFFDALGAERAAQITHVSADAADWIADVVTERCPDAIQC
ADPFHVVAWATEALDVERRRAWNDARAIARTEPKWGRGRPGKNAAPRPGRERARRLKGAR
YALWKNPEDLTERQSAKLAWIAKTDPRLYRAYLLKESLRHVFSVKGEEGKQALDRWISWA
QRCRIPVFVELAARIKRHRVAIDAALDHGLSQGLIESTNTKIRLLTRIAFGFRSPQALIA
LAMLTLAGHRPTRPGRHNHPQISQ
>1154833.3:ALRK01000022_577_1959__1253_153
MELLKNTTELLGLKDTNIKILFVLKHQTHIEMRAKLDYKPPLCPHCHGNMIKYDFQKPSK
IPILDCQGFPCVLHLKKRRFQCKSCSRVTVSETPLVLKNHQISQPVLFKITHLLTNTMTN
SDIARTLHVSVSVVQRKLAQFTFKENFSSLPEILSWDEFSRNKGKLAFIAQDFESRNIIT
ILDNNRQTTIKNYFYKYTRKVREHVKVVTVDMSGSYIPIIKQLFPKAKIVLDRFHVIQHL
SRAMMTTRIAIMKSFDAKSQTYRLLKYHWRFFQKDSRKLSDKPFYCRTLAQTVTPREVIH
KALSHCEELRYYYDLYQLLLFHFQEKRIDAFFSLIEENLTVTNKTFKTVFKNFIKHKLCP
RNY**TH
>1158602.3:AJAL01000017_67430_63094__3781_2969
KKFSQPMIPFKTKLPKILLFDEFQSV*NTSGAMSFIMMDGETNQLFDILENRQLSYLKKY
FYRFSTSQRGHVTHIVMDMYSPYMSLVHKLFPKAKLLIDCFHIVQHIGRTFRNHRISWTN
LFLKDPQDRSKGKQLKRYWKLLQKNQDKLNYQKPIWRPSFKKHLTETEIVDRLLSYSDEL
KIGCDIYQGFLYRVKKWDVLGFSELLALDDTALPNQCQTTLNTFKKYHKQIKNARRYPYS
NGPLECLNNHIKVLKRNAYGFRDFYHFKLRI
>1170318.3:CP005287_49443_50946__1071_13
GGEETQLAPPRKHFTTRAITWAVNQLLTRDVVISALARDLRVGWRTL*KAIEGPLQERLK
EISDQASVEAPGLDEHVWRHSGPHKNRMITGVVDHTRPKRGKDGKTKPFARLLDVQVGRS
GAVAEDWLASQGKEFASKIRIAAIDPYRGYANAISATLKEADMVVDIFHVTKLASQALDE
VRRRAQQDTLGRRGHAKDPLYRARRLLLTGANHLTEKMATKLDALLQEGDPNWEVTITWT
VYQKLIDAYQQSDSHDMVTLIDALKDCPIPEVARLGRTLKAWKREILAYWHTDRSNAGPT
EAINNVIETTRRIARGFRNFDNYRLRILASASGQRPYRQPPKLVKQGQPNHAE
>1234381.3:AMXD01000001_24656_27420__1356_37
MSSPIEALFTTALGLQPPWYVAKVDLDTAKRRIDFEVEHAGKRVPCPACGAAHQPVHDRV
RRSWRHLDFFQFEAWLHADIPRVQCSGCGKTTQLPVPWAREGSGFTLLFEALGLSLCSEL
PVRQAAAQMRVAPKRLWGRIRHYVHGARARDDMSGVRYVGIDETSVKRGHAYITVVHDLE
AKRLLFATPGRDHATLQAFAQDLRAHGGEPERIEHACIDMSAAYAKGIAQALPTAQVSYD
RFHVVALANTAMDEVRREEMRSAAAAVRAAAGTGNKKTLRQLLWAMRKNPPQWTPAQCDA
MNWLQRSGLKSARAWRMKQGLRLVYREAAASNCEEVARGALMKWISWARRSRLEPFKRLG
ATVKAHLGGVLRGMLDGRSNAYVEAMNGQLQQTKTAARGFRNLDNFIAVAYLRMSKLEHL
PKNPMVPAIPREYGRYRHVC
>1266716.3:APVE01000019_12003_11042__833_42
WTSVTSTRLEDYMGVEAIGVDGTSRRGHNYITVVADLVEHDVINVTPGKDPATVERFSRD
FMDHNGVPEYVRLVACDMSLGFRKGIREHLPHARRIVDKFHVARHADEAVDKAGKTEGRS
NPLLKRTKYLWLRNEESLTELQVETKRNLTRQRLKTGRACRMREVPQDIYTDSRTPSGAW
VRLHRLCSWMTHSGLEPMKDFARMIRRHFAEIVAYFGHPYTNAVLEGADSVIRNVKRRAR
GFRDMDHSATMIYLTCGRLDLKAV
>137722.3:NC_013854_1161883_1163255__1340_78
MGMPISRTTLLHRVRAGGTKPIPPVTVLGVDDWAWRKGHRYGTILCDLERRRVIDLLPDR
SADTLAAWLMMHPGISVVARDRAGAYAEGAARGAPEAIQVADRWHLLRNASDALRGVLEH
HHRDLREAAQTAALKPEPLTLEENNSGPATASETERPLRAAERRSRAAQERRDARFAEVA
RLREQGMALKAIARTTGIERKTVRRWLRAGHAPTWRHAARATSILDPYRAHLEERWQAGC
HNGAALWRDLKGQGFAGQYSVVRNWAMQRRREDPSLRKSTGPRRHSAATRVTEPPTPRRA
VRLLTVDLDVLSEEDRQFVVSLRDRSPAIATAADLISRFTTMVKDKTPTMFDGWLREAEA
SALGPFAAGIRRDEDAVRAALTEPWSSGQVEGHVNRLKVIKRDMYGRAGFDLLRSRVLAH
A
>298653.4:CP000820_8196226_8194495__1504_47
VHGRYRRRLVDAAIGGTHVEIDLLVRRFRCLDSGCSRVTFAEQVVGLTSPHARFTPLATG
MIEAIGLALAGRAGSRLAGRVGLCAGRNTVLRRVRALPDPQVGVVATLGVDDFAVRRGRV
YGTVLVDLDRHRPVDLLADREAATFAGWLAEHPGAQVICRDRAGAYADGARTGAPDAVEV
ADRWHLWHNLAGHVEATVARHRSCLKEPSLPAVEAVASQPSDVDEAVTEARDEHFESRAF
VRNARERYAAVQDLKAQGLGIKPIMRELGLAKETVRKYYRAATIEDVLAKTRDGRGSVLR
RWEPYLNERVNAGITNGSQLFREIREQGYPGSQATVLAYLRLLRTAGSTAPAASPAPKVR
TVTRWVLTDPEHLDEEETLALKKVLTRCQHLQTLAGHVTAFAQMLTGRHGDRLNTWIAAV
DADDLPELHRFTRGLLRDHDAVLNGLTLPHSSGQVEGTVNRIKMIKRQMYGRANFDLLRK
RVLLAT
>298701.3:AGFG01000071_2_1358__1266_28
VEANDLLTLGLGLTAPWRVVDQSLDLSKQPSELRLEVEAARGERYPCPACGALCKAHDFA
EFSWRHLNFFQHHCLIKARVPRVRCPEHGLKRVNVPWARPGSGFTLLFEQAVMLLAREMP
VNAVARYVGVTDKRIWRVVTHYVLKGMGKLDLSRLCGIGLDETGTKRGHHYVTIFVDMDR
ESRPVVFATPGKGKECLKTFAAYLKGRQGNPENVVEVVCDMSPAFLSAVEATFRNAAVTV
DWFHVVQIFTKALDEVRRLEAREVILPKAARWAVLKGLETWRSEEQVAALKELEERGLAT
ATAFRVKELLRWVRKADTRQGARWRATRFFEFARELAGDSVLLAPVRKALNTFEDHLPRI
LRRWDSLLSNARLEGLNGLFQAARSRARGYRNVTTFITMIYLIGAPITQLLEA
>329726.14:NC_009926_320176_318792__1286_60
MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGREITDLHCHDQPFRIR
HLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTKAYERWLLRILINSTVS
DVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISLKRGHRDFVVLITIPTTD
GVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGFVSAVREQLPQAKIVIDRF
HVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFRKRPENLKESEQQLLERLFA
YSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVLKSDIKEFDCFLTTINNWMDE
MTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQRISLDLNGYQ
>331869.3:NZ_ABHC01000018_63557_68939__1250_27
MQNQLFEVALGIAEPWYVNGVDFDAAEKTLTIGVDFVAGTRFPAAGVAGVHPVHDTQIKR
LRHLNFFQHECFLEVRTPRVKLPDGRVVQVEPEWFGKLAGFTLLFEALVLAMARQMTFAA
VAKLVGLSWHRVHAICSRYVDLALAEADLSTVTAVAIDETSCRRGHNYLTIAADMDERKV
VFVTEGKDAKTITHFAEYLAEHKAMPEQVRSVSIDMSPAFIKGVARQLPNARITFDKFHV
VAHASAAVDQTRRIEQRTDPSLKGLRWKLLKDRDRLTDEGRADLDALIAQVATKRTPRAW
LYRENLRDILERKQINVVSAMLKQWCTNVLRSKVEPMKDVARMIRRHFDGIVAWTQTRQT
NGFIEALNGLFQAAKRKARGYTRFATMRTVLFLIAGKLDFTRINPQAA
>351627.4:CP000679_2887671_2885820__1730_18
MEKYEIIDDTIYIYVKSKNSQATCPYCNQSSNKIHSYYSRSFQDLPIQDKKVVIVLKNRK
LFCKNPECRKKTFAERFQFISDNAKRTKRLEDEILNISMNISSVAASKILRRNIANKLKS
TICEMIKKAVLIDRDTVKRICIDDFALKRREKYATVMIDIESGKVIDILNSRDYDDVKQW
LEEYPNIEVVCRDGSVAYSKAIKDSHCEAIQISDRFHLLKNLTDYCREYIKGEIKNKIKI
EMPMVREAETKYSTETKKYHYKTKWELILAVKEMISDGCTINEVCRVLGLGNKTVIKYSK
INESDKEKYDREPIGKSKQEDICKRKEELIEQAKLLRRKGYSITGISRELGLDRKTVKKY
LESDGRFNHASKGRKFKSKLDNYKECILELFSKGYSGARIFEEIKQMGYDGSYSLVRNFI
ANINKERIFLEDRNEAIKTVERKSLISLLYRGIEEQKAITAEELEKVMEIYPQLKVVYRL
VKQFKEILLNKEVFKVEQWLKESEELDIPELNSFVSGVKRDYEAVRNCIMYEYSNGLAEG
VINKIKIIKRIMYGRCSFEMLRSKVLLFNFN
>460265.11:NC_011887_71768_70041__1661_27
MILSSSLPGCTIERVFRHTDHLVVIAHGRRCHGRCPTCGTPSSAVHSRYDRRPADLPSMG
QPVTLRLRIRRFYCHHPACRRRTFAEPLPRLIPPRARRTRRLAQAQTRIGLAVGGEAGAR
LTGHLGMQTSPDTILRLVHRLPLPRANAPRAVGIDDWAIRKGRSYGTLLVDLERRCPIDL
LPDRSGATVAAWLRRHPSIQIVARDRSTEYARAATAGAPAALQVADRWHLLLNLRQVLER
WLGRVHGRLRQLPPLASGDGRQPGERPRAYRRSAAEIAVSLDSRARRLAAYEDVRRRHLA
GETLLAIGRATGLARATVRKYAQAESFPERAIRRPNPSRLDPYLAHLEQRMAEGCENAMA
LWREIRRQGFAGTHRQVHRFVAERRTARKWLSQPASTSTEAIRPSPIASPKQLAWILVQP
LATLQPRAAADLARIRQDPEAARIADLARRFTMLVRACGLGGDRPADPASELDRWLLETR
NCGVAALETFAAGLAQDGAAVRAALTTSWSNAQAEGQISRLKMLKRTMYGRASFALLRSR
ILIAA
>585524.3:NZ_ADNY01000042_39325_40794__1321_50
MSSLNDYIKFVLDIEDNNIIFKDYFYKIPEAGSKYKVYEAELIQPACPFCGSVDIIHNGH
LKTNIRYITANASTPVVIRLFKQRVKCRDCSKRSMAQSSLVNKYCSISNTSKLKILSALT
EDRSMTSIAREHNTSVNTVQRVLASCSHRFIDGYDYLPEHLAFDEFKGVDRKLHFICLNG
ETHEVIQILRNRFKKNLLKYFGRFTLKARANVKTVTMDLNFYYQDIVRACFPNAQIIIDR
FHMVQMLTRSLNSLRVATMKKFDKGTREYSLLKSPWKLYLKKFDDLEKIHPRYNWHYKDS
LTQEQIVMEGIGCNDVLDNSYNLLQDFFTALDKHDTKSMKEIIYSKERVGALMHKTLLTF
RHNLKAVLNGASLSYSNGCLEGFNRKIKQIERTAYGYSNFINLLTRIRLEENKIKEKGSS
NLLI
>870187.4:AJUL01000001_28813_19301__8284_8961
MNSDTLFGMALGLTSPWQVDSIDFSGTEGRQELHIRISFARGSRFADQSGEPCPVHDTVE
RRWQHLNFFEHTCYLHCRVPRIRTGSGQVETVAVPWARPGSGFTLLFEALAMALIEREMP
VNRVAELMRVNPQRIWTVFNHWVCEGRQQDDPSGITRLGVDETSTRKGHNYITVGVDLDA
RRVAHATEGKGKETLSQIQKHLASHEVKPSQITDVSIDLSPAFIAG
>990288.8:NC_015854_20339_21640__1229_18
MVPEELFSLALGLVPPWLVDHVTFTVEEKRLDLHINFPKGSRFACSVCGEECPVHDTRDH
TWRHMDFFQHEAYLHARVPRVKCQEHGVHQISVPWAREGSRFTLLFEALIMTLVREMPVL
TAARMVGETDKLLWRVIDHYVPEARAAVDMANVHAVGVDETSSRHGHDYITLFVDLNARR
LLFATPGKDAKTFEKFSADLQAHGGSAEAITDVSMDLSPAFQKGAAEHLPNAEITFDRFH
LMKLVNEAVDDVRKGEVLTQPNLKKTRWLWLKNDCNLKMKQKEKLQELLKDQNLKTAQAY
QFRLTFQDIFTIKNRHQGATLLKAWLENARTSDLPPIVRVAYTIMNHWDGVLRWFESQIT
NGILEGFNSLIQSAKAKARGYRTHKNFINMAYLILGKLDLRLPT
>1004153.3:AFET01000005_56007_60956__3039_37
MPVDFLTTEQTESYGRFTGEPDELQLARYFHLDEADKEFIGKSRGDHNRLGIALQIGCVR
FLGTFLTDMNHIPSGVRHFTARQLGIRDITVLAEYGQRENTRREHAALIRQHYQYREFAW
PWTFRLTRLLYTRSWISNERPGLLFDLATGWLMQHRIILPGATTLTRLISEVREKATLRL
WNKLALIPSAEQRSQLEMLLGPTDCSRLSLLESLKKGPVTISGPAFNEAIERWKTLNDFG
LHAENLSTLPAVRLKNLARYAGMTSVFNIARMSPQKRMAVLVAFVLAWETLALDDALDVL
DAMLAVIIRDARKIGQKKRLRSLKDLDKSALALASACSYLLKEETPDESIRAEVFSYIPR
QKLAEIITLVREIARPSDDNFHEEMVEQYGRVRRFLPHLLNTVKFSSAPAGVTTLNACDY
LSREFSSRRQFFDDAPTEIISRSWKRLVINKEKHITRRGYTLCFLSKLQDSLRRRDVYVT
GSNRWGDPRARLLQGADWQANRIKVYRSLGHPTDPQEAIKSLGHQLDSRYRQVAARLCEN
EAVELDVSGPKPRLTISPLASLDEPDSLKRLSKMISDLLPPVDLTELLLEINAHTGFADE
FFHASEASARVDDLPVSISAVLMAEACNIGLEPLIRSNVPALTRHRLNWTKANYLRAETI
TSANARLVDFQATLPLAQIWGGGEVASADGMRFVTPVRTINAGPNRKYFGNNRGITWYNF
VSDQYSGFHGIVIPGTLRDSIFVLEGLLEQETGLNPTEIMTDTAGASELVFGLFWLLGYQ
FSPRLADAGASVFWRMDHDADYGVLNDIARGQSDPRKIVLQWDEMIRTAGSLKLGKVQVS
VLVRSLLKSERPSGLTQAIIEVGRINKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARA
ICHGQKGEIRKRYTDGQEDQLGTLGLVTNAVVLWNTIYMQAALDHLRAQGETLNDEDIAR
LSPLCHGHINMLGHYSFTLAELVTKGHLRPLKEASEAENVA
>1005515.3:AKLT01000045_33239_36653__2904_37
INKHRRPANRLGFAVLLCYLRGPGFVPDKNNIPHCGVVSRIASRLKLQPDLWHEYAAREQ
TRWEHLAELYRYLKLSPFSRTLQKDCIRHLHSYAMRTDKGFTLAEEMLSWLHNNNVIFPS
VDVIERTLAEAVTLADRSVFTAITAQLGKQHRSALDSLLISEGKQPSRLTWLLQPPGKIN
GKNVLQHIDRLNSITALELPDGIELCVHQNKLLKLAREGRKMSSRDLAKFTNIRRYATLV
CVIQEARATLTDEVIELHERIMDGLFSQAKRKQAERLQLTGKLIQSKLKQYVTVGQALLH
ARKSGEDPWAAIEDVIPWQEFVNSLEETQFLSRKDNFNPLHLITEKYSTLRKYAPRMLSA
LHFVATPAAQPLSDALDTIREIYRKQLRNVPPTAPTAFIPESWRKLVLTPSGINRKYYEF
CVLNELKGALRSGDIWVKGSRRYRNFDDYLIPVTEFEKSRQNDQLQLAVQTDCHAYLQAR
MTLLASRL*EVNAMALAGELPDVDISDKGVKITPLENGVPSGVSAFASLVYNMLPHPKIT
EILEEVDSWTGFTRHFTHLKNNNIRPKDGRLLLTTILADGINLGLTKMAKSCPGVTKSSL
EGIQAWYIRDDTYSAALAELVNAQGKRPLAAFWGDGTTSSSDGQNFRVGSHGRYAGQVNL
KYGQEPGVQIYTHISDQYSPFYTKVISRVRDSTHVLDGLLYHESDLEITEHYTDTAGFTE
HVFALMHLLGFAFTPRIRDLHDKRLFIQGKAERYPGLQSVISTTSLNIKDIETYWDEVLR
LAASIKQGAVTASLMMKKLASYPKQNGLAKALREIGRIERTLFMLDWFRDPGLRRRVQAG
LNKGEARNALARAVFMHRLGEIRDRGLENQSYRASGLTLLTAAIALWNTVYIERAIESLK
RKKLLINDQLLSHLSPLGWEHINLNGDYVWRNNLKLGTGKYRPLRSVDIESYKKQS
>1005519.3:AKLX01000476_13561_27875__3000_37
MPRRSILSAAERESLLALPDSKDDLIRHYTFNDTDLSIIRQRRGPANRLGFAVQLCYLRF
PGVILGVDELPFPPLLKLVADQLKVGVESWNEYGQREQTRREHLSELQTVFGFRPFTMSH
YRQAVQMLTELAMQTDKGIVLASALIGHLRRQSVILPALNAVERASAEAITRANRRIYDA
LAEPLADAHRRRLDDLLKRRDNGKTTWLAWLRQSPAKPNSRHMLEHIERLKAWQALDLPT
GIERLVHQNRLLKIAREGGQMTPADLAKFEPQRRYATLVALATEGMATVTDEIIDLHDRI
LGKLFNAAKNKHQQQFQASGKAINAKVRLYGRIGQALIDAKQSGRDAFAAIEAVMSWDSF
AESVTEAQKLAQPDDFDFLHRIGESYATLRRYAPEFLAVLKLRAAPAAKNVLDAIEVLRG
MNTDNARKLPADAPTGFIKPRWQKLVMTDAGIDRRYYELCALSELKNSLRSGDIWVQGSR
QFKDFEDYLVPPEKFTSLKQSSELPLAVATDCEQYLHERLTLLEAQLATVNRMAAANDLP
DAIITESGLKITPLDAAVPDTAQALIDQTAMVLPHVKITELLLEVDEWTGFTRHFTHLKS
GDLAKDKNLLLTTILADAINLGLTKMAESCPGTTYAKLAWLQAWHTRDETYSTALAELVN
AQFRHPFAGHWGDGTTSSSDGQNFRTASKAKSTGHINPKYGSSPGRTFYTHISDQYAPFH
TKVVNVGLRDSTYVLDGLLYHESDLRIEEHYTDTAGFTDHVFALMHLLGFRFAPRIRDLG
DTKLYIPKGDAAYDALKPMIGGTLNIKHVRAHWDEILRLATSIKQGTVTASLMLRKLGSY
PRQNGLAVALRELGRIERTLFILDWLQSVELRRRVHAGLNKGEARNALARAVFFNRLGEI
RDRSFEQQRYRASGLNLVTAAIVLWNTVYLERAAHALRGNGHAVDDSLLQYLSPLGWEHI
NLTGDYLWRSSAKIGAGKFRPLRPLQPA
>1007104.3:AFGG01000019_34578_44000__5484_2548
MARRDLLTGDERRALFGVPLDHASLAKHYTVADEDRPLIEAKRGDANRLGFALHLALLRH
PGFGIRHDDVVPDFLIRHLAAQLDIAPTAFEGYAHRAQTRLEHAWEAMERLRLRAFEAAD
VPGALGAATRAAEATERGKPIAAAVLGHLRAARIVLPAPARIERIGVAGRAMARRLAADT
LVDALAPEQVTGLDALLIVDQDRSTTPLAWLRDTSDSPTARNLAGILARLAHVRRLGLDP
GMAGRIHEHRFEQLVREGHVAPAFLLSDYSLRRRRATLAAAVIDLEARLADAAIEMFGKQ
TGLLFARARAAQKRGIEATTRDVNRLMRLLGATVGALRVAREDGLDVWAALDDGVGWTRL
LDAESEATAIADLTRDEPLIRAAGRYMTMRRYAPAFFDAFRFKAAGSRDGVLGAIKVVRA
LNATGRRDVPADAPMPFSRKWKAAITEGGVIDRRRYETATVATVRERLQSGDLWVEGTRE
HLRFDSYMLPPGKAAEIALTLPFDTDVGRYLEGRARLLDWRLRRFAGSLKRGTLDGVELR
GGNLRVSPLAAVTPAAADRLDAAVDRLMPRVRITELLAEVEARTGFLCAFPELRSGRAHS
NPQAVLAAILADATNLGIERMANASQGVTYAQLAWTHGWYVSEENYAAGLRHLVDAQAAL
PLTRVWGDGTASSSDGQFFRSGRRGAAGSTNARYDREPGQKIYAHVADTYAPYHVRLISA
TAAEAPYVLDGLVAHGCGIEPATHYADTGGASDHVFALAHLLGFRFVPRLRDLADRRLGL
FPGTARPEALAKLIGRPFNIAAIRESWDEIVRLAASVKAGVVLPSVMLKKLAAYRRQNRL
DFALQELGRIERTLFTLDWLESRALRQQCQAGLNKGEARHTLAQAVFVHKQGRLRDPQFE
NQALKASGLTLVTAAIVYWNTLYMGRAVEHLRASGEPAPDELLAHVAPLGWRHISLTGDY
LWQNAAAELDQDGYRALNI
>1007104.3:AFGG01000019_34578_44000__7330_9381
MAVCVIEWATATADAVIETHDRIVGRTWRDAKQLHDARVVETRGATTATLNGFTALGQSL
LEAHGDGASLEDAVAGGAGWERLTSLVATAKTLTDTLGDDPLAYVDQGYHRFRRYAPRML
RCLDLKAAAVARPLLDAATVIATKGAVPAADDFLRPHSKWRRQLRAKGDDDARLREVAVM
FHLRDALRSGDIWLDRSHRYGDLRHVLVPMAVAHAAKLAVPSDPHVWLADRKVRLADGLA
RLGRAARSGTIPKGSIEDGTLRIDRLTADAPDGIEDLVLDLYRRLPPVRITDLLLEVDTA
LGFTDAFTHLRTGVPCGDRIGLLNVLLAEGLNLGLRKMAEASNTHDYWQLSRLARWHVES
EAIDQALANVVAAQGALPMAQVWGMGRSASADGQFFPAARQGEAMNTINARYGNDPGIKA
YTHVNDRFAPFASRTIPATVSEAPYLLDGLTMNEAGRRIEEQYADTGGFTDHLFGISAML
GCRLVLRIRDLPSKRLYVFDPAATPSELRPLVGGKAREALIVSNWPDLFRCAATMSAGQV
APSSILRKLASYPRQNDLASALREVGRIERTLFIIEWILDVGMQRRAQVGLNKGEAHHAL
KNALRIGRQGEIRDRTTEGQHYRIAGLNLLTAIIVYWNTLHLGHAVEARRREGLDTPDHL
LAHISPLGWAHILLTGEYLWPKDA
>1030145.6:AJXG01000283_10411_4159__4429_1445
MPVGFLTQEQRDGFGRYVDSPSREELERYFHLSDEDREAIQVLRGNHNRLGYAVLLTTVR
FVGVLPDKPAAVPVEVLQVLCRQLAIPDPDCLQRYSDHRRWIHATDIQNRFGYRHFTDPG
IGFRLSRWLYALCWTGTDRPGVLFERATSWLFTQKVLLPGVSQLERFIAQLRSRVEERLW
FTLGRSVTEEQRLQLQDLLTVAEGNRSSRLDQLRSGPVMVSGPALIRALRRLDDVRGIGI
TLPAAAHIPPSRIAALARFANTAKVTAINRLPASRRMATLVAFALCLEATAHDDALEVLE
ALLRDLFSNAEKADKKARMRSLKDLDRSAATLAAACKVVLDSSISDDNVRARLFNDLPRT
TLEKALEEVNALIRPVDDVYFLALEARYRSVRRFLPDLLKHIRFGFSPAGKGVAASLEWL
QLNLPRRKPEDDAPQEIVAKAWQKHITREDGSLDMGAYVFCTLDALRTALRRRDVFVSPS
WRYADPRLGLLDGAEWLAARPIICRSLGLTIDAKTTLDALSVELDATWLAVAARLPDNPA
IQLSENTEGKTELSLGALDKLDEPCSLLQLRAAVSDLMPRVDLPEILLEIAARTGFSEAF
THVSERNARADNLVTSLCAVLLGGACNTGLEPLIRTDNPALRRDRLSWVSQNYIRDDTLS
AANAILVGAQSQLELAQVWGGGEVASADGMRFVVPVRTVHAGPNPKYFGTGRGVTWYNLI
SDQFSGLNAITVPGTLRDSLVLLAVVLEQQTELQPTQIMTDTGAYSDVVFGLFRLLGYHF
SPRLADVGGTRFWRTRPDADYGKLNGLARQSVKLDLIAEHWDDLLRLAGSLKLGRVPATG
IMRTLQTGDRPTRLAQALAEFGRIEKTLHTLTYIDDESKRRATLTQLNRGEGRHSLARAV
FHGKRGELRQRYREGQEDQLGALGLVVNIIVLWNTLYMTAAVERLKQHGYPVLEEDLARL
SPLIYEHINMLGRYSFAVPEEVARGELRPLRNPDD
>1052680.4:AFTF01000422_2630_6568__3141_187
MPVSFLSSTQRERYGCYPDRLSSEELARYFHLDDDDREWISTKRRDSNRLGYALQLTTAR
FLGTFLEDPTAVPCTVLHTLSSQLGIADANCVQTYRESEQRWRHTTEIRARYGYREFVER
