[Bio] / FigKernelPackages / FIGO.pm Repository:
ViewVC logotype

Annotation of /FigKernelPackages/FIGO.pm

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.4 - (view) (download) (as text)

1 : overbeek 1.1 #
2 :     # Copyright (c) 2003-2006 University of Chicago and Fellowship
3 :     # for Interpretations of Genomes. All Rights Reserved.
4 :     #
5 :     # This file is part of the SEED Toolkit.
6 :     #
7 :     # The SEED Toolkit is free software. You can redistribute
8 :     # it and/or modify it under the terms of the SEED Toolkit
9 :     # Public License.
10 :     #
11 :     # You should have received a copy of the SEED Toolkit Public License
12 :     # along with this program; if not write to the University of Chicago
13 :     # at info@ci.uchicago.edu or the Fellowship for Interpretation of
14 :     # Genomes at veronika@thefig.info or download a copy from
15 :     # http://www.theseed.org/LICENSE.TXT.
16 :     #
17 :    
18 :     package FIGO;
19 :    
20 :     use strict;
21 :     use FIG;
22 :     use FIG_Config;
23 :     use SFXlate;
24 :     use SproutFIG;
25 :     use Tracer;
26 :     use Data::Dumper;
27 :     use FigFams;
28 : overbeek 1.3 use gjoparseblast;
29 : overbeek 1.1
30 : overbeek 1.4 =head1 FIGO Methods
31 :    
32 :     =head3 new
33 :    
34 :     Constructs a new FIGO object.
35 :    
36 :     =over4
37 :    
38 :     =item USAGE:
39 :    
40 :     C<< my $figo = FIGO->new(); #...Subclass defaults to FIG >>
41 :    
42 :     C<< my $figo = FIGO->new('SPROUT'); #...Subclass is a SPROUT object >>
43 :    
44 :     =back
45 :    
46 :     =cut
47 :    
48 : overbeek 1.1 sub new {
49 :     my($class,$low_level) = @_;
50 :    
51 :     my $fig;
52 :     if ($low_level && ($low_level =~ /sprout/i))
53 :     {
54 :     $fig = new SproutFIG($FIG_Config::sproutDB, $FIG_Config::sproutData);
55 :     }
56 :     else
57 :     {
58 :     $fig = new FIG;
59 :     }
60 :    
61 :     my $self = {};
62 :     $self->{_fig} = $fig;
63 : overbeek 1.3 $self->{_tmp_dir} = $FIG_Config::temp;
64 : overbeek 1.1 return bless $self, $class;
65 :     }
66 :    
67 : overbeek 1.4
68 :    
69 :     =head3 genomes
70 :    
71 :     Returns a list of Taxonomy-IDs, possibly constrained by selection criteria.
72 :     (Default: Empty constraint returns all Tax-IDs in the SEED or SPROUT.)
73 :    
74 :     =over4
75 :    
76 :     =item USAGE:
77 :    
78 :     C<< my @tax_ids = $figo->genomes(); >>
79 :    
80 :     C<< my @tax_ids = $figo->genomes( @constraints ); >>
81 :    
82 :     =item @constraints
83 :     One or more element of: complete, prokaryotic, eukaryotic, bacterial, archaeal, nmpdr.
84 :    
85 :     =item RETURNS: List of Tax-IDs.