GMQFRLGRWLCALCWTGTDRPSALFDYANGWLIGHKVLLPGVTVLERFIAEIRSRMESRL
WRLLVRGVTDEQCQRLDDLLKLASGSRQSRLDRLRKGPVRVSAPALVMALQRIETVRGLG
IKLPGTHVPPSRIAALARFAGTVKVSAIARLPQVRRIATLVAFVHCLEASAQDDALDVLD
LLLRDLFTKAEKENRKVRQRTIKDLDRAASTLAEACRILLDCGLPDSELRERVYATIGRD
ALAQALDEVRGLVRPPNDVFYTELEGKKGTVTRFLPTLLRVIRFDATPAAQPLIQALEWL
REKPDPNPSTAIVGKAWLRHVVQDDGRINATAYSFCTLDKLRSAIRRRDVFISPSWRYAD
PRTGLLTGAEWETARPIVCRSLGLSVQADDTLTALTRELDETYRRVAARLPKNDAVRFET
VDDKIELVLSPLEALEEPPSLIALRNAIKARLPRVDLPEILLEVAGRTGCMDAFTHLTER
TARAGDLTTSLCAVLMAEACNTGPEPLVRQDTPALKRDRLMWVDQNYVRDDTLIACNALL
VAAQNRIALAHTWGGGDVASADGMRFVVPVRTIHAAPNPKYFNLGRGVTWYNLLSDQRTG
LNAITVPGTLRDSLVLLAVVLEQQTELQPTQIMTDTGAYSDLVFGLFRLCNYRFCPRLAD
VGGTRFWRVDPQADYGDLNALARQRVNLDRITPHWDDVLRLIGSLKLGLVPAMGIMRTLQ
VDERPTSLAQAIAEIGRIEKTIHMLNFIDDEAKRRATQLQLNLGEGRHSLAREVFHGKRG
ELFQRYREGQEDQLSALGLVVNMIVLWNTVYMDAVLMQLRSEGYPIRPDDEARLSPFGHE
HINMLGRYSFSVPEDVARGELRPLN
>1074493.3:AFXE01000171_127849_146745__2340_37
AIIERLTLLRAIGIDPDIAVGVHPERLRRLCQEGVRLTAQHVRTLQATRRRATLVATILE
TIVTLTDDAVLMFDRLLGQMFRREQNSADTTLKRNRRTINGKIRLLAQLGAALLAAKISG
GDIGAAVEAAIGWNDLGREVDEARKLIRPDSVDPVAVAATNYPVLRQVGPSFIASFTFGA
VPACHALARAVAIMRDLHFGHLRKLPAGTPVGFIRQAWRRAIGTGIPDRRIYELCVLVEL
RDRLRAGDMWVEGSRRYRAVEQQLIPAPVFANMRAAGPLPIPAPDTADIWLAERRARLAR
RLAEVERKAETDALEDVQLSLGRLRISPLKAITPEESDTALAPLYAHLPAIRITDLLAEV
DRWTGFSQCFTHLQSGRAADEPRAILTAVLADATNLGHTRMAEACNLVTQRQLGWLASWH
LREETYGRALARLVDAQHTAPLAALFGSGTSSSSDGQNFPLDRRAQATGAVNPHKGTEPA
VSFYSHVSDRYAPFHSTVISASASEAAQVLDGLLHHGADLHIEEHHVDGGGVSDHVFALC
HLLGFRFAPRIPNIAARRLHLFNGIEPGPDIAPLVAGRIDEGLIEAHWDDVLRLGTSIRT
GVVSASIMLERLGSYPRANGLALALREIGRVERTLFTLDWIEQPEQRRRATRELNKGEAE
NALKRAIFFHRIGRIRDHALQAQSHRASALNLVAGAIVLWNTTYLQAARMHLANLGRPVP
PDLLQHLSPLGWQHINLTGDYLWTDPDAPSTALRPLRQMRAVEGTAKP
>1078464.3:BADP01000031_12156_8953__3059_147
MQGWHTTFLGMRGLPRDISDFEMKAFFTFDGAERDAINARRGDSHKLGLALHIGFLRMSG
RLLGAFRVIPVALWRHLGNELGIAAPEVASLRAMYERGRTLFDHQQVACTVLGFQWMSEH
QRRSLVRELRDEVARCADRDQLLVRARQWLYKNKLVIVHERAIRTLIAAALAQLEVETGT
AIAASVDPATLDRWRASVSELRPDGQTQQSWLWAAPAKHSTRQISEVLERIDLLYTLDVH
KHLADIPDLILRRYARRLVSRPPSAGAKIKEPARTVEVACFLRYCLFTTTDQLILMVQRR
IADLWRQAAADVPATVNWAAMYKTLLGELVALSAQGAVPDAELRARLEALITETQKRKPP
SRASLVREGLIDGIRPVRSLLVAIAKLPWQATGEHPAIEYLAKLQALYLKGSRKLPVEVV
APSLGMIWQVSISSPDRERAFQALEVATLFALRRAVRNGSVWIEHSLSFRGRARLFFTDE
RWQAESKKHYARLSLPSKAATFLKPLLARVTAGVDAVAAAARSGVLRVDDELHLSPLPAE
DEDPEVTKLRAALDHRIGEVQLPEVILAVDAQVRFSWIMLGREPRSTDELLMVYAGIMAH
GTSLTAVECARMIPQLSATSIRQAMRWARDERRLSQACQAVLEFMQRHPIAATWGRSDLA
SSDMMTMETTKRVWQARLDPRRNTPSIGIYSHVKDRWGIFHAQPFVLNERQAGVAIEGVI
RQEKLETSQLAVDTHGYTDFAMSHARLLGFDLCPRLKELKQRHLFVPRGTKVPAEIAAVC
EANVDVALIEKHWDSLVHLAASVMSGHASAVAALARFGSAAQGDPIYEAGVQLGRLLRTA
FLADYFVKDAFRNELRRVLNRGEAVNALKRAIYTGRISPAQAKRVDEMQAVADALSLMAN
IVMAWNTSQMQAVLDRWSNRRQVIPPELIGKIAPTRLESINLRGVFRFPVDRYADQILPS
RPNASITGTNG
>1116125.3:AQDR01000034_120_3973__3003_52
MPRRNLLTPAERNSLMAFPTTDDELIQHYTLTEPDLSLIRQRRGSRNRLGFAVQLCYLRY
PGFALPTDAEPPASLLSIVGRQLRIEPDIWPQYAQRSETRREHLLELQTWLKLTPFVASD
YRHFVHQLTEQAQQTDRGIVLAKAMIEQLRQQRIILPTVDVIERVCSEALTRGTRKVYEA
LTASLTDFHRRELDGLLTIREGTKGSELIWLRQPPGPPKPRHMLAHLERLKTIHDLALPD
DLVHSIHQNRLLKLAREGGQMTAQHLRELERNRRHATLVAVLLDTRATLIDEIIDLHDRF
MSSLFSKARRNHAERFQQSGKAINDKVRLLSRIGRALLEAKQSGGDPFAAIEAIIPWDAF
SESITEAETLARPADFDFLSLVGDGFPQLRRYTPLLLSTLTMKAAPAACELLAGVEVLKG
MNDRQACKVPDDAPTSFVRKRWENLVCTEDGLDRRFYELCVLSELKNSLRSGDIWVQGSR
QFKDFEDYLLPPPRFAAQRDQQELGLAVDTDCDRFLEARLMVLQEQLARVERLAAANELP
DAVITSSGRIRITPLDNAVPDEAKELMQQAYSLLPHLKITELLLEVDSWTGFSRHFRHLK
SGAVAEDQHLLLTTILADAINLGLSKMAESCPGVTYARLTWLQAWYIRDETYSAALADLV
NAQFRPPFAAYWGNGTTSSSDGQNFKAGGRGQAAGQVNLKYGQEPGVQFYTHISDQYAPF
HTKVINATVRDTTHVLDGLLYHESDLRIEEHYTDTAGFTDHLFALMHLLGFRFAPRIRDL
ADKRLYVHGDAKHYPTLASLIGGNINVKHIRAHWDEILRLAASIKQGTVTASLMLRKLGS
YPRQNGLAVALRELGRIERTLFALDWMQNVELRRRVQIGLNKGEAKNALARAVFLNRLGE
IRDCSFENQCYRASGLNLVVAAIILWNTVYLERAVKALRDTGKNIDERLLSHLSPLGWEH
INLTGDYIWHQNKQVEQGKFRPLR
>1197906.5:CAJQ01000073_121002_130027__3015_46
MPRRMILTDAERQNFLALPIDDDTLIRHWCLDDDDRHLIETRRHDDTRLGLALQLSALRY
PGRLIQRGEVIPSVALSFLAEQLGIEPEALSTFARRAPTRYEQLAILRQHYGFTELSHPL
RADLLAFARGIAIASTKDKFVVATLADEMRRRRIIIPGITVLERLAGQACTEAEEALYTD
VAGRLTPDLVLRMETLLGAGRRAKQSGISWLREPPGKAGATAMRGLIDRLEAVRHVGVPN
DVLQAIPAHRVRRMAQEGRRLTAQNFEQMRPGRRHATLAAFFLEMEIALTDAAISMFETL
IGKSFRQAEAARDKQLLETASSATSALDFFVNFGEAITAQREAGLSLDEAVTTVASWEEL
IQATASAKAVRRPRSEDDLITYLPAQYARIRRFAAAFLASFTFEGNRRNVHIIEAIVQME
TAWRKGARSNDRPWIRKALLLANARWRKEIVGADDVIDRKMLELFLIVELKNRIAAGDIW
IRGSRAYRALDEYMISHQTFAVIKAEARIPVAIPIDVETYLAQKADALDQKLREATRRLE
TSRGDTRIGAKGLRVPAVRSTETEAAIAFARRVATAMPPIRLTDLVADIDRMTGFSSLFE
HLQTGRSPSDLRVFYAALIAEATNLGFSKMAHACPGITRRQLQQMAIWHFREETFALALA
KLVEAQHSAPFSTVFGSHAVSSSDGQHIHLGDGGEVAGGVNGRYGNNPIIKLYTAISGRY
APFHTKIIAATASEAVHVLDALLETDAGLNIVRHHVDGGGVSDLVFALCHALGFAFVPRI
PDLDGRCLYAFGLAKQYGILQNVMGDRIDADLIRTHWDDILRLMTSLRTRTVSASLMLKR
LSATTRQSGLAQALRQMGRIERTLFTLDWINDEQLRKTTTAELNKGESRNSLVRAVNLHR
LGRFRDRSQENLSIRASALNLVVTAIIHWNTIYIGRVIDALRSAGQAIPDHLLSSLSPLT
WEHVNLTGDYLWEEKPALDKNGFRAIPFNP
>137722.3:NC_013854_3173302_3181732__3029_72
MARRRLLTEDQWASLLAVPDDERAMVRHYTLSRDDLDIVTLRRTAHTRLGCAILLCYLHH
PGRIPGPDERPPMALLVFVARQVGAEPDDFIAYSRRDQNRREQVAAIMARTGHRAFDRTL
FRDLAAWLTSKAQIARDPIILATTLIDEFRRRRILIPSAAILELMLHQARGRAERVLHRA
LVDGVDQRTTDALDRLLTLQADTETTMLAWLRRVPAAPTARNMLAVIERLSTLKELGIDR
SLRARVPEVAFERLAAEGLRMTPQHLQDLATSRRRAVLTATAIRLEMDLTDVTLSMFDKL
IGSLARKAERRTAENTLRSVRDTQTQLRVLLTACKAVIGAREAGADPYEAVDQGVGWFRF
MKCVTDSEALAKPEIADPRTEMLGRYATVRAFAPTLLNRFSFLGSPSVTPLLRALDIIRV
MYAAGRRTLPEKPPTGFIRRSWRPFVIKKEGIDRKAYEICALSELRDRLRAGDVWVEGSR
QYRDFESCLMPRPTFDILCEEGALPVAVPRSADGHLAERGAELDRIVAEVADLAEEGLLE
DVDLSDGELRVTPIRDTTPPEAEDLGRRAYDLMPRVKITDLLQEVDGWTDFSGCFTHQRS
GRPADDRAATLTAVLADGINLGLSRMAEACRGASMRQLAWMHDWHIRDDTYMVALARIID
THRALPLAAVWGDGRTSSSDGQFYRAGGRGEAVGDVNAHHGNEPGIAFYTHVSDQYGPFH
TKVIAATASEAPHVIDGLLHHQSGLDIEEHYTDTGGASDHVFGLCALLGFRFAPRIRDLK
DRRLYLLPGREAPAILRPLVGGTIDIEHLTANWTELLRLATSIRSGTATASAMLRRLSAY
PRQNGLALALRELGRIERTAFTLQWLRDPALRRRANAGLNKGEARNALARAIFFNRLGEM
RDRSFENQVFRASGLNLLVSAIILWNTRYLEAAFAELASQGHGVTPELMRHVAPLGWEHV
GLTGDYVWGAEPLPEAGLRPLRRMQS
>137722.3:NC_013855_780801_776905__3031_59
MPRRRVLTDAQITALFALPTAEADLIRHYTLGPDDLAVIARRRRPHNRLGFALQLCALRY
PGRLIRPGELVPPTIVAFLAEQLDIDPDTLADYAARAPTRYDQLDALHEAFGFSTFTQPD
HRELSAWLVPIALATVSAITVAEALMAELRRRRIAAPGTTTIERMVATALLLAERHAAAK
LNSTLSPERCTALDALLDNHPGTAVSSLAWTRQPPGAPGHRSMARLVDQLRHLRQVGIDP
AATDGVHADRIRQLAREGSRLTAQHLRALGPLRRHAVLVVTVLDTIARLTDEAIGLFDRL
IGRMFRRAERRASAELRNNARSMNDKVRLLAKLGDALIDARKTGTDAFAAMDKVIPWDRF
AEVVAEARGLTRDDGPDYLALAEANHALLRRVGPLFLDAFEFQGIAAVTGLLRAVATLRT
FYAGSRRTLPKDIPTGFIRRSWRSAVFRDGAIDGQAYELCLFAELRDRLRAGDVWVVGSR
QYRAVEDQLISKPLFAEMREAGPLPVAVATDATRYLQDRKEMLEARLREVCDKAARDQLV
DVRFSGDTLKISPLQAATPEDAERLADRVYALLPRVRITDLLDEVAEWTGAVDCFTHLRT
GLPAEDRRVVLTAVLADATNLGLTRMTEACSVASYKRLAWTAGWHVSEDAYGRALARIVA
AQQAQPLAARFGGGTASSSDGQHFPLGGRGEITGAVNPHKGSGPAISFYTHVSDRYAPYH
TKAISVAESEAAHVIDGLLYHGADIGIAVHHVDGGGVSDHVFALCHLLGFRFAPRIPNLH
DRRLYTFGPAATWPTLEPFIAGRIDEALIQAHWEDLLRLATSIRTGTVPASLMLKRLGSY
PRQNGLALALREIGRIERTAFSLEWLQNPALRRQATTELNKGESRNALARAVCFHRLGRI
RDRTPENQQHRAGGLNLVVAAIILWNTVYMERAIDVLRAGGERIPDELLSHLAPLGWQHI
NLTGDYLWSADRVPGTSGYRPLRAPTELLAA
>272630.7:NC_012809_19376_15536__3139_65
VRRRSATRLDPVHQLCPVKPHCLASTATFPGRFGHSGTMARRSLLSTAERARLFGIPVDR
DGLARHYTFDRQDLALIATRRGDANRIGFAVQLALLRHPGFGLSPAITVEPALVTRIAEQ
LAIDPRAFTAYAGRSPTISDHARALERVLGLRPCARADLPSMITAAARAAWPTDQGEPIA
VAVMAALRDSGIVLPAPDTIERAGLAGRARARKQVAAALLAGMTDALAAQLDALLAIDPK
IGRPPLSWMKDLPRAPKPNHVRELLDKLAAVRDLGLDPRAAERIHPDRLALLMREGRITP
ASTLERYAPSRRRAIVVATLLDLERRLTDAALSMADRLIGASFTRGKAARERTFVATSRD
VGRLMRLLAGTAGAVATAMKENGDALAAIDAAVGLDRLIAAKPQAAEIADVAEEDPLVRA
ADRWMRLRKYGPMLIEAIDFKAARADDRTVAALTALRDLNRSGKRDLPKGTPMPFKKEWR
RLVAGADGRLDRRLFETALFAHLRNKWRSGDLWVERSTHYRRFDSYLLPLDEARTIVAPL
GLPCDPDAWLAARAERLDRRLKRLGRHLGRGTLEGVSLRNGKLSIAPVRADKNPEAEALA
ARIGALMPRIRITELLHEVARETGFLSAFTNVRTRQPVEDGNALLAVILADATNLGLSRM
AEASQGVTRDQLFWTRDAFIRDETYKAALGRIVDAHHALPIAAVWGEGTTAASDGQFFRS
GKRGDGAGQVNARHGIEPGYCFYTHTSDQHGPMRSVSMAAAEHEAPYVLDGLLHHGTGLT
IAEHYTDTGGSSDHVHFLCDSLGIRFCPRLRDFPDRRLACLEPPSRYPALGGLLGKRVKA
DLIRAHWNDIVRLVATLKAGVVAPSTMLKKLAAYERQNQLDLAIGEAGRLVRAEFMIDWM
EGPALRRRSQAGLNKSEQRHTLASVVCTYGQGRIADRSQEVQEYRASGLNLVIAAIVYWN
STYMADAVAHLRRSGDPTPDRLLAHTSPVEWEHIGFSGDFLWHRAAMMPASRRRLNLTKT
QPAAA
>290399.4:NC_008537_78916_105627__3000_64
LALRSLLTAAERGQILAMPAETEDLAAHYTLSDADMSLIRQRRGDANRLGFAVQLCLLRH
PGIGLADDTDVPPELIAWLASSLGVSIDAWDEYGTREETRQEHGREIRGYLGMSAFGIAD
YRWLVEHVGVVAAHTDKGLVLVESARDFLQARKVALPGIGVIEKACAQALTRANRRIYLT
LGEQLTVGHRQRLDGLLRRRRDSSLTEIGWLRQAPLRPNARAMNEHIDRLTTWRALELPW
AAGRLVHRNRLLKLAREGASMTAADLARFEPARRYATLFAMATESMATVTDEIIDLHDRI
IGRLIRTAQNKQNQATLASRSTVAAMMRIHSRLGDALFEAKENGEDPFAAIETAIGWESL
AESIAHAKELTRPALEDPLALVSAHFTTLRRYTPAFLAVLDLNAAPAAQDLLAAINLVRT
LNTAGARKIPDDAPTSFVRPRWKPLVFTENGIDRGFYEFCALAELKNALRSGDLWVTGSR
QFRDFDDYLLAGPDYTVMKTTGKLPLVTTDGGESYLQNRLALLNERLHHVNDLASRDELP
GVMVTDKGVKITPLETIVPKHAQPLIDQASAMFPRIRITDLLMEVDGWTGFTRHFTSLKS
GQPSKDKQLLLTAILADGINLGLTKMAESCTGVSYAQLDRHQASYIRDETYSAALAELVN
TQHGHPFAAQWGDGTTSSSDGQRFRASSKAESTGHVNPKYGAEPGRLIYTHISDQYSPFH
SKLVNVGDRDATYVLDGLLYHESDLAIQEHYTDTAGFTDHLFALMHLLGYRFAPRIRNIG
DTRLYTPTTDPGLATLAPLIGGTINTKMIALHWDEILRLAASIKTGTVTASLMMRKLGAY
PRQNGLALALRELGRLERTLFLLDWLQNPGLRRKVTAGLNKGEARNTLARAVFFNRLGEI
RDRSFEQQRYRASGLNLLTAAIILWNTVYLDRTITTLNKDGNATDPDLLRFLSPLGWEHI
NLTGDYTWPRANQIKPGKY
>381666.6:NC_005241_142972_139610__3209_273
MSAFAYRYVGREELPARLTEFDLRQFFQLTSADIAAIRERFRADRYAAVGLQLVCLRAFG
RPLDRFAAVPRNLLQYVCETFSVPLLSIASLKTLYQRRPTLYEHQQWVKEHLGIKPFDDT
SQAALLEMLRVQAAAAADVDELVTTAQRWLYDRCRLIPGQRQITDMARHAFSAYEAQMLA
AVNRAVPAATLQHCMESVRSPRADGSATHLEWIKAPSRRNGPKNLAETLDKIRYLKSLAV
HEWNLDDIALPKLRAYAQKVQARRPAKTKALKESTQALELVCFLRMSLLELTDIAMHQTS
RRSQDLFRRAASTAQSTHTRSAVEDRQQALKAKAVLQDKSKSTEQRVDEALKHLAVVTDA
AHSSFASHVRAALTGDHQRIHALLSGLEGLEFGGREDDPGFANLKAWRDLQTRKLNALPE
DFTESGVGTAWHDLVHDPDPKRGYQAFSACTMMSLRNSLRRGSVWIDHSMRFRDRDQMLI
PAKEWERDRVKYLGLLGLPAAADTYIEQLLDTLRAGVAAVAEATANGKIEIGDDGMLHLP
AIVPLEQDDEPRRTRDLIYKTIGDVQLPDLLLEVDASTNFSEVLLGHRAKSVPELLSTYA
ALLAHGTEIDAKGIAAMIPGIDTAQVSLAMRGLETHGRLRRANEVVAEFQGKIPLATNWG
TGQKASADMMSLDVSRHLWIARVDPRRRTYATGIYTHVLDKWGIVYDQPIVLNERQAGVA
IEGVEQHNRCEDRIRLSLLAVDTHGYTNAAMAWAKGLSFDLCPRLRDLSERKLYLPAEFK
VPEGIERVTTKRLSLRAIRLGWDDFLRVLASIRIGRISAELAMQRLGSAARTNRAHKAAE
HLGRLLRSIFLCDYVTIEDFRREIHTLLSRGESVHQLQRAIHAGRVPHERGRRGDEMTAI
SGAHALLTNIVLAWNTHRMNDVVERLRKGGTNIEDAWLRRMGPGHSGHINFRGILSFGVE
RYIDALIRGSGATTRRAMA
>439843.6:NC_011092_43045_70273__20706_22190
HAFRSGDVWLTRSRRYGDLKHALVPAQSIAEGGRLAVPLRPEEWLADRQARLDMRLRELG
RAARAGTIPGGSIENGVLHIEKLEAAAPTGAEDLVLDLYKQIPPTRITDLLLEVDAATGF
TEAFTHLRTGAPCADRIGLMNVILAEGINLGLRKMADATNTHTFWELIRIGRWHVEGEAY
DRALAMVVEAQAALPMARFWGMGTSASSDGQFFVATEQGEAMNLVNAKYGNTPGLKAYSH
VSDQYAPFATQVIPATASEAPYILDGLLMNDAGRHIREQFTDTGGFTDHVFAACAILGYR
FAPRIRDLPSKRLYAFNPSAAPAHLRALIGGKVNQAMIERNWPDILRIAATIAAGTVAPS
QILRKLASYPRQNELATALREVGRVERTLFMIDWILDAELQRRAQIGLNKGEAHHALKRA
ISFHRRGEIRDRSAEGQHYRIAGMNLLAAIIIFWNTMKLGEVVANQKRDGKLLSPDLLAH
VSPLGWEHINLTGEY
>765909.3:ARBC01000018_98898_95070__3040_62
VPVDFLTEAQQRRYGRYPEAVSAAQLARFFHLDDTDRDLIGQHRGDANRLGFALQLLTVR
FLGSFLPNPVAVPPPVVEHVARQLGITEVGCLSRYLEREPTRHAHRAEIRAAYGYRDFGE
PPWSFRLGRWLFLRAWLSEERPSLLFDLATAWLIERKVLLPGVTTLTRLVARVRDRSASR
LWRRLCALPSAAQQERLEALLLVPEGSRYSHLDRLRRGPTRVSAPALIGALQRHRELQAL
GIGTLDLTGLPPARIKLLARTAATAWAPIIARMQPPRRLATLLAFVAVYEVTALDDALDV
LDLLITDITAQAERLGQQQRLRTVRDLDQAALALREACVLLLDPQYPDLEVRTVVLKHIP
EERLRRAMATIETLARPADDHYQEELVDRYQRVRRFLPAVLRQVQFQATPSGQPVLEALQ
FLRSLEGKRHADCQAAPRECIPTPWRRLVIDQDDQVQRPAYTLCTLGRLQDGLRRRDLYV
SPSERWGDPRAKLLQGPQWEAQRGPLCRSLNLPVNADQALAQLGAQLDTAYRRTLANLPT
NTAVRIDPAHPARPLTLSHLDHIPEPDSLIDLRARVNRLLPRVDLPEILLEMQLRTGFAS
AFTHVSEAQARISDLPTSVCAVLLAEACNIGLEPLVREDNPALTRNRLSWIQQNYIRADT
LAQANACLVEGQTANPLAQQWGGGEVASADGMRFVTPVRTLNAGPNRKYFGAERGITYYN
FTSDQYAGFHGLVIPGTLRDSIYILAGLLEQQTCLQPAEIMTDTAGASDVVFGLFWLLGY
QFSPRLADLGGARFWRLDADADYGALNALAKHRITGSRVVRQWEDILRVAGSLKLGAIRA
DELVRSLLKGDRPSSLTQAMADLGRIPKTIHLLNFLDDETYRRRILIQLNRGEGRHAVAR
KICHGQRGEIRKRYREGQEDQLSALGLVVNAVILWNTIYTATALEQLRAEGYAVRPEDVA
RLSPLSTHHINVLGRYAFLLSEQVARGGMRPLR
>862719.3:NC_016624_116657_111986__2976_67
FGLPTDRDALARHYTFTRSDLDLIASRRGNANRLGFAVQLALLRYPGLPLPHIGEPIDAV
VGWVAEHLELPVTAFAEYARRSQTMTDHARDTVAALGLRFPREADLPDLIEAAAQAAWIS
DQGMSIMTGTIAALRSAKIVLPSPAVIERAALAGRARARKRAADALVADLTAEQRDKLDK
LLAVDPATGITSLTWLRTIPTAPKADHVRDVIDKLHVVRGIGIDAEAQARVHETRFRQFA
REGMASPTYLIERCAPNRRRATLVALLIDLENRLTDAALDMADKLIGGAFTRAKNNKEKT
CVAKTKDVGRLMRLFHRTIEALSLAQESDGDAFALVNEAVGWPQLLRVRGEVASLAELAE
EDPLVRAADRYVTIRKFAPALLEALTFKAARSKDPILAAVELLKELNRSGKRDIPADAPM
LFRKEWRRLVTKDGKPNRRLYETAVLATLRNKLRSGDVWVERSSNYRRFDSYLLPAAAAA
PISADLTLPATAEEWLGALGRDLDEQLKRFAQRLRDGQLEGVELRDERLHIAALKATAPP
EADVLADRLDALLPRVRITELLHEVNRATGFAAAFTNLRTGESCDNENALLAVILADGTN
LGLTRMAEASQGVTRDQLIWTADACIRPETYQSALARIIDAHHRLPMAAVWGGGTTSSSD
GQFFRSGKRGNVAGEVNARYGGSPGFSFYTHVSDQHGPYHVRVISAAAHEAPYVLDGLLH
HGTGLKLDTHYVDTGGTSDHVFILAAMLGFRFCPRLRDFPERRLASIEPSSCYPDLQPLL
GRRVKVDVIREHWNDVVRLVASLKAGTVAPSTMLKKLAAYERQNQLDLALQELGRIERTL
FMIRWLETPELRRSCHIGLNKGEQRHALAQAICTFKQGRIADRGSQAQQYRASGLNLLIA
AIVYWNSTYMADAVGHLRAVGGTVPDDLLVHTSPVGWEHIGLSGDFLWGRAAAVPIGRRP
LNLRRDRHAA
>fig|101510.15.peg.95 Mobile element protein [Rhodococcus jostii RHA1]
MSRFQFVDDHCDTVPVKWLCQILEVSRSGFYRWRTSGPARAARARADEELAERIRAIHAD
FDGTYGAPRITAELREAGIEVNHKRVERVMREHGIVGVHLRKPVRTTVPDPDAAAVPDLI
RRDFTASAPNTRYVGDITYLPVGDGEFLYLATVLDLGSRRLAGWSIADHMRTELVTDAMR
AAAACRGAAGLEGSIFHSDNGAQYASAEFADLCRELGVTRSRGAVGTSADNAAAESLNAT
LKRETLQGRKRWNSAGEARAAIFRWITRYNTRRRHSTLGQICPIEFEQRSATLATAA
>fig|106370.11.peg.2651 Mobile element protein [Frankia sp. Ccl3]
MTAGAGGVYDLGYHVVWCPKYRRPVLTGGVRERLDALLREKCAEHDWPVIALEVEPDHVH