86 :    
87 :     =item EXAMPLE: L<Display all complete, prokaryotic genomes>
88 :    
89 :     =back
90 :    
91 :     =cut
92 :    
93 : overbeek 1.1 sub genomes {
94 :     my($self,@constraints) = @_;
95 :     my $fig = $self->{_fig};
96 :    
97 :     my %constraints = map { $_ => 1 } @constraints;
98 :     my @genomes = ();
99 :    
100 :     if ($constraints{complete})
101 :     {
102 :     @genomes = $fig->genomes('complete');
103 :     }
104 :     else
105 :     {
106 :     @genomes = $fig->genomes;
107 :     }
108 :    
109 :     if ($constraints{prokaryotic})
110 :     {
111 :     @genomes = grep { $fig->is_prokaryotic($_) } @genomes;
112 :     }
113 :    
114 :     if ($constraints{eukaryotic})
115 :     {
116 :     @genomes = grep { $fig->is_eukaryotic($_) } @genomes;
117 :     }
118 :    
119 :     if ($constraints{bacterial})
120 :     {
121 :     @genomes = grep { $fig->is_bacterial($_) } @genomes;
122 :     }
123 :    
124 :     if ($constraints{archaeal})
125 :     {
126 :     @genomes = grep { $fig->is_archaeal($_) } @genomes;
127 :     }
128 :    
129 :     if ($constraints{nmpdr})
130 :     {
131 :     @genomes = grep { $fig->is_NMPDR_genome($_) } @genomes;
132 :     }
133 :    
134 :     return map { &GenomeO::new('GenomeO',$self,$_) } @genomes;
135 :     }
136 :    
137 : overbeek 1.4
138 :    
139 :     =head3 subsystems
140 :    
141 :     =over4
142 :    
143 :     =item RETURNS:
144 :     List of all subsystems.
145 :    
146 :     =item EXAMPLE: L<Accessing Subsystem data>
147 :    
148 :     =back
149 :    
150 :     =cut
151 :    
152 : overbeek 1.1 sub subsystems {
153 :     my($self) = @_;
154 :     my $fig = $self->{_fig};
155 :    
156 :     return map { &SubsystemO::new('SubsystemO',$self,$_) } $fig->all_subsystems;
157 :     }
158 :    
159 : overbeek 1.4
160 :     =head3 functional_roles
161 :    
162 :     (Not yet implemented)
163 :    
164 :     =over
165 :    
166 :     =item RETURNS:
167 :    
168 :     =item EXAMPLE:
169 :    
170 :     =back
171 :    
172 :     =cut
173 :    
174 : overbeek 1.1 sub functional_roles {
175 :     my($self) = @_;
176 :     my $fig = $self->{_fig};
177 :    
178 :     my @functional_roles = ();
179 :    
180 :     return @functional_roles;
181 :     }
182 :    
183 : overbeek 1.4
184 :    
185 :     =head3 all_figfams
186 :    
187 :     Returns a list of all FIGfam objects.
188 :    
189 :     =over4
190 :    
191 :     =item USAGE: C<< foreach $fam ($figO->all_figfams) { #...Do something } >>
192 :    
193 :     =item RETURNS: List of FIGfam Objects
194 :    
195 :     =item EXAMPLE: L<Accessing FIGfams>
196 :    
197 :     =back
198 :    
199 :     =cut
200 :    
201 : overbeek 1.1 sub all_figfams {
202 :     my($self) = @_;
203 :     my $fig = $self->{_fig};
204 :     my $fams = new FigFams($fig);
205 :     return map { &FigFamO::new('FigFamO',$self,$_) } $fams->all_families;
206 :     }
207 :    
208 : overbeek 1.4
209 :    
210 :     =head3 family_containing
211 :    
212 :     =over4
213 :    
214 :     =item USAGE: C<< my ($fam, $sims) = $figO->family_containing($seq); >>
215 :    
216 :     =item $seq: A protein translation string.
217 :    
218 :     =item RETURNS:
219 :     $fam: A FIGfam Object.
220 :     $sims: A set of similarity objects.
221 :    
222 :     =item EXAMPLE: L<Placing a sequence into a FIGfam>
223 :    
224 :     =back
225 :    
226 :     =cut
227 :    
228 : overbeek 1.1 sub family_containing {
229 :     my($self,$seq) = @_;
230 :    
231 :     my $fig = $self->{_fig};
232 :     my $fams = new FigFams($fig);
233 :     my($fam,$sims) = $fams->place_in_family($seq);
234 :     if ($fam)
235 :     {
236 :     return (&FigFamO::new('FigFamO',$self,$fam->family_id),$sims);
237 :     }
238 :     else
239 :     {
240 :     return undef;
241 :     }
242 :     }
243 :    
244 : overbeek 1.4
245 :     ########################################################################
246 : overbeek 1.1 package GenomeO;
247 : overbeek 1.4 ########################################################################
248 :     use Data::Dumper;
249 :    
250 :     =head1 GenomeO
251 :    
252 :     =cut
253 :    
254 :     =head3 new
255 :    
256 :     Constructor of GenomeO objects.