LFVKAHPKHSPSYVANQLKGFTSHVLRAEFPHLRSRLPTLWSRSYFVATVGAVSAGTVTR
YIETQNERPWRKAAAREADVQVPAAPDGASGRVVDRDAERPPRALQRGVAGASGRLRAPV
EDQGRVRGPSRPS
>fig|1069080.3.peg.171 Mobile element protein [Succinispira mobilis DSM 6222]
MHKAYKFRLYPTKEQETVITKSIGCNRFVYNHFLAKRKEAYEEYDAMINYKGLRLLA
>fig|1078846.3.peg.3054 Mobile element protein [Methylovulum miyakonense HT12]
MPRVGITYIWTEEGWLYLAVVLELYSRRAIGWAIAERMTAPLVCDALTMTLWRRHMPKGV
VVHSDRGSQYCSAAYQKLFIKHPLVCSMSKKGDCYDNAAMETGTIALKSRLCTVSGF
>fig|1078846.3.peg.67 Mobile element protein [Methylovulum miyakonense HT12]
MDDYPKTLAEFEERFSTEEACWHYLCELRWPDGFVCPRCGHRKAWLIDHGLHWCRSCDYK
ASVTAGTIFERTKKPLMVWFRVIWWVTGQKYGASAKGLQRMLGIGSYETAWTWLHKLRRA
MVRQGRDRLSGNVEIDETFVGGVKHDGKRGRGASGKVLILMVAQLDGKKLGRIRLKRIED
ASAESLEKAIQDTVEPGSVIRTDGWAGYNQIGNRGYIHKVVRTDAEVGDNLLPACNLVAS
LMKRWLGGTLQGAVAHEHLEYYLDEYTFRFNRRTSRHRGKLFYRLLQQAVLTDAVTYETI
KKNVRGRKPTHHNI
>fig|1117647.4.peg.2634 Mobile element protein [Simiduia agarivorans SA1 = DSM 21679]
MCEHLDVSTSGYYDWRERKPSERAQYDAILVSQICRMHVGHQKNYGAIRVHPYLRARDYA
CSRRRINRLMKAHGIRSIYHAQRPRRYKGANAPVSDNILAARPKAAQVGESWAGDMTYLK
TAEGELYMAAVLDLYNRKVVGWGFSSAHNSDLVEGALQMALAMEERLPGCIFHSDQGSEY
RSDEYRRLLQDSDMVSSMSRAGVPTDNAYVESFFKTLKNELVHHWKFKSKIECVARVVDY
VGFYNNNRLHSGLDYATPNSYQG
>fig|1122137.3.peg.962 Mobile element protein [Kordiimonas gwangyangensis DSM 19435]
MSSGIRYTEEFKRDAVAQVVDRGYSVLEVATGLGISTKSLYDWKKCYHKPERQIRQEAAE
AAEIRRLKAELARVTEERDILKKATAYFAREAK
>fig|1123236.3.peg.1430 Mobile element protein [Salinimonas chungwhensis DSM 16280]
MHESTELVCSALGVGVSSYYERRKRHRLIGAKRRILRARVKRLFDKSRQSAGTRTLVDML
RDEGIVMGRFKVGRLMKEQGLMSKQPGKHAYKTVQVERPDIPNLLDRQFSVEQPNQAWCG
DITFIWTGSAWYYAAVVIDLHTRRVIGWSISHRPDAELAARALDMAYELRGKPTGVMFHS
DQGSQYGARKFRQRLWRYKMSQSMSRRGNCWDNSPMERVFRSLKSEWMPSAGYRLPNEAK
RDVGYYLMNYYNWERPHQFNNGLPPAKAEELAKKVSGFY
>fig|1131462.4.peg.699 Mobile element protein [Dehalobacter sp. CF]
MIRQNAHKYSVSAMCKVLQVNRSSYYYKSTYQEVEDDVEQHVIEIFESNQRVYGTRKIKI
ELQKKNLTVSRRRIGRLMKKNGLVSTYTVAQYKPFKTKCNEAEIKNELNREFEKAVPLET
VVSDLTYVRVGTKWHYICLLVDLFNREIIGQSCGKAKDAALVYRAFASVKSNLHNIRMFH
TDRGSEFKNQLIDEVISTFNIQRSLSMKGCPYDNAVSEATFKLVKTEFVKNRRFVSLEHL
ENELKSYIKWFNEKRIHSTLGYLSPLEYKTIYLNKSV
>fig|1148.1.peg.41 Mobile element protein [Synechocystis sp. PCC 6803]
MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEA
LKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKELRYRERNREERVKYYRML
RELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQGKRGVRENLVAGRRKGKK
DLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNAPIHRKTAIKELAKEAGHEVL
FLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRSYCGV
>fig|1173022.3.peg.511 Mobile element protein [Crinalium epipsammum PCC 9333]
MIEPREQHLTQTQSLLGVLAEILTASDETPDAMTLGSQVQSVLQVHGGTALLLQQCEEIT
AYNSHNYLPLLWRFYSRYRKLLFELVRSLDIRSTSADESVIDAMAFVLEQEHRRAKWLPA
TIDLSFINDAWRRLVVTKQGDTEVLVRTQLEICLFVHLASELKTGDACVVGSENYADFRE
QLLPWSECSSLVEEYCQSLEIPADSVQFVEYLQQKLTLLAREVDQICSNSDQITINREGE
PVLKRLVTQPQSEEAFQLESAILQRLPERSLLDILCNVEHWLHWTRHFGPISGSEAKLTQ
AGTRYILTTFGYGCNLGPNQTARHCRGGITSHMLSYIHRRHITADKLQAAIRDMINAYNQ
LQLPSCWGTGQRAAADGSKFEIYENNLLSEYHIRYGGYGGIAYHHVSDTYIALFTHFINC
GVWEAVYILDGLLKNTSDIQPSTLHADTQGQSAPVFALSYLLGIKLMPRIRNWQDYTFLR
PSSQDVYEYIDPLFKGVVDWKLIHTHWQDLMRVVLSIKAGKLMPSTILRKLGSYSRKNRL
YQAFRCLGQVIRTMFLLEYISDCGLRQEITACTNKVESYHGFLDWLFFGKDGVITENDPS
EQEKRVKYLDLVASAVILQNAVDISQIVQQLSAEGYKINRDLLASLSPYLTRQIKRYGDY
VVDLQNVPPSWEQAIVLPIE
>fig|1173022.3.peg.5346 Mobile element protein [Crinalium epipsammum PCC 9333]
MRNKECIRNIGLPPNLFEGISPKQIKTYRYRAATETPYLLRQHPPAIRYTLMAAFCVQRA
QEITDNLIELLMSIIKRIGTRAERRINKELVSDFKEVTGKTNILFRIAEVALAEPSGVIE
KVIYPVVSQKTLRDLVAEYKANGTAYRQRVYTVMRSSFASHYRRMIPTLLSVLEFRSNND
IHRPVIQALELLKKYAQSKARYYHAEEDIPINGVLKSGWKEILFEKDPDGNERINCINYE
ISVLQALRERLSCKEIWVVGANRYGNPDHDLPTDFDQHRQIYYQALTLPLDVETLISNLQ
QQMAQGLENLDQGMPKNKDVTIIGKSCQGLIKLSPIEPAPEPINLKQLKGEINRNWEHTS
LLDILKETDLRVDFTQNFTSMGTREIIDKETLQKRLLLCLYGMGTNTGLKRINTGINGEN
YQDLLYVRRRYIHKDQLRSAIADVINAIFEIRLPHIWGEGTTTCASDSKHFGAWNQNLMT
QYHLRYGGRGVMIYWHVEKKSTCIYSQLKTCSSSEVAAMIEGVLRHCTNMDVQKNYVDSH
GQSEVAFAFTHLLGFQLMPRLKRIKVQKLYRPHVGQSDAYPNLQPILTRPINWDLIRQQY
DQMVKFTTALRLGTAETEAILKRFSKNPFKHPTYLALLELGRVIKTIFLCQYLDSSEVRR
EVNEGLNVVERWNGVNDFIFYGKGGEFASNRLESQELSVLSLHLLQICLVYVNTLMIQSV
LEQNHWQQKLTEFDKRAMTPLIFSHVNPYGTFTLDLQQRIAGLTQLYVA
>fig|1173026.3.peg.1363 Mobile element protein [Gloeocapsa sp. PCC 7428]
MKPYSLDLREKIVKAYAQGDTSIRKVAARFGVAKSFVQKLIAMKKTQGHVQPKKQGGAIK
GKLDGYKAQLAAMVKQYPDATLREYCEYWGTNYHDWLSTSTMCRALQKQKLTRKKRHCAA
LKQKHNEYSN
>fig|1173026.3.peg.3769 Mobile element protein [Gloeocapsa sp. PCC 7428]
MMNKEPFHNLSINNDKSHIYQPQQRNFEELYIEESQFLTSFQREFLLKSRQSNLRPEYHR
RIEIMLLADMGYSQAEICAALGCSQEMARYWIAMAKAGLAHKWNDRPIGRPKTIDAHHIA
RLQELVNHSPREYGYSFRCWTAEWLRKQLAKEFGVEVSDRHISRILQKLGLSLRQIRVQK
ETKSFSQDKAASIKISNLQSSAQANPLWTFNAVKPSK
>fig|1203568.3.peg.327 Mobile element protein [Dermabacter sp. HFH0086]
MPRSTFFYHQKRLSEPDKHAALKDAIRESFERNKHRYGYRRVLLDLCNQGWVVNHKLVYK
LMREMGLRAKVRQRRPCVSYSRTISHIADNTLDRKFTPDKPNTVFASDVTEFRVQGRKVY
LSPVMDLFDRSIVAHTVATSPSTTFTADSLTQTIKTCAPEPGWMIHTDQGFQYQHSSWRN
LIHDNGGVQSMSRKGNCYDNAVMENFFGHLKTEMYHGEIFDTVAEFNQAIDEYVQWYNTE
CIQQRLKGLTPMQYRDQALEALTA
>fig|122587.1.peg.210 Mobile element protein [Neisseria meningitidis Z2491]
MSTFFQQTAQAMIAKHIDRFPLLKLDQVIDWQPIEQYLNRQKNRYLRDHRGRPAYPLLSM
FKAVLLGQWHSLSDPELEHSLITRIDFNLFCRFDELSIPDYSTLCRYRNWLAQDDTLSEL
LKLINRQLTEKGLKIEKASAAVVDATIIQTAGSKQRQTIEVDEEGQVSGQTTPSKDSDAR
WIKKNGLYKLGYKQHTRTDAEGYIEKLHITPANAHECKHLSPLLEGLPEGTTVYADKGYD
SAENRQHLEERQLLDGIMRKTCRNRPLSEAQTKRNRYLSKTRYVVEQSFGTLHRKFRYAR
AAYFGLIKVSAQSHLKAMCLNLLKAANRLSAPVCA
>fig|1234679.3.peg.2321 Mobile element protein [Carnobacterium maltaromaticum LMA28]
MATEKLEHYVSLIDALHFAKDNNSNPFDEIERIILWNELIQDGEEAKQITGHKKYGYLEM
VRNKATYLRRYTPMLLKTLSFKATTSAKPVLTALTQLSELHNDGKRKLPVDTSIDFVSKK
WENLVRPQNGKIDRSFYELVAFTELKNNIRSGNISVEGSLAHRNIDDYLVPSDSCLGSLT
IPDTFDEYLEARGSFLDSHLQFYAKSDKKTAKMTLKKLEKITPDEAEIFRKRLYSMIPKI
RLSDLLIEVDSWTQFSQEFIHDSTGKPPNETEKKIVFATLLGLGINIGLEKMAQSTPGIT
YPQLANAKQWRFYKEALTRAQSVLVNYQLDIPIADFWGEGKTSASDGMRVPVGVSALKSD
VNPHYKSLEKGASMIRSINDRNTSHHVEVVSTNTREATHTLDGLLYHETDLDIEEHFTDT
NGYSDQMFGMTALLGFKFEPRIRNIKKSQLFSIKPSSEYPDLSGSINSRINVKIIEENYE
EIKRIAYSIQTGKVSSSLILGKLGSYARKNKVATALRELGRIEKSIFIIRYVTDDQLRRK
ITHGLNKTEAVNALARELFFGRRGKFMERDIRRQLQSASALNVLINAISIWNAVYLQEAY
NYLVKIDPQVTKYMRHISPINWEHITFLGEYKFDLLSIPKHLRKLNIKNSPSSDVVI
>fig|1234679.3.peg.2322 Mobile element protein [Carnobacterium maltaromaticum LMA28]
MGLKIILTAAQRERLLSVEHLSEEDFKAYFSFSDSDLEIINQHRGNINKLGFAIQLCLAR
YPGCSLSNWSVKPDRLTSYVTHQLHLGPIELASYNHRNTRANHFNEILETFRYQRFGSNG
NREHLIEYLVNLSLENDDSTFLMKETPDFLSCNRIIFPSIATLEDVISHCRSKAESTLFS
ILLQPLKGIQMEKLDDLLHLFKETKMTKLAWLKDIPGKANPESFMSICKKVEAINAIELG
TINVAHIHRNRFLQLARLGDNYDAYDFSRFEFEKNMPY
>fig|1234679.3.peg.315 Mobile element protein [Carnobacterium maltaromaticum LMA28]
MTQVHFTLKSEEIQSIIEYSVKDDVSKNILTTVFNQLMENQRTEYIQAKEYERTENRQSQ
RNGYYERSFTTRVGTLELKVPRTRDGHFSPTVFERYQRNEKALMASMLEMYVSGVSTRKV
SKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSEKNYPYLMTDVLYIKVREENRVL
SKSCHIAIGITKDGDREIIGFMIQSGESEETWTTFFEYLKERGLQGTELVISDAHKGLVS
AIRKSFTNVSWQRCQVHFLRNIFTTIPKKNSKSFREAVKGIFKFTDINLAREAKNRLIHD
YIDQPKYSKACASLDDGFEDAFQYTVQGNSHNRLKSTNLIERLNQEVRRREKIIRIFPNQ
TSANRLIGAVLMDLHDEWIYSSRKYINFDK
>fig|1255043.3.peg.18 Mobile element protein [Thioalkalivibrio nitratireducens DSM 14787]
MPANILNLPDFKVQRVEEADHDYHVYAEVSNPPGGVCTACGSDHLIGHGRNEQVIRDVPT
HGKRLAIYVDTRRWRCQSCGKTFMQAVPAVNAKREMTDRLVRWIGQQSLKRTFASIAGDT
GLDEKTIRNIFRDYINALESEFRFETPQWMAIDEIHIINKPRCVVSSIQNNTIVDLLHNR
NKDTVAKYLCKIPNRDKVQYVAIDMRTPYRDAVSAELPEASIIIDKFHVVRMANEAVEKV
RKSLREQLTPQQRRGLMHDRFVLLKRERDLDDKEALLLDGWTKNYPELGAAYRLKEDFYA
VYEGSDSPEAALAAYEAWKKAVVPEVRDAFDDLMRAFTNWQPFILNYFEHRVTNAYTESL
NRLSRVVNLLGRGYSFEALRAKILFTKGAHKHKLSCRKFERRREPEPELAAAEKAARVGL
PETYDPHKHEKPQKNYGADLNTLIELLESGRL
>fig|1255043.3.peg.917 Mobile element protein [Thioalkalivibrio nitratireducens DSM 14787]
MKKITEVLRLKHAGGLSHAQIGQACGISKGAVSKYVSLAAAHGLTWPLPADLDEARLEGL
LFPPVAKPAAFAEPDHFGLHQALKRKGVTLQLLWSEYAAVHGERAYRYSQFCHRYHQWRA
AQKRSMRQHHRAGEKLFIDYAGPTVEVIDRATGEIRQAQVFVAVLGASSYTYAEATWSQS
LPDWIAAHQRALRFFGGVPQLLVPDNLRAAVTQACRYEPGINATYAEMAAHYGTAVLSAR
PYKPKDKAKAEVGVQVVERWILARLRHHTFFALAEVNRAIAALLPALNERPFQRRSESRK
DLFEQLDRPALKPLPTTEYVYAEWRKAKPGIDYHVEVDRRFYSVPHALVGQVLELRLTAT
TVEVLHKGQRVATHPRTGQGRFSTCLEHMPKSHQAHRDWSPGRFLRWAQDIGPCTAEVIT
RQLEGRPHPEHGYRACLGLLNLGRRYSRQRLEKACQRALAVRTVSYQSIASILKNGLDQQ
PLDTDRDGQRELPLHANVRGAGYYH
>fig|13035.3.peg.481 Mobile element protein [Dactylococcopsis salina PCC 8305]
MCYTHNCEFVKTMEQTLTLVVKLDIKPEQASQLEETGQAFANACAWINENVNHRLTNRNS
IQAVCYNDVKEQFGLKANHIVRACARVASNRKTAKHKGGKVKGFKPTSFDCDGRTFSFRE
KDWTISVSTLGKRLRLPLRASNYHKGKLTGRKPTSAQICKHKDSQWYCHLQITIDYPDPQ
KTDKVIGVDFGRREIARTSTNQGWDGKEVQQKRDKFSRVRSSLQKKARKGTRSSRRRCKE
VLKRLSGREKRYQKWVNHNISKTIILEAKETDSTVAIEDLTGIRERTNQKPRNKTERRRS
NSWAFYQLRTFLEYKGVKEGIKVIAVPPAYTSQTCHCCNHIGIRTNKNFKCSNSECGWRG
DADLNGALMIQKWGCSINQPGGSEILSCRISRATENPNRARSGLG
>fig|137722.3.peg.1128 Mobile element protein [Azospirillum sp. B510]
MEKPPRHRLSDAEKDALLLEQAALIERLAARITELEALVGKPRKTSSNSHTPPSQDGPGR
PGSKAAATRRRKPRPSRPGVSRPLSEEPDKTDRRLAESCPHCGTAVSAMPQRCRHRYDHI
DLPVIRPMVTRVELFGGRCGDCGRRYRAEPPALMPPGTPFGPGIRALLAYLHHSHHVGFE
RLSRMLKEVFGLTISEGAIANSFRRMGGAFDTARAAIKAKLLTAPVIASDETTTRVNGVT
QWQWVFHSDKAVLHDIVPSRARSVAAQLLGDHRPEVWVSDRYAGQQELGRVHQVCLAHVL
RDVQYAIDCGDTVVAPKIRDHLRWAIRIGKRRPASKDSTLAAYAARADRGLDVLLGVPAA
HPAGRDLQRQIKAWRGKFFVFLTDRRVPPTNNGSEREIRPSVIFRKVTNGFRSTWGPGIH
AGYRSVTGTARLQGQSAWTAIRDLVDGTFAVAEAPALPAT
>fig|156889.7.peg.1449 Mobile element protein [Magnetococcus sp. MC-1]
MHIERVPNRNSHPTVLLRESYRENGKVKKRTLGNLTGQPEETIEALRVVLKGGRMMPMTS
ALTIEASLPHGHVAAVVGVIKSLGLKSLLGTKQTRYRNLILALIAQRVLQPASKLASHRL
FNTTTLGQEFGVADANKEELYKALDWLGAQQERMENRLVKQHLKDGSMVLFDLTSTYLEG
RQCELAEYGYSRDHRPDKLQIEIGLLCDKEGRPLAVEVFPGNTGDPTTLTAQVNKLKARF
GLKQVIVVGDRGMITQARIDEDLQPAGFSWITALRHSTIRSLAKTDNWPSLFDARNFAEI
TSPDFPGERLMVCRNPFLAEDQGRSRRELLTIAEQGLETILQAVQEGSLRDCGQIGKRAD
RVLRKLKIARYFNLEIAPGRFAWSRKQAVIDQETALDGIYVVRTNLPEKEISSADTIRQY
KSLAQVESAFRHLKSSLDIRPIFHFRADRIKAHVFLCMLAYMVERKMRIKLKTLLFTDEA
PLLPDDPVMPRESSPNAKEKTGTRRSPVGHALQSFSTLLEQLATLTRNTVRAQWEPATGK
PFEMLANITPLQQEAFRLLSTSP
>fig|156889.7.peg.2800 Mobile element protein [Magnetococcus sp. MC-1]
MRRHELIDGLKRLKLHGMVAAFDEAVVVDERRNRTIHEILGALIEAEQVERKVRSIHDQM
SVAKFPSQKNLDSFDFTASSANEGRIRTLYDGEFLDGAGNIILVGGTGTGKTHLAIAVAA
NCIRLGKRCRYFSVVDLVNKLEREQADGLAGRLAEKLLRTHLLVLDELGYRPFSKTGGAL
LFHLISKLYEQTSLIVTTNLTFGEWPKVFGDAKMTTALLDRLTHHCDIIKTGNESYRMK
>fig|160488.1.peg.1850 Mobile element protein [Pseudomonas putida KT2440]
MAKLALEQAIAPEWVDQVFEEHRQRQYSRELLFSTIIKLMSLVSLGLKPSLHAAARQLDD
LPVSLAALYDKISRTEPALLRALVTGCAQRLAPTIHELGCSAMLPDWQVRVVDGSHLAST
EKRLGALRQERGAARPGFSVVVYDPDLDQVIDLQPCEDAYASERVCVLPLLAEAKTNQVW
IADRLYCTLPVMEACEQVKTSFVIRQQAKHPRLIQEGEWQAPMPVATGTVREQSIEVKGG
HRWRRVELTLHSPNDSGDNSLMFWSNLPESISAQQIADFYRRRWSIEGMFQRLEAILESE
IETLGSPRAALLGFTTAVLAYNVLALLKRSVEQAHRDALPENWEASIYHLAVQIRGGYEG
MQIALPSEYMPVVPMENLAQRLLELARNIQPRQVAKSPRGPKVLKAKAWVQGTAVHAHVS
TDRVIKAAKTKRP
>fig|164546.7.peg.3249 Mobile element protein [Cupriavidus taiwanensis]
MPGLEFRYVGKDSLPSRLSEFDVEYYFALTDSDVAAINQKFRRAGRAGAAIQLAFLRASG
RTLDQLNTLPRQLLRYVGEKLGLPTPTIASLRTIYQRYPTLYEHQVWACQYLGLTRIDDD
HWRGLGAWMRQDAAESLSLEELIQHAHYWLYERRILIPSTRALLSLARSIWAGIERDLLL
SIEAVVPLAQIAGAEAAVFAQHATAGTTVLEWLKTPPARHSPSTMNETLAKIRFLKSLGA
HTWAFDAIPIEKQRACGQRIQARRPAKVRELKTSTRTIELVFFLRVTLLELTDAMLYQTG
RRVSDLVRQAYNKTTTKQARSASEYRQQMVEIKALVDDTRRSAEERLADIGKLLEGLSAK
PPASHAASVRETLTEDHHRIRNLVTSLRELEFASNSTDPALRQLEFIGSLHDQGATELPP
DCNVSVGASWRDLVDGEDRKRALRAMEACAITGLRKGLRRGTVWISHSLSFRERDQLLIP
PAQWDSERDRYLSTLDLPNQADTYLNPLMDHLKAGLAALDEARAAGHVTIDTNGVLHLSP
LEAAESDGIPTRTRDLLFKDIGSAQFADMILEMDARTNFSEVLLARNGDAHELITLYAAL
LAHGTELDAKGVAAMIPKLDPAHVSTAMRALEMPGRLRRANERVVEFQRTHPITELWGTG
QQASSDSMSLDTSRHLFYARADPRRRTHAVGIYTHVLDQHGIVYNQPMVLNERQAGVAIE
GVMRHNETRSDGGLLRLAVDTHGYTSVGMAVSKLLGFDLCPWLRNLSERKLYLPRGLQVT
DGLSAAVSPEISLKAIRDGWDGLLRLIASIHSGRVSAIVALQRFGSAAQGDPIHRAADHL
GKMLRTLFLCDFFSNIEFRRELRTLLNRGESVHQLQRAIYSSKVHHDRGRRQDEMIAISG
SLTLLTNLVIAWNTQRMQTTADAWRRKGQRIEDDWLRRMGPAHFAHVNFRGIMSFPIHLY
QDSLLEVAPQRRAV
>fig|177437.4.peg.2020 Mobile element protein [Desulfobacterium autotrophicum HRM2]
MIDQDKRQAIYYLHKEGMSLRTIARNMGISVNTVISIIQQQGLIPEPLRKDKITIDEALL
KKVYQECNGWNQRIHEILTEEHKLDVGYSTLTRMIRELDLGNSKKNKRCSQVPDQPGQEM
QHDTTTYVLPIGDVRIRVVASIIYWRYSKVRYLKFYRHFDRFTMKCFLHEALMFWGYAAR
ECIIDNTNLARLRGLGRNAVIVPEMERFAAQYGFEFVCHEKNHPNRKAGNERSFYTTETN
FIPGRTFKTFEDLNQQGLAWATVRMPNRPMAKTRLIPEKLFAHEQTFLTKMPAFITQPYR
EHQRVTDQYGYIPVDGNYYWVPGTGRHDVIALEYSDHLKIYLNRQCLGEYQLPPEGTKNK
KIGPDGQPPPIRQPRNRKKPTINQEKLLRELSSEVSKYIDEFVIPMSGKKRHGFIRQMYS
LNQKLTPSLFIAAIARALTYRITDIETIKRIAVLKMQQGNCKIQSPDVDMTYINRKSFLE
GQFADEVDLTTYDDLEDTHG
>fig|177437.4.peg.4070 Mobile element protein [Desulfobacterium autotrophicum HRM2]
MNPGVDIRIKQNLKDLKLAAMLRELSSHLRDARENQQSHEEFLLNLTETEVRIRAENSLK
RRIKESKFPLMKPMETFDFEKAPDLDASLVKTLSTCEFIEKKQNAIFLGRSGTGKTHLAT
ALGIEACRKGYKTRFVTGCGIVNDLVEARDDKCLKRVLSRYARYDLLILDELGYVPFTVE
GSQLLFQVLTERHEKKSIIITTNLGFADWTQIFGDPNLTSALLDRITHRAHIIQCVWDSF
RLKDSLSLKGKMG
>fig|177439.1.peg.2434 Mobile element protein [Desulfotalea psychrophila LSv54]
MKGCYNHMHGCRILLTSFQKVILMQVKLHANATTTPRIRKYIQESDKPVRTLARELGVAE
TTIRIWRDRDSVEDRSHTAQNLQTTLSKDQEWLAVELRKMLLLSLDDLLVVVRKFINAKA
SRSGLDRCLRRHGVSRLKDLIPETAPKPSPKQFKEYDPGYVHVDLKYLPQMPDEDQRRYI
FVGIDRATRWVYLQIMPDKTAASASLFLRNLLEKAPFKVKTILTDNGKEFTDRFCATGQR
EPTGKHVFDQNCTVHNIEHRLIKPMHPQTNGMVERFNGRIAAILKRTTFESAQDLEDTMH
RYELVYNQHIPQKALKHLTPMDKLKEFHQLKPNLFKKRPTNRRGPNNYGDYQCPQPGPKP
KGFTDFS
>fig|188937.1.peg.1018 Mobile element protein [Methanosarcina acetivorans C2A]
MFRKYDQKQQFLLPLNLEDFVPENHIARVLNDIVDVVDITAIESTYSKEGCPAYHPKPLL
KILLYGYLIGIRSSRKLQQMTQTDTAFMYLAAMQKPDFHTICRFRSTHLGPIKEIFSQVV
TFCKEMDMIGSSISIDGTKVKANASSRQSKSSDALEKEIDKILKESIETDKHEDEIYGDS
TPYQIPEELVDKKKRLEKIKAAKKKLDEEKLKKINITDNDARIMKHKDGSKKPSYNCQVA
VDEKEQIIVAADVVNEENDLHQIEPMIQNVKNTLGYKPTIVLADAGYFSYGNLEFLQEEG
IDAYIPDNFYKAEKEGKTRRFRKSLFTYDEQKDCYYCPAAFEIPFTRIQKRKGEPDLRYY
VCSYCSQCVLKNACTKSGKRTITRDPREHLMEDMRDKLNTEKGTEKYQKRMSTVEPVFGQ
MKQDRGFREFLLRGKRKTGIEFVMMCTVHNIKKIADFIKREGKNLKSMLKMIVGGGSKGW
NKGGIRARITNTLC
>fig|190650.1.peg.272 Mobile element protein [Caulobacter crescentus CB15]
MDLSRFVEGCDRRQPTLLPECLDDYVAEENPVRVVDVFVDDLDLGTLGFEGLTPAVTGRP
AYHPAMLLKLYVYGYLNKVQSSRRLEREARRNVELMWLTGRLAPDHKTIADFRKDNGPAI
QAACAQFVVLCRQIGLFGAALVAIDGSKFKAVNTRDKNFTANKLKKRLEQVAEHIAGYLR
DLDTADRQEGEAAETRSERLKEKVERLREQMRWLQTMEAKVAASPDGQVSLTDPDARSMA
TTGRGSGMVGYNVQSAVETEHHLIVAHDVVMTGSDRQQLSSMAARTKDALGVETLDVLAD
RGYFSGEEILACEALGVTPYVPRPLTSGAKANGRFGKQDFVYLPEQDVYRCPSGALLPRH
MTNVENGMTLHRYWDHFSCQSCALKPQCTPSIARRVTRWEHEAVIDAMQRRMDLTPGAMR
QRRRTVEHPFGTIKAWMGSTHFLMKRLPNVKTEIGLHILAYNLKRVIAILGVGPLMKAIQ
A
>fig|192952.1.peg.355 Mobile element protein [Methanosarcina mazei Go1]
MELHSFSHGYGQITYHIVLVPKYRYSIFYNKRIKKDCELIFSNICTKNGYKIHAMEVVDN
HVHLFLEFHPSNSLSEVIQYLKGGSSYRLFKLHPDLKKQYWGGSLWSNGKFYRSVGNVTA
DTIKHYIKESQGKPSEESQLYRFMRSEQRKLDDF
>fig|196164.1.peg.502 Mobile element protein [Corynebacterium efficiens YS-314]
MHRLKTNPHHTLLLDWRYYLVEAGSAAKQPYSYSHYCQRFHAYVDAHDLYRTLHHQPGRT
MQVDWAGDTIKITDRITGQARKVHFFTAVLPYSSMMYVHPSFTMDIKAWLNCHIAALRYF
GGAPFVLVPDNDTAAIYRPKKNDPARAVSAEYEALAKFYNTAVMPTDVRAPKQKAGVERS
VQIAYSRILGVLEMEGPFHSIDQIEDIVADQVHEINYDIVRVDGTRRNEQFQAEERHLLI
PLPDQDYTSYEWKELKVQRNYHISCDKQYYSVPWKLVGSTVKARLSNTDITVFAGDQVVA
THRRLHGRFGQYSTHADHVPPAHLDTAELWSDQWFINQARLVGPATTTVIEMMINRHAHH
AHGWLDCQNILKTLGGKSRSGLEQACQELLDADLYPTYSVIKKLQSSIITNRDTHKRSVA
GSAPTPAPDLVKPQPVQDLDTGVFLRSSSAYEVDDIPSLSFDDEQEGNQ
>fig|203119.11.peg.1643 Mobile element protein [Clostridium thermocellum ATCC 27405]
MNFRPIAGIDVGKFFSEMAILSPSNEVIARMKIRHDSSTDVERAVELLKKTEKDFDSRPF
VVMESTGHYHKILFHSLYKAGFEVSVINPIQTDSIKNIGIRKVKNDKVDARKIALLYRFQ
ELKTTNIPDEDIECLRSLCRQYYKLSDELTAYKNRLMGIVDQLMLNFKDVFPNIFSKAAL
AVLEKYPAPAHILKANRNKLIALIQKNSRRSLKWATAKYELLNSKAKEFAPLSISNSSNV
AMLGVYISMIKTLEENLEKVLKAIRSLIIEDMAKDMPMLALTLELLQSIPGIGLISAVTI
LAEIGDFSAFSKPGKLVAYFGIDPSVMQSGEFTGTQNKMSKRGSRLLRRVLFTIALANIR
TKRDKTACNPVLMEYYKNKCQSKPKKVALGAVMRKLVNYIFAVLRDRKPYELRSPQEHAQ
MLAAKHTAA
>fig|203119.11.peg.2125 Mobile element protein [Clostridium thermocellum ATCC 27405]
MIKMAQLEDIRKMYFMEGLSIREINRRTGIHRDTISKYISLEEPKPPKYKLTKERTHPVL
GPYIPMIKQIIEDDKTRHRKQRHTGTKIFETLKKEGFSGGYNTVMDYLRKEYRKQREAFL
PLEFELGAYAEVDWTEAYFYLKGKETKAHLFVMKLRGSGGFYVRAYPFEKQEAFFDGHIK
CFEFMNGVPYKIAYDNLKTAVKKILEGSNREEQEQFIALRTHYLYESSFCRPAKGSDKGG
VENAGKEAVRRFFVPYPEVDSFEELNEYLHNECIKLLESNPKWEAERAALRPLPAVRFDG
ARYKEAKVNRYSMVQFETNRYSVPTIYVGEKVTVKATADEVKILNKGTMIASHPRIYGRY
QEQIKLDHYLELLLQKSRALGNTKVYKPQMLAPVYEQYRRSLNARSPRGNREFVKILMLH
RDYPTALVTEAIEIAMAYNVYSYDGVFNILGQLLVSGSPKTAPVSKDKLQGIPEVVVIPP
DLSKYSALMSGGGQ
>fig|203119.11.peg.865 integrase catalytic subunit [Clostridium thermocellum ATCC 27405]
MTQIKDIRKMYFEEGKNISQIARETGHDRKTVRAYLDKVDWNQKPPKVKKETAFPKLNPY
KDDIDTWLNEDKKARRKQRHTAKRIYNRLVEKYGERFNCSYRTVAGYVAVKKKEIFNARE
GFLPLEHVPGEAQADFGDADFYENGRHYRGKSLTLSFPHSNKGYTQLFKGENQECLFEGL
KAIFEHIGGVPPRIWFDNASTIVAKVIKGGGRNLTDDFMRFMEHYRFKAVFCNVDAGHEK
GNVENKVGYHRRNMLVPVPRFEDISEFNKELLIRCEEDAKRQHYRKNGTIEELYRDDKAA
LLELPKTTFDTSKYITVKTNGYGKFLLNKGLHEYSSAPKFANKYVLVRLTAFHVTVLDES
HREIVRHERLYGDYKQQSMQWLPYLTQLARRPGALKYTGIYQMLPQPVKEYMEELSKQDR
GKVLRVIADLTQKSSFEKAIKTVSTALSYGAADVDSLINLHRYLYEKVLQLEPIHLPEHI
PHLNRYVPDFMAYDRSLKAGEEKC
>fig|203124.6.peg.1614 Mobile element protein [Trichodesmium erythraeum IMS101]
MPSPYSYDLRQKVIKAIDGGMSKTQVSSIFKISRNTINTWLHRRRETGDIKAKTGYQKGY
NPKIPDLEQFRKFAQINGSKTQKEMADEWPDKVSDRTISKALKKIGYTRKKNLRLQRKR
>fig|207559.3.peg.69 Mobile element protein [Desulfovibrio desulfuricans G20]
MKAEEARRAFVIKQAVAGAFTVREAGEVLGLSYRQVIRLKNRYRKEGAVGLVHKGRGKAS
NRRIAQEIRKFVAEKAKSDFEGASCQHMEELFASRYGLELSAKSIGRILKEQGVACAHRH
RSPKGRRCRERSRRRGDLVQMDASPFDWLGDGVMRSLHGAIDDATGEVVGLWIEKNECLS
GYLRVLRQMLERHGVPRAIYADRHTIFVSPKTGKLTIEEELQGKVAPQTQFGRVLETLGV
RFIAARSPQAKGRIERLWRTLQSRLVIAFRLAGIRTVEAANDFLGTYAEQMHNPKFAGAP
AEAQNAFLPVVEGTNLDLLLARHEQRKACGDSTVAFGGQKYRLQDSRGRTRLLRRGKAVT
VVEKLDDELMALADGEAFVLVPVVTGKSSEEPASEEKSLARGAQEREQTSPAAESSWHWY
LHPREPIARAIHNPQETTPGTW
>fig|212717.8.peg.330 Mobile element protein [Clostridium tetani E88]
MVLVIKYRKNVIDDQVSNRLKEIFEYICPKYNIVLEEWNHDLDHVHLLFRGSPNTDISKF
INAYKSASSRLIKKEFPKIKNQLWKEYFWSRSYCLITTGGVPIDIVKKYIENQGMK
>fig|216596.11.peg.3927 Mobile element protein [Rhizobium leguminosarum bv. viciae 3841]
MTIPSFETIKRWQLIEDWPHRASVDAVITSMIDKGYSSETMVRAVRFIGAFIEYQNNRDG
GEPERLDAGDIDQFIASRLSSGAIANGNRIALRRLQIELVRAGVLCPPAEKADPSEKVAT
LYGAELFRRGYSKQSITGHVWLARRFLRTVFFEQGDISHLTHIEVRADLTNNFEGRKSTS
LGTWFSHLRVLLRFLHATGLTEHDLSAAVPSPRNLRFSALPAYMSVSQLNSVLEACDLST
IPGRRDLAVLLLLSKLGLRASEVALLSLDDIDWRSGLLRVNGKGGRVATMPLPKDVGAAI
SDYILHGRPTSGSRIIFHRVQTPCTPFETATPVILVARRALKRAKISGTRSHHAHIFRHT
FATIAIDALEQYLTLRRSLGFKLQTQESRLRNFVRYATARGELRVTAKTAVDWANHQCGP
ATWSSRLSTVRAFARHLQVVDPQTEIPPSHIFPPQRRPRPFIYSDEQIADLLKSMLDMHP
GSFRGPTYHYFFGLLASSGLRFSEAARLLREDVDLEAGMLTIRETKFGKTRIVPLHPSTT
LALRRYASIRDDHAVRRVSKYFFTGDLGRALIHANPHFSFILWTRQTGLRQPDERDGPRI
HDLRHSFAVRTLLSWYRDCEDIERRLPELSTYLGHNHVSATYWYLTAHPNLLDQARLRLD
ARWEMAE
>fig|219305.4.peg.9 Mobile element protein [Micromonospora sp. ATCC 39149]
MDFCHLVGKPVDAAEALAAADDELHTALADLETQLAKGNPGEVRLTDDGELIIPPLTAED
VPAEADALRGELAGMLPRVPIASVLVEVDARTGFTDHLVHAGGKVARPAELKRNLLYVII
AEATNMGLSAMAESCGVPYDVLAWTAEWYFRPETLEAANAAVVNYHHRLPLTRAFGSGTL
SSSDGQRFPVKGKSITARHLSRYFARGQGVSTYTHVSDQHSTFDTKVIVATAPESHYVLD
GLLGNATDLPTFEHATDTHGATLANFALFDLVGKQLSPRIRDLGKITLYRTGPRADFLDR
YPRAGALLTRRLNLDLITSMWDDLLRVAASVQGGHATAALVVGKLCSSKRQQNALTSAIK
EYGALRRTVYATRYLADETYRRRIARQLNKGENLHALRRSLAYAGEAALRRRHHKQQTEQ
MWCLTLATNAIVCWSTEYHGLAVGALRRDGRQVDDEVLAHIWPTHHENVHFC
>fig|224911.1.peg.8200 Mobile element protein [Bradyrhizobium japonicum USDA 110]
MLVVETIARIRREHFIKGKTIKEIARDLKVSRNTVRKVLRSGETSFEYERQVQPRPKLGR
WAVELDGLLAANAAKSAREQLTLIRIFEELRGRGYDGGYDAVRRYARRWSKERGQSTAAA
YVPLSFAPGEAYQFDWSHEVVLLSGTTVVVKVAHVRLCHSRMLFARAYPRETQEMVFDAH
DRAFALFKGTCTRGIYDNMKTAVETIFVGKGRLYNRRFLQMCSHYLVDPVACTPASGWEK
GQVENQVGLVRERFFTPRLRFKNLDELNAWLLDKCITYAKAHRHPELVDQTIWDVFEVER
PRLVPYAGRFDGFHAVTASVSKTCLVRFDNNKYSVAASAVGRPVEVQAYADRIVIRQDGR
IVAEHQRSFGRGDTVYDPWHYVPVLARNPGALRNGAPFKDWVLPAAIERIRRKLASIDDG
NRQMVDILNAVLTDGLPAVEAACAEALSHSVHSADVVLNILARQREPAPPANIMTPAALT
LRHAPIADCARYDNLRRTN
>fig|232721.5.peg.875 Mobile element protein [Acidovorax sp. JS42]
MDMIGRIRHLHARKNKSEREISRMTGLSRNTVAKWLHGEVDGPPKYRRGEQPNKLTAFHD
VLRQALKADARRPKHERRTAKALYAEIRRAGYEGGYTRVTDFIRAWRQGEGQGSAGNAFV
PLAFELGEAFQFDWSEEGMVIGGIYYRVQVSHMKLCASRAFWLVAYPSQGHEMLFDAHTR
SFAALGGVARRGIYDNMKTAVDKVKKGKGRIVNERFATMCAHYLYDPDFCNVASGWEKGV
VEKNVQDSRRRIWIDAAKIKFGSFTELNAWLAQRCRALWDEVRHPEHTQFSVAEMLEHER
AHLMPMPVPFDGYVEKPARVTSTCLVSVARNRYSVPCERVGQMVSTRLYPGSVAIVADDT
IVARHDRLSNAGETRYDWQHYIPLLQRKPGALRNGAPFADMPEPLQRLRRGLLRNPGGDR
VMAQVLAIVLSAGLDAVLVAIELALESGPPGKVSVEHVVNVLNRLNAQPVPPTAATLLRA
TTPPLANTARYDSLRSDTVGAITEGADHED
>fig|233412.1.peg.245 Mobile element protein [Haemophilus ducreyi 35000HP]
MFTLHLRKENKKIDRLDYRLKENKSPNKRCVMVAREHFSAEEKAENQFNRGAKRSHVFVT
YSESQPVVKDFSNRFIVRESRINTDESTAYESLLLDYDLRTVNHKEEYRSDLGITNNQAE
SFFSRFKRMYYGHVHKMSNLYLLNYANEIAYREDNRRKANGWQSQDILGKCLTTTNENNE
WCGYWQRKIVHQEVIWQ
>fig|235909.3.peg.733 Mobile element protein [Geobacillus kaustophilus HTA426]
MKPKERFSIIQELSNTYPIAWLCQLAGVSRSGYYRWMNQQGIVTEKQKENEQIKQMILEC
HQKVNGIYGYYRVKAWIKRNYGKTVNHKRVYRLMKELGVQAKIRRKKPKYKAGKENIVAS
NVLNRDFVATAANQKWVTDITYVPFQGTYLYLSAIKDLYNNEIIAYRISRSNDLKLVIET
VKDAIKKRDARGVLLHSDQGSQYTSRQYHQLLKAHHIIPSMSRRGNCLDNACMENFFGHL
KSEMVDLPTFETEEEMIEAIDQYMYFYNYERCQKKLDYLSPVEYRIAQAA
>fig|243230.1.peg.60 Mobile element protein [Deinococcus radiodurans R1]
MVGERSVWCGTVLSISWMPYGGNPNSSWRSWRCSSRLFARQERLKVKLSPTELMAILQYV
LSAVPLRKTQRNFLTVLLSVFLAVPGQLNALNLSRYAACSESTIRRWLHRSDDGAIPWGA
LHQATVSTAIESGLISPLCVLAIDASFHRKAGQHTAHLGSFWNGCAARTERGIEQSCCTL
IDVQHRQALTVDVRQTLTGSEAPTRLEQTADQLDDVLLDLRTVQQLDLAAVVADGNYAKE
PIVETVTGHGLPFISRLPRNANLNDLYTGEHPRRRGRKKKFDGKVDFSDLQRFDLVSARP
TERVWTQVVWSVQWAREVRAVVIQQIGKKGQVTGYAVLFSTAVTMPAHEVMALYRSRFEI
ELIFRDAKQFLGGQDVQLRSQQGIEAHWNVVLLTLNLCRLEALRAAGGGQDLVFSLEDMK
RRAYNALLAQVILSNLDLSARFEE
>fig|246196.19.peg.1298 Mobile element protein [Mycobacterium smegmatis str. MC2 155]
MSSAVFDDAHLVSCAGLVPVMTLAAQTGLPKLLADKISIPAPKIKSGSANPSPKLTTVIA
GMCVGADSIDDLDLVRGGGMKTLFGGVYAPSTVGTLLREFTFGHARQLESVLRHHLAALC
ARVDLLPGSDTGAFIDIDSLLRPVYGHAKQGASYGHTKIAGKQVLRKGLSPLATTISTPG
AAPVIAGMRLRAGKTSSGKGAGRMVAQAIATARAAGVRGQLLVRGDSSYGTRSVVGACRA
HNAHFSVVMTRNTAVDRAISSIDEQAWEPVNYPGAVRDPDTGDWISDAEVAEVSYTAFAS
TKDRFTARLVVRRVKDARFRDALFPVWRYHPFFTNTDLPTAEADITHRQHAIIETVFADL
IDGPLAHMPSGQFGANSAWVLCAAIAHNLLRAAGVLAGGAHVVARGATLRRKIVNIPARL
ARPQRRPILHLPEHWPWTEHWLTLWRNTIGYSPPLPATT
>fig|266779.9.peg.307 Mobile element protein [Chelativorans sp. BNC1]
MAKRTLLKVQDRQELFCIPTDDDSLIRHYSLSPADRLEIELRRRKHNQLGFALQLCLMRH
PGRPLMPNETPPGAMLNYVAEQIDADPRLFDLYARREETRRDHIAHLLGYLEMRSPTADD
RRTALMAAIDAASTTDKGAVIAKAIIATFRERRVLLPAVNMIERMGLAARAVARRRAEHA
LISDLDPEKLETLDALLNIDPAIGQTRFHWLRSAPDAPGAGNLVGLTERIAFLRSLGIDP
RLQARIPSGRWEQMVREGDATPAWLASDFNASRRRATIVAQVIKLGQKLTDDAVMMFIKL
MGRLFSQANNRKKQRHMNARIETSRALRLFLDTIVALQAANDNDVDPMTILDRRVGWHRL
LQIKPSLEAMVENGDMSPLVLAAEQHGNIRKFAGAFLQAFTFRSRRRHDPLLAAVATLKM
LYVEGRRVLPDRVPVGHLGANERKLVFEDGKPDRRLYEIATFAHLRDRLHSRDVWVEGSR
SFRPIDEDLMPKPTFVALKGQDQLGLGVPSDCAIWLAEVGQMMDFNLKRLAWRARFGKLD
GVRMENGTLTVTPHTSDVPAAAEALNAEITDMYPLVEVPDLLREVHEWTGFADQFTHVRT
GDAPQNIAAILAGVLADGTNLGPKRMAGASKGISAHQIGWMRSFHARSETYRAAQACVTD
AHTRHPHAQIWGDGTTASSDGQFFRASDRAARRSDINLHYGSEPGSKFYSGLSDQYGYYS
ILPISPTESEAVYVLDGLFDHDTILEIEELFTDTGGASDHVFALFCLIGRRFAPRLRNIK
DRKFHTFEKADAYPTLANHIGAPINTALIMEHWDELLRLAASITTRTVAPSAILKRLSAS
SKSSDLAKALRELGRIERTLFMIEWYSSPALRRRCQAGLNKGEAAHKLKRAVFFHERGEI
RDRSFDSQAFRASGLNLVVSAIVHWNTVYLSRATAHLRQRGRNIPDGLLKHVSPLSWEHI
NLTGIYSWDTEQQLSEGFRPLRLPGRMLRAA
>fig|266834.1.peg.536 Mobile element protein [Sinorhizobium meliloti 1021]
MTKTEGKTASAAVKDILLSNPDGLREVIRTVMQEVLEAEMDEALGAAKGERTPERLGYRS
GHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKA
ITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLILDARYEKVREAGVVMSQA
VLIAVGIDWDGRRQILSVEMAGRESRSAWKDFLVRLKGRGLKGVELVVSDDHAGLVAAIG
EVIPEAAWQRCYVHFLRNALDHLPRKHGDDCLQELRWLYDRRDLDEAKADLAAWLGKWSV
RYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLNEEIRRRTYVVRIFPNTESCP
TPRPRARRRNPRKLDGGQSLHQHGRPARAQETRTPSSRMTSTHDRPICRT
>fig|267671.1.peg.255 Mobile element protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
MNRSIGSQSFRIAKSILNKGVQVIVLNPGNLATIYQSLKKTDKEDSLKIARLIQRHPIEE
LPTVPIPNDEEEDNRRLCSEHENWTKQLTQGKNRLHSLFTQAGLTQITKKHLRTKVSREA
SVTLLSDRYKKEAERILKVLDLVELNLKLIEEEIQEALKKNKAYVQTIMSMPGIGMITSL
AIKANSISHSLWVVR
>fig|272623.1.peg.94 Mobile element protein [Lactococcus lactis subsp. lactis Il1403]
MAQTIQTLALNVRLSCQLLDVPESSYYERINRHPSKTQLRRQYLSLKISQLFNANRGIYG
APKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKPGYSLSDHINRKNLIQTEPTKK
NKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGKRMTVELVQRTLNKAIKSQDYPE
AVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPYHNASLESWHGHLKREWVYQFKYK
NFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEKVSA
>fig|272624.3.peg.1026 Mobile element protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MASCEWIINESKEANFGDKRLDKRYGDILSGLLSSPNASIPTTFQSWNETLAAYRFFNHV
NVNPESILLPHSEATLERIKAEKIVLIPQDTTEVDFTGRKSLSGMGYLSNERSRGLYLHP
SIAFTPERVCLGVVEMQHWIRKEIGTRNSRKGKSIEEKETYCWLKGYNAANKIALAVPDT
MVVSISDREGDIYEVLEKLPSEENKAYWLIRCQHDRAVLNEETNQFELLLKKEVSKACVL
GTIEFEIPAGTSYRNCKKRHTRKARSVRQEIRICSVSLRPPRRKSKKLNVIEIQVVHCKE
INTPEGEQPVEWFLITSVPIKTLDRAVEIVNWYLCRWLIEMYIKILKSGCKIEELRFETY
EATLNCIAFYMIVAWRVFYLTMLGRTCPDIDCTTVFEDNEWQATYAMATKKKPPKKPPKL
YEIILMIAKFGGHLGRGSDGFPGTKVMWIGLQRMKDFTLAWETFHTLS
>fig|272633.1.peg.219 Mobile element protein [Mycoplasma penetrans HF-2]
MGIFIISLIGGIMKKINKIRMIDKIKELLKNQQVVNIKALSRDLQIDRKTVRKYLRILSN
NPELKSCDFKRKYKKPSKNFLSQIEHIIEERIESYKEKTNGTKPSIFSIYEHLLDYLPSK
LEISKTEFKNKISYSTFKSFLKENYDYSSRAITPPKKIIKETYPGKILEIDWAENIVIHT
KEDGKLKINILVTKFSYSRYMKLFVSYEKSSQTVLKFLVSALAEFQGSPLYLVCDNMKSI
ISKNQNYLNKKPILEKHWNDFERDFGIEIIPCDPASPEQKAKVESAVRIAKKIKAWTGVI
ENKNHLIEIVKNIESKYNNSENGVGFKPIQSFLKQELHTLQPLPNKKIIEGYLNSKETRM
VKNDYKIAFLSNFYYLPPLYLNEYVQIYQDDSNVYIEHNGTIIATYENSLKVAKHSFTTT
EIHSEILKYEFLKRGDNISEEVIRKMAKETVESLDLQYKLKVFNQKNQET
>fig|272942.6.peg.977 Mobile element protein [Rhodobacter capsulatus SB1003]
MAKVEHTSDARVLVGIDISKHRHEVLIAVPGKTRRRRMTVLNTAEDYRRLIAALLDYGLP
VTIGFEATGNYHRALMFALGAAGFDLKLVSSVALARTREALHNSWDKNDPKDAQVILRML
EIGAVQVFHDPLVVGTCDIQELSKTYEMVARSKTELWHRILTHYLPLYFPEADRFHRSSR
GDWFLALLEAFPSPYMITAMDKDAFIEAAWPVIGRRVAKAALLADIYETSKTSVGLPVAP
DSDAIRMFRLVLAQGRSLVQQRNAIEDRATELLADHPDYQLLRTIPGIGPVNALAVLAEA
GDLRRFRHHRQFLKFCGMDLATVQSGVFRGRSKISKYGNARLRRTLWLASQAAVLKPANS
FRDKFERYIAQDRHNPDLRRKAYTVARDQLPDGR
>fig|273116.1.peg.468 Mobile element protein [Thermoplasma volcanium GSS1]
MKRANAVKLTVDKKTHEKLKELAVVTAKCWNEVNWLRMQQFKKGERVDFSKTEKEVYEKY
KQILKVNTQQVARKNAESWRSFFSLVEEKKGKLPKWFKPRPPGYWKDKSGKYKMLIIIRN
DRYEIDEEKRIIYLKDFKLSLSFNGKLKWRGKQGRLEIIYNEARRSWYAYIPVEVQNDVK
AEDKLKASIDIGIVNSATVYVEDGSWYIFKGGSVLSQYEYYSKRISVAQKTLARHKQGGS
REMKLLHEKRKRFLKHALNSMVRKIMEELKKKDVGAVFTAMIAYIALMMIQDMLS
>fig|288000.5.peg.206 Mobile element protein [Bradyrhizobium sp. BTAi1]
MTASTARNLVAAVRPALRISARSVWSDQVWHLDGHRPGSNRSDFSLDWGFVLADDSRFSD
PRWADWREAAKLFLWSLKLDPPPGYRNAHESTIVSVFNRLRMLIRWMAAQGYRCFADLDR
DACDRFMTVMAQRPGHKPGSTLKSTTLGNHANLLTRLYLQGAKFPEIAIADPFPGIAPPF
VRRDRGWLPYTPDAIAVPLVSAALRLIGTPADDVIALQAQAQSVYDHALANGISQTKAGF
IVTDAIAPFTFATLPGEETAWHEAPVTSTKQVRNLADRIYDACFVVVSYLVGARISEILG
LQVGCIEQHPADDGSESFAYLVGRIYKTARGIDGEAHRWVAPAPVERAVVVMERLTARLR
AQSGRDDLFLAMASNGLIGPAARINLPVGSTIIRRLNDLFALFIGLPDHEGEPWHLNTHQ
GRKTFARFVGKRDRTGLYALQAHFGHVTRAMTDRGYVGTDFALDDLIDRHAREETRAALE
EVLTATALAGKGGRMIAARSQFRGRTRDGDVQAYVSFLMEETDLRLGVCDWGYCVYRVET
AACFGDEKGPNPVLRTESTCLACANFAVTARHRPVWQARRDRNTDLLGHPGLDPVSRQLA
ETRIAECDRILGELDHAKDVRHGA
>fig|289376.4.peg.826 Mobile element protein [Thermodesulfovibrio yellowstonii DSM 11347]
MKESCKALGLSRSRYYSFVKSREAEKPKRIKNVLELVLKIKAIKAEHPFWGYRRVTAWLR
HREGVFVNHKTVRKIMKEHGLLVSQIVHRAKRKSEGRKPRANRPKEIWGIDMTKFMIPCI
GWAYLIVVLDWYTKKIVGLEVSLRARTAEWMAALDKALQAEFQDRIRGSGLKLVSDNGSQ
PTSRAFMREMAVLGVEQIFTSYDNPKGNADTERVIRTIKEELIWLNEFRSLDEAREMIED
WITNCYNRLYVHSALGYLSPEEYELKYYMEQKRNVA
>fig|290402.34.peg.718 Mobile element protein [Clostridium beijerincki beijerinckii NCIMB 8052]
MSNFFYSPVIGIDVSADFSYTAILAPNGDIYKKSFKIKHDLNGFNHLVNEIKKVEEEFNM
KTAIFMESTGVYHLSLFHYLNKYFDNTFVINPLVTKSNKNGDIRKVKNDKKDALSIATIG
KFQNIKLSQQLSLDIFLLKNLVREYYKLTDTSSTFKKKLSADLRVIFPGYNTIFSDSTSK
SSIELLSQYPTPQSILEAPKENIIKIFLDSSKKGIIWSENTYSKLFKVANEAKIIGLPLD
GLAVKIASSITLIKTIQSEIDILLQKINNFIQSETFPESIRANIELIDSIPGIGQLTAIT
IIAEIGDIDGFLKPKHLVAFFGIDSSVNQSGNFKGDDNKISKRGTRIGRRALYSVALASI
RNNRNGVPINKVLLDYYQINLKGKKPKIALVAIMHKIINYIFAVLRNQTPFEQRDPKIHK
QMFLENNSLNKVA
>fig|293826.4.peg.729 Mobile element protein [Alkaliphilus metalliredigens QYMF]
MPREAREKSKTGIYHVMVRGINQQDIFEDDDDRQRYLETITRYKNELDFEVYAYCLMNNH
VHLLIQEKEAELSKIFKKIGTSYVHYFNWKYERNGHLFQDRYKSEVVETDSYLHTVIRYI
HQNPVKAKISGINEYKWSSYNDYIEGHGISDVEFYLEMLGKEKDMATRRYIHYMNELSDD
QCLEIVNTLRISDEKARERIKEIGNLKNISDLQKLEKDMRNKILGKTKEIEGISILQISR
ITGITRQVIKKSQQ
>fig|314230.4.peg.1249 Mobile element protein [Blastopirellula marina DSM 3645]
MIAPPSLPDSPEEQFVAARTLLSEILRVPQIEAIVDFDDRPNTKMVYTQAVTIWLLILQR
LRGGASLQTVVSEAVEHQADLFPDNKRVHEGTLGENTSSFSAARKRLPLDAIERFSRCVC
DHLGRTVEPVFDDRRVFIIDGTTITLPPTPVLKKAFPPATNQLGETVWPVAMLMVAAEMQ
TGCILVPKIDPMYGPNNSSEAKQAREIVGDLPSRSIVLADSCFGIFSVAHHTRAAGHDFL
FRLSMLRLKAHRKKAELIDQGEGYKSCRLTWRPSAKERNTNPDLPADASLDVFLHEVELE
DGATLALVTSMSFDALCLAELYRRRYDIEFDIRDLKVTMDTENLRAKSVEMVMKELMGSV
IAYNLVSQLRRGAAKLARVEPRRLSFTGVWVSFQVQLLGRSCETFEQWSKAFTKALVSAS
KRRLPNRKSPRSYPRVAHPRRAKTTKFQKSLRKKTKSPDPPPPE
>fig|314285.4.peg.2108 Mobile element protein [Congregibacter litoralis KT71]
MRVIIMVDTYAEDFLPQGHRLQILTPEEYELLWGFPTLTATERELFFSTNRREQTVFELA
RTPRTRLHFRLLLGYFKARQRFFVVDEDAMGDDIRYLAELLDVRSFDIQVSKHTRQLHVS
WILELFGYSLLDDRARLDLETRALEAARISSRPVYVLRDLVDYLRQQRIVLPGYTYLQDV
VRRALVFERDRLSDALAKALSADDRRRLDALLRDDEGLHAITSIKHPLRDFSHRQLLNEI
DRGERLQGLYGVAQRVIGDANLSVESVRFYASLVDYYTVYKLKRMKRQMTRLYLLCFVRD
RYQRLHDHLIAAFCSLLRCYVDEVNETAKEAFLRYRREANDDLDQGAKLLHLFIDPEIQD
AMPFGEVRAAAAELLPADRIARLCDYLVGEQSLDEAQFEWDAVDALMPKVKRNLRPLIRF
LRWSSPAPQHNLIESCHHLADAFVMGHQVPSNCDLSWVPDRHRRYVMPQGVLHRDRYEFL
LYRVLRDRIEAGDVYCTDSARYRSFEDDLVDAATWAHRDTLLPKALPSVTPISSQLAELK
DTLSSRFDAVNERIRRGENSFVHLRDGQVQWNRTQGADPDSSHEPLFDTAERIDIDQLLL
YVDRKTGFLSAFEHVMGRYQRERASPPLTIAALMAFATNIGVGRMAEISNLTRAQLSGTA
TNFLRLETLKEANDRIANATARQPIFKHYDIGDTVHSSSDGQKFESAIPTVNSRHSSKYF
GLKKGVVAYTLLASHVPLSARIIGANEHESHYVFDVLFNNLTDIQPDTHSTDTHGTNQVN
FALLHLFGYRFAPRYRDFRRKAQTGLYAFKPPNAYAGCAIKPVRRIKESLIESEWENIER
ILLSLALKTTSQSVIVSKLSSHRRQNRTKQALWEFEHIIRSLYLLDYVDSPLLRRNVHRA
LNRGEAYHRLRRAIAYAHGGRFRVRSQHEQELWNECTRLIANAVVYYNSEILSELLQTLV
DQSDHGAIDTLQRVTPLAWQHINFYGRYRFDEDLRPVNLAQMAKNLAKTDARSWGMTA
>fig|323097.3.peg.1006 Mobile element protein [Nitrobacter hamburgensis X14]
MPHPLSNDLRERVVAYVEAGNSCHGAAARFGTSVSFAVKLMRRWRETGRVDPRPRGGFRH
GKLGQHRDFILATVAAESDITMPELAEKLAKAKGVKADPSNLSKFLIACGLSFKKNSAGQ
RTRQA
>fig|329726.14.peg.6393 Mobile element protein [Acaryochloris marina MBIC11017]
MHKIPVTVVTGFLGSGKTTLVRHLLQNNQGRRIAVLVNEFGEVGIDGELLRSCQVCNDEE
TPNGSGPNIVELANGCLCCTVQEEFLPTMQELLKRRDEIDCIVIETSGLALPKPLVQAFR
RPEIRTGATVDGVVTVVDGDALAQGRIVSNLDALNTQRQADDSLEHETPIEELFEDQLAC
ADMVLLAKTDVIQGEDTCSRIQQWLQQQTPSGVKVVPCHHGQISPDILLGFNAAVEDNLD
SRPSHHDQEEDHDHDDNINSICVELEQTFDPNTLIERLQVLVQQQEIYRIKGFVAVPNKA
MRLVLHGVGQRFDQFYDRLWQTSEPRLTQLVFIGQGLDSHHITEAISA
>fig|329726.14.peg.7469 Mobile element protein [Acaryochloris marina MBIC11017]
MSMRPTDLLDIPSETIEVARAAFPDGNLYMQLRDELGIIYHDHDFADLFPKKGQPALSPW
QLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLRDSGFNYSVLSEFRKRLIAGDKE
QQLFDSFLEHLQAKGFLKEHHQQRTDATHILASIRTLNRLELFGETFRAALNSLVVADPQ
WLSEHMHDDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGLTLLDAIYAPSSPPWLKHL
PAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDSSIHSPYDVEARYSNKRSMDWVGYK
VHLTEVCDPESPRLITHVHTTSATVPDDQVVEPIHLALAKKQLLPKEHLLDGGYLSAEHL
VNSKAEYDMDVIGPVRQNHSWQAKAGNGFDSSFFLISWDQQKVVCPQGHFSTKWLPGKDI
HGKDVIQARFQGTTCRSCPVRSQCTKSKTQPRELTFRPRELHQALNERRQVQRTTEFKEK
YSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVFCAIALNFVRLDAWFNDVPLAKTR
VSLFKRILQPLPA
>fig|334380.3.peg.60 Mobile element protein [Orientia tsutsugamushi str. Ikeda]
MNSIIVGIDVSKETFDAAVLINNKVQTRKFNNNSEGFNKLVTWLKSRGTGHVCMEATGIY
WKNLAKYLYDYGYKVSVVNPARIKGFAMSKLSRTKTDKADSVLIADFCKAMKPEAWYPQP
LYIQELQQLVNRLNVLIKHKTQETNRLEGASKAIANNIQMHIEFLETQIKEIEQLINDHI
KNNKDLHNKAMLLESIPGIGAKTQAVVLAFLADIEKFSSAKQVVAFVGLNPKHRQSGSSV
RGASRISRTGNSDLRKSFYMPAMSALRHNCIIKQFSQRLSDTGKPKMLILIAAMRKLLHI
IYGVLKHNSPFNPNVLINQK
>fig|334390.3.peg.1279 Mobile element protein [Lactobacillus fermentum IFO 3956]
MTHLNDITTDTNVSTRSKGSHLTIDDRVKISVLKELEYSNRMIAQYIGVAHGTIDREIKR
GMVTKMSKQSNNGKVYCYYKEYYDPYTAQERCEKSRPNCGRTPIYQSSPEIINLLDDLML
GEFDFKDHDKFESLDSQKCSPYATLKIAESLVNDDVKLPASERPIYNWIDKGLLRTKNID
LLEKTRRTKAKHGRTPKREQPGKNISQRPKEVETHTTFGHWEMDTVQGKKSAEDPVILVL
AERLTRYNLAFKITSKTPNAVSRVITKLKELTGDYFDEIFKTITPDNGSEFFEVANEVDQ
VYYADAYSPWQRGTNENNNRLLRRSITKGTSLQLFSEFDVGQANLRLNSYPRKILGSKSS
LDRFEEEILKIIDPETLAV
>fig|334390.3.peg.50 Mobile element protein [Lactobacillus fermentum IFO 3956]
MCPQNQKILSTNHHYGNPSTRFSVEPFFYFVLHFNCKFAVADDNDIVIEKMEVMPDHIHM
LISFPPSKAPASAIKALKGRSAYIFLQNHPEIRCSQYWGGHLWSPSYYMSTLGNMSKEVV
EKYINDQKYTETNKKPHKGAQ
>fig|335541.4.peg.409 Mobile element protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
MCKFYNVSRRGFYDFRKRQQGENPDQELINLISECHKKHKRRYGYRRLTLWLKQEKNLVV
NKKKVLRITSRNNLLSAIRRRKVTKFKPNGNLKYENVLNREFYSEIPNEKWVTDISYIIM
PDGTAYLSAIRDLCGNFIVAYRTAKKQDYSIVKNTISNAIQAEKPQKPPLLHSDGGGQYR
SFDYREQTTEHGITPSMSKPSTPGDNACAENFFSIFKTECIYLEKPKTLDEALKLTDEFV
HYYNYERIQGNGLTPYEERQIAFVKQKADI
>fig|338187.4.peg.612 Mobile element protein [Vibrio harveyi ATCC BAA-1116]
MKIPSSISCLRVFFMLAHWLIDVDDFASPDSLALFQKELPLEWINQALDETNKASMRRRK
LPAELVVWLLVGIGLYRDRPITDVLEKLDLKLSNSLGESIAPSAIPQARKRLTAGPLKAL
FTMTAQHWTKSEDSEDKWFGLRLFSVDGTQFRTHDNKALANHYQYVKHSKSRHTEYPVVR
LCALCSLRSRLLHDVAFGPSSTGEVSYAKQLISSTMPNSLTIFDRCYLSAELMINWQRQH
NSSHWMTPIKSNTQYEVIKKLDKEGRDLIVEMDVSQHARKQDPSLPDKWQARLALYPEPE
QPNHIKGVLTSLTDSQYDLQSLLDVYFERWEVENSYGEIKHDMLEDELLLRSQSVEGIEQ
EVWGILIAYNLVRVEISRIAKEAKVSPLRISFMMALRDIQDELMWCAIASPGSIPKKLRA
MRERVKRYILPERKKRPKSRTVRMSKTRYPVRSKHVK
>fig|358681.3.peg.2135 Mobile element protein [Brevibacillus brevis NBRC 100599]
MVTNLESGGLQNKHIVVDELRDKRSVQELCACLGISRSGYYAYVKRKDNDPDEHLKRKIR
SIYEERDKTVGYRRVQDELYRQYNLKVNHKKVLRLMQELGMQAIIRRKYIHRTSYETAVS
DGRITENLLQRNFTAEGPNQKWVTDVTQFRVFDHRIYLSAIKDLWNNEIVAYHLSQRNDN
PLVLETFKKAFEKQKDVAGLIVHSDQGYQYTSHAYHDMLPKVGAQISMSRRGNCYDNASM
ESFFSHLKVEALYPYDIRSIEEAQRRIEEFILFYNEKRAQRKLNKLTPVEYRRQLIA
>fig|362242.7.peg.32 Mobile element protein [Mycobacterium ulcerans Agy99]
MSSVPEVFDRWSAGERSELIGSEFLDVLASVPDPRDPRGRRYSLMALLAIAVLATAAGMR
GYAGFATWAATASDDVLAQVGVRFRRPSEKTFRAVLSRLDPADLNARMGSYFTAHVASSD
PSGLVPIALDGKMLRGALRAKATATHLVSVFAHRARLVLGQLAVAEKSNEIPCVCALLTL
LPDNLRWLVTVDAMHTQVVTAKLICATLKSHYLMIVKSNQAKILARITALPWAEVPAAAT
DDSRGHGRVKTRTLQIITTARGIGFPYAKQIIRITRER
>fig|373994.3.peg.5283 Mobile element protein [Rivularia sp. PCC 7116]
MARSKTPSFVTEISLKVDSKQEKELSSRFQAARQLYNACLNEALVRMNLVKNSELYQQAK
KLRGGDKKKRQDLFNKARETHRLSDYALKTFATQTANRSKWISSNLGAHEKQTIGTRAFK
AVDRILFGQAKKVRFKVTTRFKSVEGQSNATGIRFINNQVLWKKLILNPIIDWNNPVIVH
GLNSPIKYCRILWRNLNGKKRWFIQLINEGLPYQKPQNYVIKGIVGLDVNIAAVAFVADK
KAGLLPFAEKVPTFEREIKALQRKMQRSQRMHNPDNFEPDFDKKVGNRIVRKKGKVKKGK
KQWIKTKNYRRIQVRKAELERRKASYAKSQNRKLVNEILRHGNQIKTERVSIKGWQKIYG
KAISAKSPGYFQSELKRKAENAGGYFLTFSTQTTALSQTHLDGTRIKKKLSERVHRDVTG
IQPMHRDLFSAFLSRCVYNNKLSLWDAQCEYPGTEPFLLDGWQQSQSANRVAERESRNSY
SSSEQMSNEALTSNQISQKDYKLEGNA
>fig|377629.3.peg.1219 Mobile element protein [Teredinibacter turnerae T7901]
MCRLYGVSRHGYNSWRRRGESRRKREDSEIYSLINRIFQKHQGCYGSPKITQELRKQGVN
VGQKRVARLMQEHGLKAVKARMYRTKAYQHVFQKASPNRIKDFTPTGINQLWVADVTYIR
MPDESWQYLSVIMDRYSRRIISWSLGENRTAELTSNTLARAMRNRKGAKNVILHSDKGIE
YIATSFRRKLHHYGIQQSMNGVKQMNDNAHIESFFQDFKTERIKRKAFNTVDELRGIISE
YMRYYNHERSHSVIGYISPAKFESRIAV
>fig|379066.3.peg.3586 Mobile element protein [Gemmatimonas aurantiaca T-27]
MAIWQDLVDQHGFDGRYASVRRFVGRRRVTSPEPAGIIETAPGEEAQVDYGEGPMVRDPV
SGKYKRTRLFVLTLGYSRKSVRLLTWRSSSQRWAALHEEAFRRLGGTPRVIVLDNLREGV
LTPDVYDAQLNPLYRDVLAHYGVVALPGRVRDPDRKGKVESGIGHTQRTPLKGLRFETLD
AAQAYLDQWELRWADTRIHGTTKRQVSVMFSEERPQLQSLPLELFRYYRHGTRVVHLDGC
VEVEAAYYSVPPGWIGQQVVVQWDDLHVRVLDPKTSGLLREHLRTRRGHHRVADADRPTR
TPAKTLALLDVARKAGPSISAVCEHIHRTEGVLAPRRILGVLALARKHGPALTEDAAHFA
LEAGAPSYRFLRRYLERVKLPATALKQIDPLIRHLTDYRALIEQRAAAS
>fig|380394.3.peg.310 Mobile element protein [Acidithiobacillus ferrooxidans ATCC 53993]
MMEVLIKRPTTLARYLGAPLAEERDNFLKHCAQVGYSPSMLKKISWVIWAVAEYIGIDHG
KVTMQDIRIAVDHRTRFKRQSTQTKESKSTRQMFIHFATEWARHMGCLGQAAKPQDSFAV
QIGIFARHMREERGLSPVTIATRCERLGWFFAGLNPPRGTLDAITICDLDAFVELKGQQG
WTRASLGSLASSLRSFFAFAEARGWCAKGLTATIESPRLYTREGIPEGPGWEDVQRLLVS
TAGDHPVDIRDRAILMLLALYGLRRGEVAALQLEHLDWDGDKICVVRPKQRIAQRYPLLP
SVGEAIVRYLRDVRPQCEHRALFLTIGAPMRPLSAESISHVARARLNQLGLTLSPRGAHC
LRHACASHLLSSGFSLKQIGDHLGHRNANSALSYTKVDLTGLRQVAEFDLGGLL
>fig|380749.4.peg.94 Mobile element protein [Hydrogenobaculum sp. Y04AAS1]
MKKNNKQSLVQNTELRTFSIRIKSDKLEKKLKNILFTYKHFENILLILINQNYNLYKDGK
DTNDFNLLTSPQLMRNALYDYNSKHSAQIEYLKNKYKDNQLWNELKETAKKLKSHNLTHI
IKRVKASFNTYFTSLELYKQNPSLFQGMPKPPKPKKLSKLTNYAVELDKYCSLSFARLEK
ENLVGINLSDRMVYIHVDKEQVKKLTDINKLYSARVVYDNGDLYLQISYLKELNKTEKDK
IKYAGIDIGINNLITVFIDDKSTPSLIVDGKPFKHYNAKFNRLVAKLNESKSKEVLEWGV
SKTGTKYPVKYTEKGKRIGKFISFLYSKRNRFFTDQFHKMAKRVVEYLHLHGVSELFISK
NLAQLKSNGECELSKAVKQNFIQIPFVKLLKYIEYKAQEYGIKVSYIDEKYTSKASCISD
DVESIQDNPDLTNAFKGKRVKRGLFLDTVINKVFNADINAAVNHIKIGTGKCFVWLKDKL
FKLCNPIKIKSDYEFCRLLKSLWNSVGNKSVSFGTEALQSNRLVKNFSFC
>fig|391616.3.peg.1356 Mobile element protein [Octadecabacter antarcticus 238]
MRELDDALGLSDLASAALRDTRTGKNSVHRLDGLFRQSVFGRLAGYEDVNDADRLALDPV
MRQVVGGRAVDAQAASASQMGRFETETLALPENRAALADLNGTWIDRFHDRNGLKYITLD
MDSSVSPTHGDQEGTAWNGHFDCTCYHPNFLFNQFGMLERCALRNGNVHSADGWRDVLDP
VIARYADRNIGGRFFRADAAYAIPAIYARLEEAGYFYAIRLPANNVLRERIGHWLTRPVG
RPSQTKVKRFHEDFKYQAQSWDKPRRVIAKIEWHPGELFPRIGFIVTNLPMDPDWVVRFY
NQRGTAEQHIKEGKYAFRWTRLSCKRFRNNEVRLQLHALAYNLASFLRRIELPEEMADWS
LTSLQLKLIKIGARVVRHARTITFQLAEVAVTGPMVRAILATIRRLRAPPVCA
>fig|391616.3.peg.4061 Mobile element protein [Octadecabacter antarcticus 238]
MADANQEIERTEPNKHPNKALSAAFVRTATTPGKYNDGHGLFLKVVTSGAKRWVQRIVVR
GKRTEIGLGSASLVSLAEARETALENRKLARAGGDPLQAKRTSEALLTFEEASRKVHKIH
EPTWRNKKHAAQFLSTLETYTFPRMSNLKVSEVTTADVLAVLQPIWLEKPETAKRVRQRI
GTVMKWAVANGWRQDNPAGAISQALPKQKQPVKHRKSLPYDEVSGCLVAVRSSRAFNATK
LALELTVLTACRSGEVRLAEWSEIDLAKAEWTIPAQRMKASKEHRIPLSGRAVEVLEAAK
ALDDGTGLVFPSTTGNPLSDMTLSKLVKGLGYDVDVHGFRTSFKTWCQERTTTAREVSEA
ALAHSIQNKAEAAYARSDLFEKRRKLMEQWSCFVAEPSSAVLVRIAK
>fig|411483.3.peg.636 Mobile element protein [Faecalibacterium prausnitzii A2-165]
MNAVGIDVSKGKSMVCVMRSFGEVVLEPFEVLHTAQNLNDLAGKLKALDGETRVVLEATG
NYHKPVAFVLHNAGLFVSVVNPVLIHDYDNNSLRRVKTDKKDAVKIANYTLDKWTRLRQY
LPEDEARLALKNCYRQYQQAVAIRTMLKNNLISSLDLTFPDANNLFSSPAKSNGCEKWVD
FIGEFWHSGCVSSLSADAFAKKYLKWCQKHRYNFTRSKSDEIYSCAVNATSLPKSPTSKL
LIQQQVAQLKAVSKSVAAFQQEMLRLSQQLPEFDTVMEMYGVGPSLGPQLMAEIGDVRRF
SSKKSLIAFAGIEPQPNDSGKIMGNDKGISKVGSAVLRRTLFLIMTVILQTQPQDEPVFQ
FMNKKRSEGKPYKVYMMASANKFLRIYYARVKAVMDSECSQ
>fig|413999.4.peg.9 Mobile element protein [Clostridium botulinum A str. ATCC 3502]
MRRADIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCMCRSQA
PFCLCTLRAISDRAEGTFGRLRYFLGGDRPSQTAHLTMSRDQIHGRRLEPQYCQGGIPRM
TPLRLTPKLPSLPPILYRQYRDSMLSYSKALRGLSVQSRVASIFTCTTISPDLLLRQCPN
HYAIRAGRNLPDKEFRYLRTVIVTAAVYWGLSSHLRLR
>fig|435590.6.peg.616 Mobile element protein [Bacteroides vulgatus ATCC 8482]
MKQGTMNILFFVLKTKLLKNGEAPVLMRITINGDYDDVRIQRSVPLNLWNAAKGCSKGRD
RASVALNAYIAELHARALEKHKELVLEQALITPKLILKRVFGKDTEMRTLLGTMREGIKE
METLAGIDYSPVTINRYKNVVKKLQLLIPSYYGKEDVTFHELTPEFIRAFDIYLKTEAGL
CRNTIVRYMKCFKKFTNMALAKEWMRKNPFYGYKMEQDETDPVFLTYDELQTVMKKKFTI
PRLELVRDVFVFACFTGLAFSDVASLNKENLVQDNLGDWWIRKGRVKLEHRRKASSISNI
PLLPVPLAILEKYKEHPTCIKKGCCLPVMCNQKMNSYLKEIADFCGIKKNLTTHVARHTF
GTTVTLANNVPLQDVSVMLGHASTRMTQHYARVMNSSLKEAMNTVKERLAQ
>fig|449447.3.peg.1143 Mobile element protein [Microcystis aeruginosa NIES-843]
MFPAPLSINSSRYSTSPGLGLASVPAAAPVTTSPGLGLASVPTAAPVTSELEPAATRTLA
PHAPNQLIVKFKQGIASAQVAQFQSLFGAVRTQTIKLTGAQVWKLSGSLSVEKILAQYRS
NPIFEYIEPDYIRTVGAFTPQATFPNYPSFNQLWGLHNTGQNGGTPDADIDAPEAWDIQT
GNPNLVIGVIDTGVDYNHQDLVGNIWTNPGEIANDGIDNDGNGYIDDIRGWDFAYNDNNP
SDVYGHGTHVSGTIAGKGNNGVGVTGVAWNAKIMPLKFLNDQGSGSTSNAIKAINYATAK
GVKLTNNSWGGGGFSQALYDAINAAGQAGALFIAAAGNSSANADINPMYPAAYNLANIIS
VASTTRTDALSSFSNYGLTSVDLGAPGSDIYSTTPNNNYATYSGTSMASPHVTGAAALLW
SQNPTWTAQQVKNTLMNTGDPLASLAGKTVSGKRLNVFNALGANLPSVTVSVSPASVQED
GTTNLVYTFTRTNLNLSSPLTVNFGASGIANAAPVGSDPADYNVLTGSGVIFDPTTKLGT
VTFAAGATTATVVVDPIADTVQENSESVILTVNSGTGYIDGSPNTATGTIISEEGFTTYF
SDDFANNTKGWTLGKEWQIGAATTSTGQNYGNPDPGTDNTPTADNGVAGVVIGGNASTAL
HGFYYLTSPVINTSTANKLFFEFARWLNSDYTPFVQNKVEIFNGSSWVNLLPNNFDEAPG
VQDNAWTPQQFDISAYKSASTQIRFGFNVGSTDVFTVSSWNLDDVKIYGDGGITTKSISI
AKTTDGKEAGSVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPGAGKATFAAGSSK
ATIILPTIDDSVVDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEA
GLVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFVAGSPTATITLPTID
DSVVDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTL
TRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFVAGSPTATITLPTIDDSVVDPSET
IITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSA
LTVNYTLAGTATLGSDYNDPSLGQATFAAGSPTATITLPTIDDSVVDPSETIITTITAPT
GYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSALTVNYTLAG
TATLGSDYNDPSLGQATFAAGADKATIILPTTDDIVVDPSETIITTITAPTGYTISGPDT
ATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYN
DPSLGQATFAAGADKATIILPTIDDSVVDPSETIITTITAPTGYTISGPDTATATIIDDD
LGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSALTVTYTLAGTATLGSDYNDPSLGQATF
VAGSPTATITLPTIDDSVVDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKT
TDGKEAGLVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFAAGADKATI
ILPTTDDIVVDPSETIITTITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGSV
SSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFVAGSPTATITLPTIDDIV
VDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGSVSSVFTLTRT
GDLSSALTVNYTLAGTATLGSDYNDPSLGQATFAAGADKATIILPTTDDIVVDPSETIIT
TITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSALTV
NYTLAGTATLGSDYNDPSLGQATFLAGADKATIILPTTDDIVVDPSETIITTITAPTGYT
ISGPDTATATIIDDDLGTLTLGKTTDGKEAGSVSSVFTLTRTGDLSSALTVNYTLAGTAT
LGSDYNDPSLGQATFAAGADKATIILPTTDDIVVDPSETIITTITAPVGYTISGPDTATA
TILDNDGNAANNNLVGTGFADALAGVGGNDTLSGLGGNDTLDGGANNDTYLFDTDLVLGS
DRVIDASGIDTLNFAATTTKTINLNLGSTVAQTVTAGNLTLTLASATAFENVIGGSLNDN
IVGNTLANSLSGGAGNDTLNGGANNDTYLFDTDLVLGSDRVIDASGIDTLNFAATTTKTI
NLNLGSTVAQTVTAGNLTLTLASATAFENVIGGSLNDNIVGNTLANSLSGGAGNDNLTGG
LGKDTLTGSTGLDTLTYNSLGESLLSGFDVIQGYSGTGANLERINAPGSIAAITLTASKG
TATSLTEAAIQLVLTNAAFAANTAAAFTVTGQSGTFIALNNGVAGFQAASDAIIQLSGYN
IAVATPVVVI
>fig|479432.6.peg.4376 Mobile element protein [Streptosporangium roseum DSM 43021]
MVDDAYTQVAAGLAANALVNIKGGKLHLSRLEAAPLPEGFKAVHDAVAAMLPRIDYPELL
LETHAKTGMFDCMRHISGSHLRRDDLDITLAALTVARSCNVGLVPVIKEGMPALAEHRLL
GVEKGYFHGEGIAAVSARLVDKQAGIDITADWGGGMVASVDGMRFVVPVRSLHARPSPLY
WRIGKRARGSTWLNTVSDKVMGLGGLLVPGTLSDSLFILDAIHRLDAAEHPEVITTDQGS
YSDVVYGLFAICGYQFAPRHADVTDTQLWWGDTAMLEGTLTRDHRSGNAWGDFNTLGLRR
VSLPAIVQHWDDMVRVAGSLATNQVRAYDLIRMMMADGRLTGLGNAFAHYGRIFKSLHLL
QVIHVEEYRRMIGAQLNIDESRHTLARRVFFGNLGRLMRGYERGMEDQVGALGLGLNAII
WWNSLYIDAAVKKLESGALGIKGGQVTPEIRAHLLPLMFEHINFHGFYPFNRPEVGGELR
ELHNPAAAEDDR
>fig|479434.6.peg.9 Mobile element protein [Sphaerobacter thermophilus DSM 20745]
MDVDTFLITVYVLVDTFCQTHLPPEPHRPGPAPALSRSEVLTLAIFGQWMRFSSEQDFYR
YAERHLRPYFPTLPHRSQYNRLLRRHQVALAQFALYLADQLGRGPVAVDVLDVAPAPVRN
AKRRGRGWLAGEANIGFSLRLGWFAGFRVLTAVSLEGAITGWGVAPASTNERSLAETLIA
CRAHPDPRLPSVGTPVATYLADSGFAGEDYEAHLAATYGVTLVATPQRGSRRRWPKAVRR
WAARHRQIVETVIGRLLHTFGLERERPHTLAGFQARLAARVALHNLCCWLNRQRGRPLLA
VANLITW
>fig|485913.3.peg.3394 Mobile element protein [Ktedonobacter racemifer DSM 44963]
MITLEQYEQIRRMYHVEEQSERAIARTLGISRQTVSKALHADRPPEYTLKRPRPSPVLGP
YQARLDALLAENAHLPKKQRYTAHKLFELLQTEGYSGSESSIQMYGVRWRKTHKRPATFL
PLEFDPGQDAQVDWGEAQVIVGGIQQTVQVFVMHLSYSRRTFVMCFPSQKQEAFLYGHVC
AFEHFGGVPHRISYDNLAAALKPLIEGRIREEQRAFVAFRSHYLFASHFCTPAQGHEKGG
VEGSVGFSRRNYLVPMPQVESYTELNRSLLEKCLRDDVRVVHRQPLSIGQAWKIEQPALR
PLPKRAFDCCVTRQVHLTPYSQVSYDTNRYSVPTEQARKLLTLKAYPFTVEIYDKGQLLA
VHERSYGREQDVFNPLHYLFLLEIRLGAFEYARPLKQWKVDWPSSYHRLLAHLREKWPEG
RGVKEFVRILRLHQQYPASVVEQAIEQALAFGCTHLDGVKHCLEHGQAEVEARPLLDLSD
RPHLASLGSQAIDLAWYDQLIGRGVAQ
>fig|485913.3.peg.435 Mobile element protein [Ktedonobacter racemifer DSM 44963]
MVKTYSWSTDAKEMRRLFTLTYHDLQFLEPLRADAQRLYRALVLVWARVERVLVSDPNDV
PEDVIEQVSKQLSLKPAVLSQLRNHPSARSATFEAVRKHLEVRAWQESDAEQLSAYLAQK
VAHTGNPSALFDAATDWMVRVGVLRPQGETTIDRLIYQVRNQAEDTFFEQIVAQLSLEHR
NKLDALLDTSQGDSRLAWLGAPPRAASVPAIKEECERLVHVRQSLPAPLQWGAMTTNRLR
QWAAIVKKHRARNIRLYPPAKRYTHLCAFLTIRAEELTTIIVEMFDILVGRLFSRSDDDL
MEARAKRTETHQESARLFKKVAQVLLDANVPEEQVRERIFKQVSRERVSALVDLSDELDK
SETATFFGILDHRYAHLRDFAPVVLRTLQFDSPRTNNPLLEGLTTLTQMNQEGKKTVPDE
APVDFVPRKWEGAVVKDGEINKHAWEFTLLHETRAALRAGDLIVEGSQRYAAWDSDLYQA
TEWAQRRAAWYEESGLPEDGNLYLQEQLSGLEQTAKRVARRIARGKNPDARVEGDKLKLT
ALEKIEIPQEVIDLRTDLIELFPPTGLPEVLMEVDRWANISPIFFRLTSRREPTEEALAE
LRPQLYAVLVAEATNIGLSAMAQSSGIALHELERVYDWYLREETMRAAISRLISYHRSLP
LTMKFGDGTTSSSDGIRFGMAASSLHGRHLPRYFGVRRGVTLYNHTTNQSNQPWIDVVNC
LVRESTYVLDGLLYQDAPPIKEHYVDTGGFTELLFGLFMLLGFRFAPRLRDLSDQTLYRP
RKHTDYSVLTPVLKKDIREDLIVAHWDDMNRLAASLKDGLVRPSLVVSKLQAMQRQNPLQ
QAIQELGRLGKTGHILHYVDDPPFRRRVLVGLNKGETLHSMARDLSLGHQGRFTERSYEA
QLNRASALSLVINAIVVWNTRHFDRAQAKLLEQGEQVADSVWQHLSPLAWKHINFVGSYH
FSDIHLEGDFRPLRESERKSHRGGGEKYARSESIQEGNELPSQEDESSEQQLIQLPLLQD
TPRDTEK
>fig|485913.3.peg.8373 Mobile element protein [Ktedonobacter racemifer DSM 44963]
MRAVYTDRRIIMKMTSEAFQAWCQHLQLPPETEELVASIRSSQPVRRVSARGKNVTGRYP
SPKMGVPIQFESEQGEFWAIYEMECDEDVLELYEQPSRIPLSYRARSGRRTTQWHTPDFF
VLRRESVGWEEWKAAERLDHLAESQPGRYNRAATGHWSCPPGEAYASHLGLTYRLRSSAE
FRPLEIQNLKFLQDHWAHEVPPDPEHEALALAHIQAHSGIRLNDLLATYPHLAVDVIWVL
LSTRRVFTDLSATLLMRHEQVALYAEEGQVPRDTSEESPALHLSLPSAPLAWDGRLWWVE
RLEGEEVQLRPEVGEPLVLPRAEFERLKGEGALWIVGAATPSPMTLEVRQILLHASPKAH
QAANARMIQMLAYARGEPTTASRRSVQRWWRAYQQGKREHECGFLGLLDRVAARGNRTER
IEPASLQLLEAALQAHYATPQSKSAAAVYRLYREQCAKQGLPPVSERTFYRVRARFATNE
VEARRRGTRAAYASQPFSWLDQTTPRHGERPFALAHLDHTKLDIVLVSSLTGKPLDRPYA
TFLTDAYSRRLLACYLTYDPPSYRSVMMALRICVQRHQRLPQECLVDRGPEFGSVYFETL
LTRYGVTKKERPPAQPRVGSVVERLFGTTTTQLLHQLLGNTQASQHPRRMTREVDPRRLA
VWTLERFSARLCEYAYEIYDQLDHPSLGQSPREAFAQGVALAGMRLHRLIPYSEEFLILT
CPTTRTGYAKLDASRGIVVNGLRYWNPLMRGASDAGRAVPFRYEPFNMGVTYAFVDGQWL
TCTADAFLQIQGRSEREWELILSEWREQQRAHHRTRMSLDSTKLAAFLEEVLEEEPLLEQ
QQRDLEGVSIRDAIVGRAMSTGLPLDTSEASSEADDELDLTTLPTLEEYRSDGKA
>fig|485915.5.peg.1072 Mobile element protein [Desulfohalobium retbaense DSM 5692]
MSQAVSASTGKAYTMRRVCRVWRIPRSTVYHRLQQSKQCSSRPRGPKAFYSDAELVAHIK
DLLEQSPFHGEGYRKIWARLRLQDIRTSPRRVLRVMRENNLLVFQNTSIHPGPKAHDGTI
TQESSHVMWGTDMTKAYTIRDGWVSVFGAVDHFSAACMGLHAAKPGTRFEAVEPVRQGVR
EAFGAIEQHMAQGITMRHDCGSQYLSKVFQDELRFLGFTISPAFVRSPQCNGCIERFFRT
LKENLLWVRSFQDIEELSQALQEFKEQYNTQWLIGRHGYQTPYQVLASHRPQQGLAA
>fig|485915.5.peg.1073 Mobile element protein [Desulfohalobium retbaense DSM 5692]
MSQRSDQETGSCPGAAAPGQQQKNQKPQRISAKMKTRVVQRVMRGESLELLAREFGTSVA
KVSQWRDEFIQAGEEAMKKDRGSDEKDRKIANLEQKLGETTMDYELLQDKVRRLEQKRPL
ARRKSKK
>fig|504472.7.peg.6877 Mobile element protein [Spirosoma linguale DSM 74]
MLDLPTWATTYMGQIQSSTNKIGFLLQLGYFRITNRFFVADRFEPDIINWLCARTQLDPN
QIDLTKYTRSRTAFRHRETILAHLGYQAFDRTHEQELLVEAQRLAHLQTRPALVLDALTG
YLQERRIEIPPYNTLRLILIEALQSFQANLEQIIDRYLQENDSQLLDTLLGRQSSPAGSA
TQLFPYRLTHFKRISQSMQPGQIKQRVELFRELKLLFSQLAPLIVRLNLSDDAIRYYAQY
VLDTQSKQTVQRTSERYLRLIAFIIHQYLSVGDALVLTLRQAVTNILNECEQTLKDEQFE
SRYANAQLVHRVTRRSDIHIQALVQIEEIVDLPGLEAAQKIDQIRDLFQRHRLSGNDLQT
DKERLIDLKTVNQSIHDRDDFYDALERASLKLQTRVAGVVQALVFDEQSSPPALVAALRL
FQATKGELTQSNNLPLDFLDMADRQRIFTLTGKLRVSLYKALLFWKIRDHLRDGSLNVLS
SYEHRAFDEYLIPRRQWQIHRQAYLQKANLLRYVKAEPTLAKINERLNAQFRLTNQHLNT
NAQVYFDKAGDWHLHRYRGRESEQPSPQTNLYPTSRVISLRDVLLDVDELTDFLSAFEHQ
GFAHKPSRPDNSLLLAALIGYGENIGIRKMAMISKNIPINSLETVATHYFSPESVLKAND
LILTKSNELPLTEQFRRRANFIQTGSDGQKYDVSIPLLRASASYKYFGNGQGITIYSHLD
EAGQLIYSTAFSAADREAPYMLDAITYNEVITPDAHATDQHGFSEPIFGVTGLIGVEFRP
RFASIHRQRLYSLDAVSIYKEQGCRIGPDARIDYEHVVSQWDEILRLVATIKLGYAKASQ
LFKRLNSYDRQHPLYRALRDLGRLFKTEYILRYISEPQLRETVEGILTRVEHANRFAKAV
NLGNNGELGWATYQEQLIAEGCKRLIMNAINYWNLLYLSEQLKRCANSAERKVLLEAILQ
TNTHTWHHVNLQGEYDFSDDSPLSTIFKLHEILSARTVK
>fig|525919.4.peg.429 Mobile element protein [Anaerococcus prevoti prevotii DSM 20548]
MISIGIDIAKEKFTVCALEQGSKIIWKPFDVHLNKTKVEEFLKKLDTLNEEVKIIMEATG
KYHLPILYELKDKEYFVSVVNPLKMKQFCRVLNFRKAKNDNIDAIQIAEYGLMYWKELQE
YKVDSESFRILKELNRSYQHYMDLRINQMNFIDQTISQTFPGIKKLIPHASGDFSKDKLL
DFLEIWWHKDLVLEKPEEKFIEDFKNWAKEKRYHPNADKAKSIYKLAEESISIQPSNSSY
IKTSIQEGIELIKHINQILHTILSQMIEISEPLEEYQEAKKFSGISDKLAVQITAEFGDL
SKFKNKKSLISFVGIDSPPYESGNFKADQRKITKRGNAILRKVGYQAMKCMMSAKDTEND
IYLYMVKKEKDGKAKKICKFAGLNKFLRTYYAKVMASKQEKKLLKVA
>fig|533240.4.peg.3183 Mobile element protein [Cylindrospermopsis raciborskii CS-505]
MIKSWLDEKNDLLLSELCDRLRETTGTSVSITTMHRALEKLGLRHKKSLNASEQETPLSD
RIMLIKIKAISP
>fig|546269.3.peg.1517 Mobile element protein [Filifactor alocis ATCC 35896]
MHYTYIKVNGSFHYLCVVMDLFSRKIIGWSISNRHDVDLTMKAFENAYFDRGEPEYVLFH
SDRGSKYTALTFRQMLERCNVVQSFSQKGYPYDNACMESFFHHMKRECINRKSFRNQDEL
RLCCFEYINRYNSKRPHSSLGDYTPDEIEQFYMERQE
>fig|635013.3.peg.1729 Mobile element protein [Thermincola sp. JR]
MYKPVLSLDVSKENSIAALYLSFGEPMGKPFRVEHTPSGFAALVEQLRNLELLTHKKPEV
ILESTGNYSRAITQNLMEAGYSVIALNPLETHEQKRRAIRKVKTDKVDAQRIAKLYYFDE
HRPLHPVNPEIAKLRNLCRLYDGLSNLYIEAQLRFQSILDLLFPHYTNVFSDLCGDSSLN
LISVFPTPEAVLSASKEDIVKHLKSKCQRKDWPEQIYQKLLTAARACLPYKVAQQSNVRV
LREYIPILMTQKRLLSGLRAQIAAAAKEIPAYSLLKTIPGVGEITAASILAEIGNITLFP
TAKQLVAFAGLDPSVCQVRPV
>fig|101510.16.peg.7839 probable integrase/recombinase [Rhodococcus jostii RHA1]
MTVARYCTDHAIDEYNEQVRDRFLAEQDTRLQQGSIGPVFRSSLEKTANMLLEFKLAGKV
AWRRRRPMSTQLPSRFETALRLFDESLSGTLAVGSVEFAVGEIRQLLTHLRDRGHDSFGS
VGLDDVRGFLMAVAPNHRSGMGNTVWAVKRFFSFLNDFELSDLPVHAMLSQVSPRRIRTL
PRFTQDEVARLLAVIDTATAVGNRDYAMVRLAVSTGLRCGDITDLRLESIDWRRDEIRIV
QRKTAATLALPLTAEAGNAVADYVLNARPASDAPEVFLRANAPHVKLTGPTGALIMRRYL
AAAGIHHKAGDGKTFHALRRTLGTRLIETGTELPMTAQILGHARIDSSKRYIALDTDSLR
ECYLPLTGFGCRAEALQ
>fig|1051632.5.peg.1495 COG4584: Transposase and inactivated derivatives [Sulfobacillus acidophilus TPY]
MITVPDIQFIRPLREREGWSLRRIAREFHFSRKTVTKYLQRTETTETPQYVRRNPSPAPQ
MDPPRAVIASWLRQDAEMPRKQRHTSRRIGQRLREEYGATAAESTVRHSVARMRRELQPA
AQPVFLDLVFDPAEAAQVDWGEVQVIQDGQSVTAQMFCMRLAYSGACYVQLFPHQRLETF
LAAHVAAFEFFGFVPQRIIDDNLTTVVQHVLHGRERELNPRFQELTAHYIYDAVFVTPAA
GWEKGLVEGLVGYVRRTDCVPLPSGPDWDTLNAALKTDCLAERVRTLPRRHHTTIGELWD
HERTTGASRPVTWWPVRATSQAMVRHRRVPYSVPASRVGQTLRLAAYWDHVEIWIRRRVS
PPIPSASLANRNDNGIITSMSCV
>fig|1078763.3.peg.4101 POSSIBLE TRANSPOSASE [Mycobacterium tuberculosis NCGM2209]
MIDTAIEEMIPLIGVRAACAATGRAPASYYRAHSKRLSAQSDTFTSTAVTDPSGPRESAQ
PRALSAAEREHVLAVLNSQRFADMAPAVVYATLLDEGIYLCSESTMYRLLRERGQTGDRR
RQATHPAAVKPELVAHQPNSVWSWDITKLRGPAKWSYYYLYVILDIFSRYVVGWMVASRE
SKVLAERLIAQTLAAQHISADQLTLHADRGSSMSSKPVALLLADLGVTKSHSRPHTSNDN
PLSEAQFKTLKYRPDFPKRFESIEAARVHCDRFFGWYNHEHKHSGIGLHTPADVHYGRAD
QIRRHRATVLDTAYRDHLERIRSQTTRATRATGLQRDQPTTEGGPADSINPRKSCLRNVD
RFRPGLLDLPAPAPVDLRRLLPSGQIR
>fig|1094715.3.peg.3444 Transposase for transposon Tn1546 [Fluoribacter dumoffii NY 23]
MRLMDVLPDNEVNRYNRPPALNSDSRKKYFKVDQIIQEAIKKQAKNVESKIGLLLQYGYF
KASGRFFTSKSFKLSDIKYVSKVLGVTTPADFLEQYLDRTRQNHRILILDICGYIEFTSA
IEFFDEVAGDMVEKQMHPRKMFYVLIEQLRQKKIELPSYDKISRTITEKFHGFEKNIIQK
MTETISKEQAEALEQLTELPEKHYERSLLTRLKVINQSLKPGKIKSGIRNFLIIKNLHKE
VSPLIKKLELSAEATKYYAQWVIKAKTTQVAEITEPYKRHLYLTAFVDHCYKIWQDTLVD
ILLKCVQQQLNKAQQAVSKMIMEKMPEKNQLTVSVLSGLDDSQSTVNAVQGVLYNKELSS
EDKILKLYTIVPSPKNDTPLSKAELDAKKLKRQLDAEQTRCDEFDALSNLSRKLQNRVAD
IVKYLEFEVCKGAEDLYSAILHYQSVKSITSTAPDAFLDDLEYAAIHRDEQFNVSLYKAI
LFCKIATAIKCGQISLIHSYRYLSIDAYLIPEPYWDEHKAHLLEKLGLTQFIDIEQVLLL
LRGILDKQFIDVNQRIVEGTNPYTTIQKDGGFSVHTPAVDKPDYNSISMIIGSDRYVPIL
QMMSEMNALTTFTSNFKHHKIKGSAGAPNNEIFYAGLFSLASNIGLHKLANTAIGINYNT
LSNTVNWYFSLENLHAVNQSLTDLMGKLWLPEQFKREKELLHTSSDGKKQCVSAESLNAN
ESFKYFGNGKGSSVYRFIDERGILFYSTVFSSSERDAAYVLDGLLHNDAIASTMHSTDTH
GYTEMVFAVSHLIDVTFAPRIKDLSGQNLVSFRRMKTELTNKGYPIKPAYYVNEHKIKRN
WDTILRLIATIKLREHRASTILKRMGEYSNQHPLQEALKEFGRIIKSIFMLKYFDDVALR
QTIEKQLNKGELANKFSGAISFADPNLLEAHSEDQEISVMCRTIIQNIIILWNYIELTRI
IMKSEPDERESLLENIVSASILTWQHVNLHGTYDFSNLLSVNDSEYSLDEVVNFRAA
>fig|1117316.3.peg.922 ISCps9, transposase orfB [Pseudoalteromonas marina mano4]
MCSWLNVSRSGFYAWRERTVSARALSDANLLLKIKHVFNVNHQTYGSPRVFHALKKEGVN
TSQKRVARLMRENGLRARALKTYSKPAKVKFFYKEIENKRKDSEKATAINQQWSGDITYL
KVGARWHYLAVVIDLYSRRVIGWAFGKNKTTELTLKALRLAIKKRQPTESVLFHTDRGAE
YRAHVVQKYLASKNIKASMNRPGCCTDNAEVESFFHSLKADLIRGNKFESSGKLLSKLKV
YLNYFYNRQRLHSSLGYKSPAEFESAVN
>fig|1121378.3.peg.162 transposase, putative [Deinococcus aquatilis DSM 23025]
MGHHVFPISLRQTRPKAEKADRLKQYLDQLRVLLRKHRVWLRTYAPVLVADGQYAKRVFF
DLCRDEGFAFVTKLAVNANLLIPFTGQHPKRRGGRQKWEKKVDFCDFAGWTGVAGSEREQ
VWTRVVWAPHFGCYVRVIVIQTVDLAGKVRGHVVLYSTDTGRPAEQIRALYSARFQLEFV
FRDAKQHASLTTCQLRSKKGLENHWNASMLTVSLARAEQFLRVAALTGQPAQQIVFSMED
AKRRAFNLLFAQRIFANLGLSQRFEELQNHPTRPLDLGVKAA
>fig|1122611.3.peg.8390 transposase [Nonomuraea coxensis DSM 45129]
MTSIERTAYPQFKRLTSARVLHVFFTPTADEIDWAQELARGSQTLFALILALKCFQKMAR
FPAREEIPEVVVDHVRRCLGLAGDVEPDHGAASTAKWHRKQIRARQGVIYDKEQARAIAA
EAITEAAQAKNNPPDLINVALERLIEASLELPGFTTLDEMAATIRARVNAEIFTRVVDRM
GVDGQERMGALLTTVGTDGRSLFNRLKKPAQRPTWAKFDAHVKYLDEIDALGDTWEWLEG
IALTKITDFAGEAAAQDADTLSRYNPVKRLALLACLLHMARMRARDDLAEMLCKRVAANL
KKARTALEGIRERQRAVSERLIGTYRTVLEHLDPEGPEADRGAERAVAAVNNAGGFDAQL
ADIEEVSAFHGDNYEVLAYRFFKRDRAVMFDLVAKLELKATSRDESVLTSLEHARAHAGL
RRDFIPMPPPVDGSGGPGSGIMFASGNWRRAVTDRGRPGMVARRHFEAMVFTYLAEELRT
GDIAVVGSNEYADWSANLLPWAECEPLLEGFCEQVGVPSTAAGFVAHLRSNHLAAAAELD
AGYEDNADLVISDDGAPTVKRRRGQQTLKAAEKLAAAIERRMPERSLLSIVARTAHWLGW
HHHFGPASGSDPKISDPLFRYSLTVFTGGINLGPYEAAKHLTGVSARELSMIRNRHIDIR
KLNAAIGCVVNAFAELDVVKAWGDGTTVAADGTHVETYVDNLLAETSIRYGGVGGIAYHY
VSDTYVALFSRFIPCGVWEAVYLIEGLLANDSDIQPTTVHADTQGQSFPVFALATLFGFD
LMPRIRNFKDLIFFRADPHLVYPHIDALFGDRGRNVIDWELIERHWCDLMQVAISISEGR
LSSATLMRRLRSNSRKNRIYKVFREVGRSVRTVALLRYLADPALRARVTAATNKVETYNG
FSQWLGFGNNGVIADNDPEEQEKLIKLNTLLANLVIFHNALDLMDVVRTLVAEGWTITAD
ELGALSPYLRAHIRRFGAYATDEIGDEPAAFNPELKEIDFTAVDLAA
>fig|1123278.3.peg.4833 Transposase [Spirosoma spitsbergense DSM 19989]
MDLYNDNERFISLVSDYGFKATFGNESDTRFLRKALQALINSPVAIEQVTFIQNEIKGVT
RDSRSGIYDLFCEDERGNEFIVEMQLSEYPEFIQRMKFYAFYRLNTLIRKGDYQFDNLPK
IYCIGILAVSIFTHVADYQNVAVLKNQNNELIDEQMTFITVELDKFKKGMSEVENDLDKL
IYTMKTIHEVSEPTQFPQFWNEEWLRVAIQELDKRAFTPEQRLSYEMTISANALAVKNEN
KKIEAAKEAENLAVKTEAITKALNRGKLSLEEIAEDNGVSIDFVLGVQQRITGS
>fig|1134785.3.peg.1827 transposase IS116/IS110/IS902 family protein [Enterococcus faecalis ERV103]
MNCVGIDVSKGKSMIAVMRPFGEVVVSPFEVRHTANELSELAGLLKSLDGETRVVMESTG
NYHAPVAWLLHDAGLYVSVVNAMLVHDYGNNSLRRAKTDKKDAVKLANYGLDHWLTLPRY
IPEEDTRLMLKICYRQYQQYSKVQTMLKNNLISLLDTTFPDANRLFTSPPRADGSEKWVD
FVATFWHCECVCGRSEKAFTTQYQKWCRKHGYNFSEDKALDIYASACRHFGVIPKTDTAK
LLVEQAISQLQTTSSALAALKQEMQSLAASLPEYPVVMGMFGVGPTLGPQLLAEIGDVRR
FHSKKALVAFAGIDAPPYQSGQIDVRSRSISKRGSASLRRTLFLVMSVILQCAPIDEPVY
QFMDKKRSEGKPYRVYMMASANKFLRIYYASVKAYLESLEHD
>fig|1148.35.peg.1178 transposase [Synechocystis sp. PCC 6803]
MAMLPLPNYCRIAPRQPEPLSKFHGQQSIRLQSFPELCLSLPEGSHYLTARMNLYEHFGH
DQVFKACIDYLEKALEKLGILDSDIPARLLLVFPDHTRTAIAVRLLLDAIFYFQETYKHL
QFSILFGLGTHPPMTHKSVSEYLGGERYQKLINLGITIRQQTTIAPLEPQVKIKVQDRLK
IDEVSNYSFANLNRNTAQLPESLNRTYVRPKNRQNNPIAKQIHHLSANSLSQCT
>fig|1151196.3.peg.2855 TnpA transposase [Enterococcus faecalis 2630V05]
MKIARGRELLTPEQRQAFMQIPEDEWILGTYFTFSKRDLEIVNKRRREENRLGFAVQLAV
LRYPGWPYTHIKSIPDSVIQYISKQIGVSPSSLDHYPQRENTLWDHLKEIRSEYDFVTFT
LSEYRMTFKYLHQLALENGDAIHLLHECIDFLRKNKIILPAITTLERMVWEARAMAEKKL
FNTVSKSLTNEQKEKLEGIITSQHPSESNKTILGWLKEPPGHPSPETFLKIIERLEYIRG
MDLETVQISHLHRNRLLQLSRLGSRYEPYAFRDFQENKRYSILTIYLLQLTQELTDKAFE
IHDRQILSLLSKGRKAQEEIQKQNGKKLNEKVIHFTNIGQALIKAREEKLDVFKVLESVI
EWNTFVSSVEEAQELARPADYDYLDLLQKRFYSLRKYTPTLLRVLEFHSTKANEPLLQAV
EIIRGMNESGKRKVPDDSPVDFISKRWKRHLYEDDGTTINRHYYEMAVLTELREHVRAGD
VSIVGSRQYRDFEEYLFSEDTWNQSKGNTRLSVSLSFEDYITERTSSFNERLKWLAANSN
KLDGVSLEKGKLSLARLEKDVPEEAKKFSASLYQMLPRIKLTDLLMDVAHITGFHEQFTH
ASNNRKPDKEETIIIMAALLGMGMNIGLSKMAEATPGLTYKQLANVSQWRMYEDAMNKAQ
AILVNFHHKLQLPFYWGDGTTSSSDGMRMQLGVSSLHADANPHYGTGKGATIYRFTSDQF
SSYYTKIIHTNSRDAIHVLDGLLHHETDLNIEEHYTDTAGYTDQIFGLTHLLGFKFAPRI
RDLSDSKLFTIDKASEYPKLEAILRGQINTKVIKENYEDVLRLAHSIREGTVSASLIMGK
LGSYSRQNSLATALREMGRIEKTIFILNYISDESLRRKIQRGLNKGEAMNGLARAIFFGK
QGELRERTIQHQLQRASALNIIINAISIWNTLHLTTAVEYKKRTGSFNEDLLHHMSPLGW
EHINLLGEYHFNSEKVVSLNSLRPLKLS
>fig|1157458.3.peg.1227 transposase [Enterococcus faecium UAA720]
MTQVHFTFESEEIQAIINESGANDTAKTLMTIMFNQLMEEQRNQYIQANAYERSEERQSQ
RNGYYDRSFTTRIGTLELHVPRTRDGKFSPTIFERYQRSEKALIAAMIEMVISGVSTRKV
TKTVELLTDGATVSKSFVSNLMKQLDPFVFEWRNRSLEGSEYPFFMCDALYMKVRENHRI
VSKGVYIGIGIDSDGRRTILGFDVQDGESEDNWDTVFQSFVQRGLFGVKLVISDAHKGLV
KAVRKNFLGASWQRCQAHFLRNIFDKLPKKVSSDVKDELKSIFKASELELTRERKEHFLE
KYGCDSKLSAACDILENGFEDAIQILSFPENIRRRIRTTNVLERLNEEIRRRERVIRIFP
NINSITRIIGTLLMEKDTEWLASPRKYLEFNSNNI
>fig|1158628.3.peg.1666 Transposase,  mutator type [Enterococcus faecalis WH257]
MARKKRNPDAEKLAESILNAYQPESVDDMQDALKDVFGPLFEKMLQGELNNHLGYDAHSK
EPKEHDNRRNGYGTKTLKTSFGEVAIDVPRDREASFEPELIPKRKRDVSDIEGKVLSMYA
RGMSQRDIAATVEAIYGFDISHEMISDITDAVLPELEEWQARPLAKCYAFLFVDCMYVTL
RENYEAKEYAVYTILGYDLKGNKEILGLWLNQTESKNRWMQVFDELKARGVEDVFFISMD
GVSGLEEGAKAIFPSVIVQRCIVHLVRNALRYIPSKDYKEVCRDMKKFYGASSLNAAHAA
FGSFQNRWSHYSGAVDVWKRNFAHVEQLFDYGSAIRKIMYTTNAVESVHSSFRKVTKKGA
FSNENALLKLLYLRTKELHAKWSGGRIQNWAMVLKQLMINETFSSRMKSMRFTFRNNGRF
IQLCVRSKFI
>fig|1163409.3.peg.832 ISCps3, transposase orfB [Rhodanobacter thiooxydans LCS2]
MCRLYGVSPSGYYAWRDRPASARAQEDVRLLERIRQVHNEGEQTYGSPRVHAGLQRDGES
VGRRRIERLMRDHAIRGCSADLYRRCPGVDRFFASVDNRIHELTVDRPDQVWVTDVTYLK
VSGTWRYLATVMDRYSRRLLGWSLGTDRTSRLTRRALAAALRQRKPPAGTLLHSDRGVEF
LAGDFKQALASAGLVQSVNRPHRMTDNAHMESWNKSMKSDMYHRQWFSTESSLRAAVRNY
IDFYNTKRLHSALGYRSPIEFEAHAANPPVSTFA
>fig|1163740.3.peg.256 ISHa1152 transposase A [Helicobacter pylori Shi112]
MRLKEIIQEVAKELRVEIIEMQTDKDHIHILADVDPSFGVMKFIKTAKGRSSKVLRQEFN
HLKTKLPTLWTNSCFISTVGGVPLNVVKQYIENQQNSNRPKQKEKWKNYVDNLQTKALHQ
>fig|1173022.3.peg.5069 putative transposase for insertion sequence ISRM17 [Crinalium epipsammum PCC 9333]
MNNAELDEIDKILGDRQLYEYLESDLSKRYPKTKETGRNSTPVEVIFRLLVLKHLYQISY
QEILNRVNENLVLRQFCRVYFNQLPSKSTLIRWANLIKAETLKQFNQRLTELATQLEVTQ
GEKVRTDGTVVSTNIHFPSDNSLLVDGVRVLNRHIQHARKLIIKQNIPTDHRLFQNRHRT
AKIIARKIDDLSRTRTQAGSDKRKLLYQKLLDVASATLKQAQQVKAILHNAIGKDVNKLS
KTFQLFINRVEQVINQTFRRIVGQEKVPSSEKIVSIFESHSDIICRGKQNVLVEFGHKVW
LDEVDGGIISNYRVLKGNPHDTQQLPETIDQHLKQFGHPPKQISADRGVFSSLNENYAKS
QGIKQIILPKPGYKSKERQIQEKKRSFYLGRCWHNGVEGRISFLKRCFGFQRCLYHCEEG
FERWVGWGIVVHNFLMIGRTLIHKKSIACE
>fig|118161.3.peg.3003 transposase [Pleurocapsa sp. PCC 7319]
MRQRVINAYEGKEGSQRQIAERFQVSHSFVKKLIYRYRATGTLEPKSHGGGALPIIKQSE
LKQIEELVNEQPDALLRELCERWEARNGIKVSISTMHRRLEKLKLTTKKNSVRQGTRNS
>fig|1193807.4.peg.313 transposase [Dehalococcoides mccartyi DCMB5]
MIQVDQKENIRRLYFIKRHSVRQIAKELGHSRKTIRKAISDASVPHYNQTAARPSLVMGP
YMDIVKEWLETDKSRPSKQRHTAHRIYVRLTKELGFTGAERTVREHVAKLRPTITEMAIP
LEFDPGTDAQCDWGEAQVRIAGKLTIAQVLCMKLSFSGRPFVMAFPTQRQEAFFEGQRRA
FEWYEGVPGRVSYDNLTVAVHKVLRGRNREEQNAYIGFRSHYLFDSHFAMVATPREQGRV
ENLVGYMRRNYFVPVPEVESYEELNEKLLWRLLEDDSRLVPGKEITVKQAWETEKPKLRP
LPRFPHRCCISRPVKASRLSLVNFDSNRYSVPVEYGFGRLTLHAYAWSIEIVCGDRIIAT
HERCYDRGKEITEVDHYLPLLLRRPGAFPYARPVRQWKMPPVYRDCYEALCSKHNGYGVR
EFLQVLALGRQFGKAAVESAMAQVLEENQVSSDRIRQLLNTNSGEITPTVWTGNLGQVKV
VFPDLNQFDRLRDLATAGRPE
>fig|1211814.3.peg.3049 transposase (08)/ABC transporter (ATP-binding protein) [Bacillus sp. AP8]
MLEIIDLTKKFKQQTVVNKINMYLEEGEIVGLLGPNGAGKSTTISMISSLLEPTSGDVQL
DGKSTIKQPQKLRNILGVVPQEIALYHELSAKENLMFFGRIHNLSGKELHDRVAEVLEII
GLTDRQKDIVKTFSGGMKRRLNIGIALLHNPKFIIMDEPTVGIDPQSRNYILETVKMLNR
ERNITVLYTSHYMEEVEFLCNRIYIMDYGEIIASGTKDEIKHVLSSENTVEVKLQKPSKA
FEEALLASNDIRSVTVQDTVMTIIASKNVNILSVLIPLSEEFGVSFLSFEVKNPTLEDVF
LHLTGRVLRD
>fig|1228997.3.peg.271 IS1 transposase [Riemerella anatipestifer RA-CH-1]
MIEIKTSCIKVSDTKMCPHCLSKKIIKNGRTKTLKQQYYCKECYRRFIDYYTYHAYHSEI
NRKIVIYTKEGLGIRSIARVLGISATTVLKRLLAIAKALSSPLIAYGKEYEVDEICSYVR
HKGNKIWITYAMERDSGNVVSFNIGRRTKTTLSKVITTLLYSRPKRIYTDGLHHYRYLIP
QNVHKVSRYGTNKIERLNLTLRTKLRRLNRRTICFSKSLCMFMAIMKIYFWY
>fig|1229518.3.peg.1078 transposase Tn3 family protein [Lactococcus garvieae Tac2]
MGAYKLTSSAQQEALLSLDKLSKDEFQGYFSFSRSDVKFILSHRGVENRLGIGLQLCLAR
YPGISLTSVDKVSKSLVEYVADQLKISTIDLDNYLSKKNTPLVHLKKICRHYNYSLYSSK
ASDYLKNILNEAIQENNDELFLINLAIYRLREQHILLPELSEIERLISTIRQNHEKYLYK
KIIELLSENQKEQLDSLLVVNLDTKKSKLAWLQDISGKPSKDTILSICDRISVIKELKLE
QLTFSFTNEKRLSQIARLTERYHAFDLRRFEETKRYALLVVYLIRYRKALIDLAIEVHNK
IVQSIKRSGLHKKNEENKKTGEQSNRMLKHFSQVVSMLDHAICNNDFQNLARQLKQSFDW
NELIEEGQQAALIASPRKRTYMGLVQYKAQYIRGYLPRLVETLDFKSPRMDDDGLINALR
LITVLKKENKRKIPVDIELNFVKKPWQSLVKNPDGTIDRSYFELVAATELNDRLRSGEVI
EPQSVLHQELDNYLVSSDAMMGSHTIPDTFKEYLSSRIEVLEERLEAYQKLGKSFDRLTI
TKKEKNTPEEAEYYKKSLYKLLPDVNLVELLIEVNNWTGFMDEFIHEATKDSANKEELEV
LFSTLMAMGLNIRFQDMEKSTHITSAQMANAKQWRMSPESFKRAQSVLINKQITCPFSEF
WGDGSKASSDGLRMQLGVSSIHSDFNPHYGNKKGTTIYRHTADKYISHYVEVIATNQREA
ASAIDGAIGHDTELNIEEHFSDTNAYTDTAFALFHLLGFKFEPRIRDIGSMNLYTIKSPD
QYKKMQPLIKRAVNLNLIEKHYDEIKQIAYSIQTRKTSAKIILNKLGSYARKNKVAQALS
ELGKIEKTIFLLEYAINEDLRKVITQMLNRGELINDLARELFNGQRGKFMEKDFEKQLQS
ASALNILINAISLWNTVYLQQAYNYCKNSEPEITKYLEYTSPIIWRHINLLGEYKIDLTT
LPEELRELNQGK
>fig|266835.9.peg.7107 INTEGRASE/RECOMBINASE [Mesorhizobium loti MAFF303099]
MSIHNKRSSAAIAAAPTTDEIRRIWSGERRFGAGTADKYLICIQQFRTYCSQLGLIEREE
LTLEGANRFIGWYARRRSRPRRSHQNFRSALRSLARVYHRMGVAPPDWQPPRAVQPPPSP
LFAEYDAYLVQHLGLAERTIHKQLSHLSKFYNYLVRAGKEWYSIQLTDVDAFLVGCSTQY
SRSYVSNIASTVRCFYRFLHWSGKNPIDISEAIIAPIQRPFERPRRALPWEDVQRLLNAV
DRSTPVGLRDYAILLMLSTYGLGAAEVNRLQFQAIDWNANTLAVYRPKTGVSFTLPLLPP
ISEALAHYLRYGRPVDTPTRHIFVQMQVPFEPYVRSSAIGHIVAKHARKAGINAPSLGSH
VLRHSHAGRQIDLGTRPQVLSELLGHSDPESVSAYVRIATDSLREIALPVPA
>fig|273057.1.peg.1803 Transposase ISC1332 [Sulfolobus solfataricus P2]
MTKSKNNPGRGNTIRESNTMKVMEEIREKIRKAIKEGVSLREIEEIILQEAMMEEREAYL
EVEDDHKNGTYFRYLGTGDGVLRLRVPRTRKGGFRPKILPEKYERTSPDYEDFLQQLVLS
GMTPSQVKAVLAAKGIPYSEIVMNRVAERISNKLKEYKSRELPHDLLALYIDVKIVKVRI
SESIMERAIYIAIGVDLEGNKFVLDYEVRDREDLDGWKSFLSGLVSRGVSRVDVIVSDDF
SGLDRVVSTLFPSSQHQLCITHMVRNLMRVLPDKEKEELMIRVRDLKSSRNVEEGRKAIL
SLSQLVQPFSPARAKRLLDAADKYCSFLNFPREIRHYLYTNNTSESFNLTLARFEEELGG
YFPSLRSLEVYLYVSIHESNSRWKFRPMSVIRHYSYHLKQLHASRFQVSLDEDF
>fig|310037.4.peg.3111 Transposase [Acaryochloris sp. CCMEE 5410]
MLSDSDFEAWCSQLKLSKITRTLVSQIRTSEPVRRVGGGRSNVCGQYPSHKMGKTIQFES
HKVELPAIEAYEADKEVLEYYDQPIQLEIEFKSSKGRLIRCKHVPDFLVLRQTNVVLEEW
KTEKKLEELAQKQPHHYYLDDNGHWQNPPAERSAETYGISYQLRLDHEINWVEYRNRQFL
KGYRDGSYSVDKALEANLIDKVTGSPGITVAQLLQSIHTASQDDINALIAKGAVYTDQRA
VSLTEPNKVQLYQNLETAEAFQLAPPWQPLDTLQAFGLDITTPLTWDGKPVTIAHAGGTT
IVLRNDDGLVELTHTELDRLLQRRAIVALENPLQHSSSKFWEEFLQASPDDLRIANDRYR
ILEGYLQGKPLDSSVVSSRTLRRWHRQFKAAQQICNWGYVGLLPHHNAKGNHLSRVSKDA
WEFIDQIIDDHYETLQQKGKMAVYGILLREWEHSRRPDLCPSHVTFYRYLKQRDQYRQTK
KRKGAKAAYQKAAFYWELKQSTPSHGDRVFEICHIDHTELDIELVCSRTGELLGRPWATI
LLDAFSRRVLAIYLSFDSPSYRACMMVLRICVQRYERFPETIVVDHGAEFDSIYFETLLA
TFNCTKKQRPPAHPRFGSVIERFFGTANTQFLHNLRGNTQITKQIRQVTRKNSPKSQAVW
NLGELYDHFCQYTYDIYDQLRHPALGQSPRAAFAAGMSNSGSRPQQRVMNDSIFQVLTLP
STSKGTARVQANRGICVNYLSYWAIDDCFLNPNVEGTDVPVRYDPFDMSIVFAYVNKAWV
RCVSEYHALFQGRSVKEIKAASAELRKQAQLQNQQVPLRAKTIATYLASTEVSEATQLQR
LKDLATKDVQAQLQSNVQPADIADRHPLTHEFEEVTNSDQPSRPKITTAVKIDIEHIQPY
ANEELWR
>fig|311402.9.peg.3838 conserved possible transposase [Agrobacterium vitis S4]
MLNPKARNLDPEAIWALTEDEAYALFVDFRWADNGGKPNCPRCGCLEPYSIRRRRFRCSE
AECRAEFSATSGTVFANRKLSFKKIIMAIWEEITAAKGMAALHLTRKLNTQYKTAYVLLQ
KLREAVGLRRTTVMLQGLVQIDGKYVGGVLRKANKKEDRKDGRKRENQNGKRMCVLALRE
ANKHAPNRTLTRVIMDENGKDAWAAVAKHVDPKALLIADEHKAYDDLVGLVSMHRVNHSL
QYQEDDGTNSNVIESFFSRVEKAYKGINHRFSMKYLDWYMAMLAWKEDTRYMGLRWQFAD
VLRTVMSKPTSRNLCGYWQEAASNIQDQVWVRGVPPD
>fig|314230.4.peg.3595 Transposase, IS4 [Blastopirellula marina DSM 3645]
MLTFGDHQNGDLFDPWEHLGPKRLKLLERSWAGVFREFLLKQLPVGKLAEAFRKDLGRPT
KDLYVALGALILQQLHDFTDRQTTEAVALNMTWHYALDIRRDADAYLCERTIRNYRQKVL
AAGLDQVLFQTLTDRLIEEMGVDTGKQRLDSTAVKSAIRGLTRLGILVEATSKFLRELKR
KHAALYADVAPDTIRKYVERSGDGCFGDTRPSESKKRLPEAAQDVFELIQQFRAAECSTL
ESYQLLRRVFDEQCEVDENSATPVSVRPPHTTACAHVINPADPDARYNKHRGPGYLVQIM
ETYEESHPDEQEQADPPKPDLITYVAVNPMTMHDKDALTPAMDCTEQRGVKPKELLADSH
YGSTECLEKGRARDVEIVSPAQTPKGKLQGKLTLEDFELAEDGRITRCPHGQEPKETSVA
GIRLQVVFTLESCATCPHRERCPASSVGRSSARYQYTHDRVHLWRRRQKERGKEFRDRYR
WRAGVEATMSRFKYQMGMASLRVRGMTKITYTATLRALGLNIQRVAAYRLKTG
>fig|316274.3.peg.5276 Transposase for IS3511b [Herpetosiphon aurantiacus ATCC 23779]
MLDMFALSAWSTHHCSRFTRNTANPARQTPVSRLSCLVSDAATLGHYSPPPRWVGRERHC
RLYATTRRTVSLLLKRFTSEDLAALRPRSRRPRHRVRKVTVAIIQRIRSLQHNHRLGAWR
MAAALKQEGIRISPRTCGLIMAKNKTLYAELRPPDPPPAADPKPMPFAAIRPHQFWSIDI
RYLDMHQLGGGNIYCLTILDNYSRAVIASCVSRSQDLTMYLLVLFAAIRNHGAPEAIVTD
GGSIFRANQAQNIYRALGITKHQIAKKQPWQNYIETTFNIQRRMTDVSFETATTWEALLD
AHAVWVANYNYQDHWAHRQRSAAYRSPVEVLRWIRGRPFADADLRFVFYSTRFQRRLNRF
GYVQFRSWRIYAEEGLANHAVTLWLYRDHLTISYDDLVVAQYQVRYQPDQHHFTQITDPA
LYPTPHQSPQMTFWERQAGWWNLAQRLALLPIRRIRQTVGGEQLPIDPSLLEAPQDTAA
>fig|324925.4.peg.2902 integrase catalytic subunit [Pelodictyon phaeoclathratiforme BU-1]
MKVRTKSNPRAMRTQLKKLTMYNKVKELSREGLSIRQISRNTGLDRVTVRKYLRMTDEEF
SDFLAQQKRRYRKLQPYEQFIKNRVADYPDCSAAQVEDWLKEHHPEFPEITTRTIYSFVQ
WIRKSHDIPKPKGTPRHYYPVEQLPYGEQAQVDFGEYWMLSADENKVKVYFMIMLLSRSR
RKFVSFSQQPITTRFVLEAHEQAFTFFEGIPHTLVYDQDSTIVTNENRGAILYTEAFNKY
LLHRSLKIHLCRKSDPESKGKIxAGVKYVKHNFLPGRRFVNLDVLNQEVLLWLERTANAK
EHTTTHLVPDAEWQVEKQHLRPYEPLPYPISGTIGKDYHVRKDNTISYRGNFYTLPVGTY
AGPGTQVVLEARENNLFLYAQDGKLLAGHLIESGKGIVVINNHHRRDISTKIRELQDSLM
QQFTNQEQAGLFLESIHNRYPRYIRDQFLHVRDTINGCEQRLVDDALASCVDHHLFSSGE
FHDILQHHRKQKDKQSHHAVFKAFRPKTLQSDLNKILSFVPESSTITTYEKILC
>fig|330779.3.peg.1657 C-terminal of inactivated transposase [Sulfolobus acidocaldarius DSM 639]
MNGTWKKYYEKYKKVLGVNAQAVLQKKNNEAWSSFFSLLKNKDKLPLFMNHVSPPGYWKE
DGKRKLILVVRQDRYKVDEERHALILKDWKMEIPFSGRLRWSGVQGRLEIHIINNRFYAY
IPVDVGRVVAKRSGKLVKDSLIIHGERGKIQISSPKGNKVASVDLGINMLATVIVDDGTV
LFYRGSVVKSDYFYFQKKIAELDRLKSEAEKIQEVEAREEVLEERKRLFNKLYRRLLHYY
RTLASHLAKALWNLGVSTVYLGYPYFISQDKGNKFTVNIWSYRKLIEAIMNKLHEYGIKT
FLVVEYNTSRYCAYHDVEVVRKPRGLTSSPP
>fig|383372.6.peg.4059 Transposase, IS630 family [Roseiflexus castenholzii DSM 13941]
MRCPHPARWFAPLRNVARYTPCATVHRSPICVHGPPRGSPSPMAGVRRSSHVPACAGSAT
PLPSLFGATAGWRKGSTDAPFAMDVGARPPFPLSPQRWTRRRRRGRIRLQRAPRTGGPDQ
PRWTLAGIRPSCTGGPSRALPGVHTIRDRLHVVWKRTRASRRSPAPEDDDQRAVIAVLLV
RLHAAPERSRLGFLDAVPIARQPTLTTADAVRGDDQVRAYLRQRATTLARVGATLDGRTV
QVGVRRATRSTAPTLALCAQALRATDLAVACIDVGHDPWTEHPHPDRLVVWEPHPTPAPC
YRLSHWSTKPSAAASRKRGPVAVTDPAGAVADVCLVGSSESRSWGARCGKPCPPAALGGR
SPPAARRG
>fig|391616.3.peg.5277 Phage integrase [Octadecabacter antarcticus 238]
MATSWLPAVSTMQTKITQRTLASIDGTGTRTFIWDTALTGFGIEVSAKGKASYVCETRIK
GTGRKVRQKIGSVDLMPLDDARSDARSMLLQAFKGVDPRFDKQEVEQAPKTVGQAVTDYI
EAKRHKLAASTIRDYRVTFSSCLSDWEHLPLGQLSGQMIANRYNKLLDKLSVAYSNKVMR
NLRAALNYHGLEPNPVTFLTRKDLMAVDAPRNRFLSAHEIYIIYGYFSTYQHPVARVVLF
CILTGVRKNEALKLTWENVTSQTILFAGDIQKNHKPHHVPRVGLLDGIFGDRGESQDLVF
GYTEYSFRKPFERFKQRPELDGWAYWTMHDLRRTFSEHMNLIGYAASDVSLASNRSDNSV
TVKHYLGGQLAKENLLRRMYADLQRQVHYYWYERGDAETMVAPKDYIPSILVEPELTEDE
WREYQESLVGVDTSTF
>fig|41431.3.peg.4120 ISSoc4, transposase orfAB [Cyanothece sp PCC 8801]
MQPLSIDLRQRIISASERDTISIRQLAKRFDVAKSCVQKLIKQNKETGDIKPKRQGGNSP
PKVQGEDLVTLIELIENNNDATLEELCELLEEQTGITVSRATMGRISQNLDYTVKKKTLQ
AAEKDSEEVQLKRVEFWKKIRDIKVEDLIFIDESGVNLAMVRLYARALKGKRARGVKPLP
SRSKYLDNKRTIP
>fig|449673.7.peg.2563 Transposase [Bacteroides stercoris ATCC 43183]
MVYSSEGILTRREVSLVNRLIRNEKEDLVRNYRLLERTDPGFTLERLMLKHRKEQYDQSV
DKFILQYIDTLLEEGKQSTAASYTSGLYSLLRFCSLRKINFKDIDYVFVTDYIHYLRMRG
ISENSIHMYLSNFRAVYNKARKQGIRVCGENPFAGLNVRRQETVKRALSKEEIALIASAD
LRRYPQLEAARDLFMFSFYCRGMSFVDVIRLKHDGIVRDTIFYTRSKTGQRLQIGLLPAM
KEIIEKYRTSGPYIFPYIHGQSPRDAYTQYRYSLGTVNRYLKRLGTLLNIGIPLTTYVAR
HSWATIAKNEGIPISLISEGLGHTSEKTTQIYLNSFAVDTLNKVNENVADAVSDCIKNAG
EKFICLHNTDKT
>fig|457394.3.peg.2898 Integrase [Bacteroides sp. 4_3_47FAA]
MFLKMDSLNILGARLRDCIKSHLLQFGKGDIKGNIYILLGGNEFTLSISDLCEGKGEPPR
KEKYLGGYYDKVKAMLPEGDSDKHYAAFVDFFSDVCMDTGIRESTRKNYFRTLDTLEKYA
PVAAFCDIDKTFVCGYERFLCSMGMKANTIVKHMKHLKKALRQACLKGYSKHSIEELFSL
CSVKPEKTFRESLTTKELVVLYQFLENNFDTMEEKEREILSGFLFSCLTGLRYSDICSVE
YSNIKRIRNKRWLFLTMKKTSQKVFIPIEQMFSGKALGIMRLFHRTRGKLFHMPSNAICN
RVIKRVYKKLFRSRKNISFHTGRHTAATLLLYHDTPLTTIKEILGHTNIRTTEIYADINE
ATIYNSIAKIKFKELEKVERRIARSFSNKS
>fig|472759.3.peg.3077 transposase [Nitrosococcus halophilus Nc4]
MPAPYSLDLRQKVIEAYANKEGSIRQLATRFKLSKNTVSGFLKRLRETGTVHPKRGEGVG
HPAKIDEPRAQYLTEVLQCEPDLTLQELCQRFEVRFGETISTSAMDRGLKKHRITRKKKR
STIPKNTPPGSNNAGLSIGSK
>fig|483216.6.peg.447 Integrase/recombinase [Bacteroides eggerthii DSM 20697]
MKLKSESIVISQAVNEWFTSYLPIARGCSSHTQRSYFTALSQYMQFLQEEKKVTPNTLSA
ESYSKSNLNDWLLWLKKTRKCSNSTCNDRLSGVKSFIKFLSIKDIRFNAVYISSKEIKPM
RTVKVIHEEITQKAIKSLFSTIRTDTRTGKRDLAIFYLIYSIGARIDEILSVKICDLHLH
EYPNPNYLTIIGKGYKCRTPPILKDVTKILLRYIEVFHNNDFASHSYLFYSFYNGEKKKI
SQEAINKRLKMYAAKANEIDKCVPRNLHCHSLRHARASHWLEQGLNIIAIQRLMGHADIR
TTMRYIFVSVEQKNKALATLESKSTLKLEKKWKKLPKGQSLLEYVGLKK
>fig|485913.3.peg.56 transposase IS605 OrfB [Ktedonobacter racemifer DSM 44963]
MAKATKTIRQALHYPPQYAAYFVANQVLFNRVVAFYFDCIQAHEGLLALNNKEGLTALEK
LTHGTGANPHPIMPLTDLAPDIPAIFRRAAINAALGSARAFSSSLKTWRARKQKHEAKQT
RSGGKKKPFKERPPVPPRSWNKSAPFYAGIFRERHHHSLMLKVWTGSCWSWLKVHTFSRD
LPEGFEMGSPSLVRIRDRWWLHTPIEKTFETPAKVVEQLTTAQTRICSVDLNLDHRVAVC
SVQTVDGTILATSFIGNGAAVSGCRKQLLGRIARNRSQTGIIAENEQDNADLWAKIRHVD
EQIAHLVSARIVQFASEHKASILVFEHLGNLQPEKGTYSRRSNSKRAYWMKGRMFRYAKY
KAWQAGGIITSRVNPRNTSRECHRCHAAVIRYNQGHPVEGYTPGAALCLCPQCQMRDHAD
RNARLRIGQRLIERTQEPLKEKPHARSQRAKRESKDSGVGISQDAKRQMGPSLPAARRGD
HANGDGTPQGRRRRMGAPLPDIASQLRVHFE
>fig|485916.4.peg.2321 probable integrase/recombinase [Desulfotomaculum acetoxidans DSM 771]
MAYKKQQDRLLSPLTKEIEEFIDFKQQSGSLYTSSEFALKAFNRFCAAVENQALTPQQLA
EAWVKSGDDKPKYDGGCCVRQLGQYLTAQGHPKAFTVLSAKGNTPRLLGINSGPFVREIK
EFVDQKRSAGRKYISEGYCLKAFDKFCAMKENEFLTPQQLADAWCGKVREKNTANIGMIR
ELGMYLTMQGSTKSFVVPYANGDMPKPPFTGYTGSFAEEIVSFLKTKRSAGLKYRHEEFR
LKDFDKFCNEQSNLKLSLRQLADAFIHFQEERGYSKSRRSTSVIKAFGNYLTNNGCSNAF
TIIDKNFVAGPYAEEISAFVAFKKSCGFKYLNSGYHLRSFDVFCASKENESLTPQQLADK
WVLKRDNEHPNTRAGRVDPVRVFGKYLTSIGHAKAFTIAVDAAQRRSPKPPYLFSEDDID
IFFGACAELKPDEKEPSMHIVLTAAFLFMHCMGVRTCELKILMENVNLETGEVIIIDAKT
GERSVYMSEELSEFLFKYNLVIEKIFPRHKYLFPASVSRSRNDFAKHFREIWTSNVPAVE
HGGPRLYDFRHHLLYRNVELCMRNGDDVNVLRPYLMRHMGHKLPESFQYYFHLSPPIRKE
VSQIKKSLDWMIPDVPEVPYE
>fig|515620.4.peg.388 site-specific recombinase, phage integrase family [Eubacterium eligens ATCC 27750]
MGTSQPIRSLDELTAFRSYYLNKEVNLRNYMLICMGLNTALRISDMLQLKWGNVYDFDRK
HYVKHIVVCEGKTGKETRIAINNNLIEAFEMYMGSLKSVSGNDYIFTGKTKGTHLSRSQA
FRIITHVAEALNMENGISCHSLRKTFGYYAWKYGTPPAMLMEIYNHSSYEITKRYLGIKQ
DDRDNVF
>fig|546268.4.peg.1859 integrase/recombinase [Neisseria subflava NJ9703]
MIITYNAVSPHCPNNIPMATIEKRNGKYRVKVRLKGVTKSETFTLKSDAVAWAARTEAAI
LDGVQGNAPKSLYFADLLTRYRDEITPTKRGNRAETYRLNRALRSDLADIKVSDLRPHHF
AQWRDNRKKEVQEATVRRELETLSAVCQMAVKEWGLLPSNPLLQIRRPGKGKARNYIPPD
DIVLAVVRELGVADGVPIITAKQRIGLAVLFAIETAMRAGEICNMNWRDVHLARRVVHLP
MTKNGSSRDVPLSKKAMAILDRLPRSESGSVFDISSHTLDVMFRRARAKVEGAEGFHFHD
TRHKALTRMAAMVEPMQLAKISGHKDLRILLNVYYNPDIGELADLLD
>fig|546271.5.peg.81 transposase YhgA family protein [Selenomonas sputigena ATCC 35185]
MEKEAKGRQYQDTVFRLYFNDEQRLKEVAGALHGRSYARDPLKIVTLDGTFLSQIKNDIS
FLLAQQHLIFMEHQSTANKNMALRCLYYVCEQWRQYVPAKKLYQNTRIELPAPEFHVFYS
GDGDMPETYQMKLSDAYRKPESDENINLELKVCFHNISYDEAKILLQKSRTLHDYSFFID
RIKKNMTSGMARAQAIREAMRYCEEHDIMAEFLQQHEREVVDMVNFEWNQKDFEEAILEE
GIERGMKRGRAEGCEEGKVAIVLEMLRDKLPLETIARLSKFSMERVQELGRRHSLL
>fig|552811.9.peg.178 transposase IS4 family protein [Dehalogenimonas lykanthroporepellens BL-DC-9]
MAMLPPVIEDYVGPKDPVRAYDAIVEAMDCDQMGLTIDRSLVGNPAYDPKSMLKLLVYGY
SYGWHSSRKLERACHHNLSFIWLMGGLKPDHKTIANFRRGNQQVLRKVLEQTARICLKMN
LIEGNCLFTDSTKMKGAAATSRTLTRKAWEQKLAETDKAIEELLARCEQIDRNESGNLVE
MKEELEDRQKLQSKIKGLVKQLDKEKLSRINSTDPECLNVKGRQGTYAGYSAHITVDEQH
GLIVNADVVAEANDSNQFSQQIEQAMITLGKPCRTAVADAGYSNMDNLKRTTEKQIDVIV
PTQRQALHSPQDSPFDKSKFRYDEQADCYECPEGKKLKYSHYSRQKSNYLYRMEKPALCL
KCRYWGTCTISKRGRTVIRLKEEKLREALEARYASAEGQEIYQKRKARVESPFGHIKRNL
NCGNFLLKGLAGVKAEWGLLAGSFNIARMITLSGGVPGLLRRLEQAETG
>fig|556262.3.peg.3168 Transposase [Coprobacillus sp. D6]
MKLVGIDIAKYEHAAFIMEASTGESLCDPFFFKNNKEGFKKLYTELNKYSKNELLIGMED
TGHYNFAIESSLLAEGYKVALINPITTKSLRKASLKSVKSDKEDALLITKALLDKAYYRI
ISIQDEKLKEAKELTRYRTQLTLEMNRKKNVLQRHIDIVFPEFNTLFNNEYTITYLNILR
KYSDAYTIAHTDIRSLRKCFKYCNSFSAEELKELASNSVGIHDVSISFIIQSVISSIDLI
NSQIEELDKKIEELAITQASSITSIPGISIITGTSILAELGDISKYSNAGKVIKFAGVNP
YISESGKFSADKTAITKKGSKYLRTTLYRVIIPVIRHNPAFNNYYHLKRNQGKGHLCALG
HCVRKLLRIIYHLETNNLSFDINSLK
>fig|575590.3.peg.906 Transposase and inactivated derivatives [Bacteroidetes oral taxon 274 str. F0058]
MNCIKCKSDKSVKNGIVSSRQRYKCNDCGYNYTVDHKSDVKSNETKRLALAMYIEGLSYR
SIGKILDISYGTVYHWVKDLKDQTKMLHSDRTVQVTDIDQLDDYIHEVKHNKQYGLLLID
LQKGLSILSVKKQ
>fig|591167.6.peg.23 Integrase catalytic region [Streptomyces flavogriseus ATCC 33331]
MTETAPEAVVAFIGNQRVEHGVPHRVSCRVLGVSEAWFYKWRRRPDEPTKREVRRARLEE
RIVHFFTASGGTYGSPRITLDLWAEGWQVSVNTVAEIMAELGLRGRKPPRRRSLTRQGKR
KAAPDLVNRRFDAVAPDVLWFGDMTEIETGEGKVYLATVIDAFSRRCLGYAMGEHHDAAL
VGASLKMATTTRGGRREGTIFHSDRGSEYTSGTYNTLCDRLGVVQSMGRVGSALDNAAAE
SFNSLIKVEYIHRRRFATRTEARLKIGTWIIGFYNPRRRHSAAGGLPPEEFEQIITEARN
KSRQRCQAA
>fig|658661.3.peg.3458 Transposase [Parabacteroides sp. D25]
MGKFINPFTDFGFHRIFGQEVHKELLIDFLNQLFFGEHDIEDITFLNPIQTPETLDDRGI
VFDVHCKDSNGNLFVVEMQTGAQPYFHDRGLYYLARAISNQGQRGKDWKFALQPVYGVFL
LNYKMDVNSKFRTDVILADRETGRMFSDRIRQVYLELPYFQKEPDECENDFERWIYLLKH
MDTLERMPFKARKAVFDKLLEVADVANLSKEERIQYDEALKRYRDYKNTIDYAEEKGILK
GKESTARNMKAEGIAPLIIQKCTGLSLEDIEKL
>fig|707241.3.peg.528 transposase ISRM11/ISRM2011-2 [Sinorhizobium meliloti SM11]
MARPFSNDLRERVVDAVTGEGLSCRAAAKRFGIGISTAIDWVRRFRETGSAAPGQMGGHK
PRKLSGPHRAWLLCRCRERDFTLHGLVAELSERGLKVDYRAVWTFVHEEGLSYKKRRWSP
ANGSGPTSPATGHDG
>fig|709032.3.peg.77 Transposase and inactivated derivatives TnpA family-like [Sulfuricurvum kujiense DSM 16994]
MTTLQILSKEEEKAFNQKPIFNFNQQKFYFSIPKNLLEKIEIDFNQIYFVLLYGYFKATN
KFFTDLNDDKNLDYIASDILKISIDTDAVSLTKSTLYRYQQIIKQHLRINEYTYEIKDIL
VKEAITLANNFTHRKKIFYALVEFSKKLSIEVPSYTELYRIITVAINSQKRDILERLTPF
IKDQKLNILDEFLQKDGDYKNRWSLTHYKILEHSTKKAAMMVSLQKFKTIQSKFNILESI
FISGGITPKIAQYHAKWIEKSQVFQVKRKKDVESNFLLLSFVYYQYLIRNDNLIDRFIST
VQTAKNSSLRSQKEYSFEQEPHKNRVIQSLENANLSTLNDIEAIVKDSDLSAVQKVATIE
KLLQQKTLALNEILTEKKVFDTVVECKYDFIESKSVSLQGKLSGILKAIEFDEKASNKNL
IEAINYFKNNPTLTNKVPKAFLDEEERIAVFDGDKFKVSLYKILLFFHVSDAIKNGTLNL
KYSYRYKNFDDYMIDKDDWIKNKDLLLTKHEMEYLKPFDTFMNTVKDKVEASYKETNHNI
LNGTNTYFTASDDSYILKTPKLEKDEDEEKNPLAKYSQRKSTYP
>fig|718255.3.peg.2775 transposase IS116/IS110/IS902 family protein [Roseburia intestinalis XB6B4]
MIAVGIDVSKSKSTVAILNGDGSIRAKPFDVHHVADDLQALVDYIKRTSEPPTILMEPTS
HYHYPLLKAFTEAELPVCLINPYQMKKYGDTELRKAKTDKRDSLRIAQYALEKSYSLIPY
TPQDQKYEDLRFLSRQYSQRISTITVAKVQLLSLLDETMPGITTILPLKSRDPDNCVLLR
FIKRFKSFDVIRKMGKTRFLDSYQVLVKKTKDRFAGSKGLAIYELVLNSVTTRGENPLSA
MTQDQCVDLVSTSQKAADEINLQMRIIAETMPEYKVLRSMAGVGDRLGPIILGEIGDIRR
FHSGKALNAYAGNDAPPYQSGQFESRNRHISKRGNPALRKACFEVMQALKLTKPQDDPVY
LFLLKKEQEGKPYNVAKMAAVNKFLRIYYARAMELYK
>fig|744980.3.peg.5751 Transposase and inactivated derivatives TnpA family-like [Roseibium sp. TrichSKD4]
MQILSPSELIAFNTPPRMNAAQRKAAFDLPLGFQREIEQLRDPAHRIGFYLNAGYFRHSR
RCFSPEAFHENDIAYVAGRLGYDGSLFKPDGYQDRTRQRHERIIERLAGFRTLSGDGEAQ
LSQLIDQKVRAHEKPKAIFHASIDHLLTNRIALPGYRRLQELILSAIGRLKTRETATIEA
HLPEQLGHELDLLLGENPESDGITRSRLAALKQNSQSVRPRSVKGRLANHTDLSDLFHKL
EPIIAILGWDRNSTRNYALAVMKSDPHDLRRRKAADRYLHLIAFVVHQYFALQDNLVATL
LSSVKATETAATREFKDWCYVERKSQAAKLRAQIQAFEDHFQSAMATLRGVFEAGHLSDA
DKLESLHLLLFPVDAEPVLSDAILKDMKDDAGLSQAEDARYYDILEARSRRLQNQVSGVM
KSLSFQTEPHIKPLLAALVHFRQADGQITKSAPSGFLDSTERKALGSGTHFRPSLYKVML
FQHVAKAIKAGGVNLPQSHKYQPLDSYLITTERWQRDRDQLLERAGMTRFSDPETVLSTL
KTALSDQFHLTNTTIAKGNNPYVVVTPAGHIKLNTPKQEEIEAIALSRFLPQRHYVPLCE
ILNTVHGACGFADSLSHLRQQYARPVSTAVLLAGVIGLGCGIGLRKMARISTGITEDGLD
HAVNWHFSRENLAAANDRIVAFTDSLDLPEVYRRQANQTHTASDGQKFEVPGHSLDASHS
FKYFGKGRGSSAYTYVSDKILLWYSTVFSAAERDSAYVIDGLMHNDVVKSTIHSTDTHGY
SEAIFGATYLIDIAYAPRIKGLKHQTLYSFRSMNSEGRKSWAVQPDKYVDEDVIRTHWED
VLRLMVTIKLKEATASDIFRRVNSYSRQNSLYTALKAFGRIVKTLFILRYIDSVELRMDI
EAMLNKVELANRFTRAVAVGSPREFIFTLQEDQQIAEACNRLIKNAIICWNYLYLETRLR
AADPETRAEMMKTIKAHSPQSWAHINMLGEYDFSDKSSQTASVSSP
>fig|749414.3.peg.1177 transposase Tn3 [Streptomyces bingchenggensis BCW-1]
MKPLLPREVDEKLVPPAWRKAVYANPDLPQGAVDRDAYVVCVLEQLHRALNNRDVFAAPS
HRWSNPRARLLDGPDWDAVEEDVLAALSLDMPVEEHLAELVRGLDAGWKQLAERLEEAGP
AAKVSIEVQDDGRVKLNVDKLGALGEPKSLTWLRKRVEKMLPKIDLPDLLFEVNAWTGFL
DAFVHLGDGTTRMKDLSTSVVALLVSEACNIGLAPVVNPGYEALTRARLVHVDQYYLRAD
TIAAANAALIAAQAEVPIVKFWGDGLLASVDGLRFVVPVRTVSAAPSPKYFGFKRGITWL
NAVNDQVAGIGQMVVPGTPRDSLHILDALLNLDGGVKPEMVATDNASYSDMVFGLFKILG
YNFSPRFRDLDDQRFWQATMPGVETGAYGPVEDLARNRVNLNKVITHWPDMLKVAGSLVT
NQVRAYDLLRMFGRDGRPTPLGSAFAEYGRIAKTEHLLRVVDPVDDTYRRQMNRQLTVQE
SRHKLARDVCHGKRGTIHQAYRDGMEDQLGSLGLVLNAIVLWTTRYIDAAVAQLQAEGHE
IREEDITRLSPLKHRNLNLLGRYSFTASTPAADALRPLRDPDAPELDEDDEGVD
>fig|76114.8.peg.129 transposase [Aromatoleum aromaticum EbN1]
MRQKVVDAYERGVGSQRQVAELFGVSISFVEKLFMRLRSTGTVAPKPHAGGKRSRLDEVA
RQRLAQWLHAQPDLTLDELAQRLKSELDIHIGLPRLCRVLKQMQLSRKKRRSMRRNVTPT
R
>fig|763034.3.peg.2664 site-specific recombinase, phage integrase family [Bacteroides fluxus YIT 12057]
MDLRNKKNKLSIRVVLNSCKASEEGIYSLGIRVLYRRRKKEYSLGWRLHWSNFLPDKERV
VFSPEGPLKRKDLGCINRLIKEEKGNLLKAGLFLERAEPGFSLERLMQKHHKNRCSQYVE
VFMLQCIEELRGEGKSGTAEAYVSGLNSLRRFCALGKLRFKEVDYAFVTDYMHYLRTRRI
SENTVGMYLSCFRAVYNKARKQGVEVREGNPFADLNFRVQETLKRALTKEEIARIARVDL
RRHPRMEEARDLFMFSFYCRGMSFVDVIHLRRDCIVNGTLFYERNKTGQRLQVGMLPCMY
EIIEKYRSRSPYLFPCIDVASSRTVYTQYRYSLGMINRYLKRLGELLHIATPLTTYVARH
SWATIAKNEGVPVSIISEGLGHTSEKTTRIYLDSFTNDTMNRVNENVAAAVNDCMKKEGE
SFHLSI
>fig|768493.3.peg.1361 integrase catalytic subunit [Serratia sp. AS13]
MHYLLNKQLDDGLHFGRDRLFSLLKERRLLVPVRRAYHKTTDSHHRFRRHPNLLKTGPEQ
VVVRRPEQVWVADITYLPTRNGMVYLSLITDACSRKIMGHHVHSDLRTDNVVQALKQALK
QRKTTQPLIHHSDRGIQYCSASYQAVHERYGLICSMTDGYDCYQNALAERVNGILKTEFL
LSRPADLEQARKMVRESIEIYNRERPHQSLKYKTPDAVHQAFYRHKSVNLCQD
>fig|82654.3.peg.4304 transposase [Pseudanabaena sp. PCC 7367]
MDLRYRIVVAYENGEGSIRELAQRFSVSKNSVHKLLQLYRDKGTIRPTPYRAGVKPKFSP
PHLVMLAELVADHPEATLVDLCQQMHQRTGIEVSVSTMCRILQKQKLDRKKHCVS
>fig|861360.3.peg.173 COG2801: Transposase and inactivated derivatives [Arthrobacter arilaitensis Re117]
MSNSLSASIRRQIIEFDPGLPDSLSISQFCKELGISRPSYYKVKERFVAEGNKALNPHSR
APKTDRRIYSDQTKTTVLRIRKRLAKDGWDNGPLSIWFESLDTQEFGELRPSVATIGRIL
AEAGATKRNPRKRPRKSWLRFARSHPMEMWQIDGLEYRLFDQDATKAMIYQLIDDGSRFD
VGTRCFEQMENAQDAMETLKAAFAEYGVPQQLLSDNGGAFNLSRQGLVNQTEIFLASVGC
EAITGRFSHPQTQGKNERSHNTLTRFLDAHAPHNLAELSTLLEQYRNHYNHRRRHQALKV
GHTYLTPAQAWEAGDHRGSDGVAIDIARIQAKAQSYLDKALAVKADLVPEGVVDDGLQVL
GRTKVENYTGSPSVLTDQRDDVIQIRRTNPQIYFRGRVFKVPAHLIGEYQLVLSKDAYTL
YSTVDGEQSLSFPLPVRLHSSARLVPLWQVYGARIRDPKPAWTQKRIEYEDIYYSPDVAV
S
>fig|866771.4.peg.141 integrase core domain protein [Prevotella disiens FB035-09AN]
MWGQVATSLVKQDNLSVTLACKLFDHHRQSFYQLKSDIEKDIANERRVLESVCEIRAEDP
GIGAYKLWLMMRNIYGYEAVMGRDRFYVLLRRHKLMLPPPKVRHTTNSNHRYHKWKNLIK
GISLNSANELWVADITYIWTAQGVCYLHLITDAYSHKIIGWVLTDTLKAAMSIEALQQAI
DQAVQSTGNSCLKGLIHHSDRGVQYCCDAYVEVLKSYGISISMTEDYKPTDNAIAERVNG
IIKEEYVYRTHQFANQAQAKEVIGRYIQFYNNKRPHMSIGYKTPAMAHQEKGPQQKKWKK
KKYDKKQETKENKIVTLQRQTTSQGQSTCQQP
>fig|880072.3.peg.51 Integrase catalytic region [Desulfobacca acetoxidans DSM 11109]
MEEWQAIQVLKRQGHGKKAIARQLGISKNTVKRHWNRQAPPAYQRAASEKMLDPFAPQIK
EMIGKQFIGTRIFQELSELGYTGSLTSVYRYLRQFQDDVRDRTTIHFETSPGQQMQYDWK
EWQVPVAGRPLKIYFHQAILSYSRYKFVTFSLDISTPSIIRVLTQALVFFQGVPAEIVID
NPKQLVLSHDRQGVIRYQDDFLAFLGTYGLKPDPCQPYRARTKGKVENPFFYLQEHFLRG
LEVEHLDHLGERLARFMEQYNARTHSTTGLAPVQLWPQENLKPLQSDIPLSFQKESRKVS
WDGYVHADSNRYPVSLAMAGKKVWIERVLGRWLDILDADLKPLARYELLREHQVTLPHPE
HADLAKEFLDRKEQRRLQVKVVFQETFPALAPDFIRLAEQSYTLNASYHLNKILDLLSVY
DHQAVAAALQTALELGTPSVRSVQGLLPEKLQQPVLPTSCRTACLPAVAKRPLSLYRASY
GGGAR
>fig|880073.4.peg.444 transposase [Caldithrix abyssi DSM 13497]
MKQSQQSNKLRFDGQVFFIGIDVHKKSWTITIRLNGMQLKTFTMEPNAKQLQKFLKKNYQ
GGHYFSVYEAGFSGYWLHHQLTELGIKNIVVSPGDVPISNKEKSYKDDAIDSRKLARELE
NNSLKAIFVPTPKQSATRQISRLYALQSNENKKIRLRIKSFLNYLGVEIPFEVGSRWSNR
LINWLEKLELKNEGDRYYLDQLIKNMKAKRKELLATLKLIRKNYADHQVIKRLRTIPGIG
LITAFTYYAEIMDIHRFDNENKLASYVGLIPSLKSSGNRTRVRGLNHRQNKLLKFRIIES
AWVAIKNDPALTSSYVSYIKRMPKQKAIIKIARKLLNRMRSVWINQKEYQIGRMI
>fig|887296.3.peg.1646 transposase [Campylobacter coli 1948]
MQIEYDINLHSVFLLQYHLILVVKYRREVIDDKICARLKEIFEYIAKNDNYSLELIEFNH
DKDHLHILFKAKPKSELLKFINAYKSASSRLIKKEFPHLKQYLWKQYFWSGSYFLATTGG
VTLDILKQYVENQGIEDNRVKKQYKNTKRKRLLNANN
>fig|903510.3.peg.170 putative transposase B [Vibrio furnissii NCTC 11218]
MQRAGLRAQVGYRKPRAPSGEQHVVTPNRLERQFDPLAPNTAWVTDITYIKTHEGWLYLG
AVMDLFSRRIICWSMGSRITKELALDALLMAVWRRKPAGKVLVHSDQGSQYTSHDWSEFL
SAHGLEGSMSRRGNCHDNAVAESFFQLLKRERIKRKIYATSMPATLLISIIRML
>fig|991905.3.peg.4206 ISGsu7, transposase OrfB [Polymorphum gilvum SL003B-26A1]
MAGSFSPATGRAYGVARVCKVWGVPRSSFYLARRLARDPAPVRPKGRRGPKPSVSDDALL
EAIRADLARSPWSGEGHRKVWARLRVLDGLNVGRKRVLRLMREHNLLSPHRARPRPEADH
DRKIVTDAPNVMWATDGTQITTVRDGKVWLFATVEHWNAEALGWHVSKRGTRCEALQATS
MAVRQQFGHLGRDAARGVQLRHDHGSCFTADDFQTQIRAWGMTPSFAFVGQPETNGVVER
FFRTLKEQIVHGRVYETIEDVREAVRAFIARYNAEWLVEKNGYLSPAALRRQHQLAAMPM
AA
>fig|991955.4.peg.1354 Transposase for insertion sequences IS1326/IS1353 [Vibrio cholerae HC-28A1]
MSKREIARRTGLSRNTLKKYLSQEQVEPAYPQRACVSKLDAFETLLTEALEREVKKPRKQ
RKTVKQLYHELVPQGYTGSYDRVAAFARLWRQQQTVSKQVYVPLQFAPGEAFQFDWGENW
VSIGGKKVKVQVAHFKLCHSKVSYQRAYWTQTHEMLFDAHTQAFRVFGGVPERGIYDNMK
TAVDKIGRGKERVVNKRFQAMASHYLFEADFCNPAAGWEKGQVEKAVQDGRYALWHKAPG
FNSLEALNDWLEQECQAVWQQQQHPEFKPHTLWQCLQEERLHLMHISSGFDGFIEHSKQV
SSTCLITFENNKYSVPASFANRRVSLRVYPAVLHIIAEGRKVTEHLRVFTRDHNAPGQVL
YNWRHYLLVAQRKPGSLRNGAPFQTLPESFKQLQQVLLRKIGGDRQMVDVLALVLHHEAE
LVEQAITEALQSGCASKDHVINCLHRLIEAPPPEPVPVAAHLQLSIEPLSDPSRYEQLGG
GYAH
End_of_Tpns

our @Tpns = &gjoseqlib::read_fasta(\$tpn_reps);
$Tpn_Data{tpns}     = \@Tpns;




MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3