257 : overbeek 1.1
258 : overbeek 1.4 =over4
259 :    
260 :     =item USAGE:
261 :     C<< my $org = GenomeO->new($figo, $tax_id); >>
262 :    
263 :     =item RETURNS: A new GenomeO object.
264 :    
265 :     =back
266 :    
267 :     =cut
268 : overbeek 1.1
269 :     sub new {
270 :     my($class,$figO,$genomeId) = @_;
271 :    
272 :     my $self = {};
273 :     $self->{_figO} = $figO;
274 :     $self->{_id} = $genomeId;
275 :     return bless $self, $class;
276 :     }
277 :    
278 : overbeek 1.4
279 :    
280 :     =head3 id
281 :    
282 :     =over4
283 :    
284 :     =item USAGE: C<< my $tax_id = $org->id(); >>
285 :    
286 :     =item RETURNS: Taxonomy-ID of GenomeO object.
287 :    
288 :     =back
289 :    
290 :     =cut
291 :    
292 : overbeek 1.1 sub id {
293 :     my($self) = @_;
294 :    
295 :     return $self->{_id};
296 :     }
297 :    
298 : overbeek 1.4
299 :    
300 :     =head3 genus_species
301 :    
302 :     =over4
303 :    
304 :     =item USAGE: C<< $gs = $genome->genus_species(); >>
305 :    
306 :     =item RETURNS: Genus-species-strain string
307 :    
308 :     =back
309 :    
310 :     =cut
311 :    
312 : overbeek 1.1 sub genus_species {
313 :     my($self) = @_;
314 :    
315 :     my $fig = $self->{_figO}->{_fig};
316 :     return $fig->genus_species($self->{_id});
317 :     }
318 :    
319 : overbeek 1.4
320 :     =head3 contigs_of
321 :    
322 :     =over4
323 :    
324 :     =item RETURNS: List of C<contig> objects contained in a C<GenomeO> object.
325 :    
326 :     =item EXAMPLE: L<Show how to access contigs and extract sequence>
327 :    
328 :     =back
329 :    
330 :     =cut
331 :    
332 : overbeek 1.1 sub contigs_of {
333 :     my($self) = @_;
334 :    
335 :     my $figO = $self->{_figO};
336 :     my $fig = $figO->{_fig};
337 :     return map { &ContigO::new('ContigO',$figO,$self->id,$_) } $fig->contigs_of($self->id);
338 :     }
339 :    
340 : overbeek 1.4
341 :    
342 :     =head3 features_of
343 :    
344 :     =cut
345 :    
346 : overbeek 1.1 sub features_of {
347 :     my($self,$type) = @_;
348 :    
349 :     my $figO = $self->{_figO};
350 :     my $fig = $figO->{_fig};
351 :    
352 :     return map { &FeatureO::new('FeatureO',$figO,$_) } $fig->all_features($self->id,$type);
353 :     }
354 :    
355 : overbeek 1.4
356 :     =head3 display
357 :    
358 :     Prints the genus, species, and strain information about a genome to STDOUT.
359 :    
360 :     =over4
361 :    
362 :     =item USAGE: C<< $genome->display(); >>
363 :    
364 :     =item RETURNS: Null
365 :    
366 :     =back
367 :    
368 :     =cut
369 :    
370 : overbeek 1.1 sub display {
371 :     my($self) = @_;
372 :    
373 :     print join("\t",("Genome",$self->id,$self->genus_species)),"\n";
374 :     }
375 :    
376 : overbeek 1.4
377 :    
378 :     ########################################################################
379 : overbeek 1.1 package ContigO;
380 : overbeek 1.4 ########################################################################
381 :     use Data::Dumper;
382 :    
383 :     =head1 ContigO
384 :    
385 :     Methods for working with DNA sequence objects.
386 :    
387 :     =cut
388 :    
389 :     =head3 new
390 :    
391 :     Contig constructor.
392 : overbeek 1.1
393 : overbeek 1.4 =over4
394 :    
395 :     =item USAGE:
396 :     C<< $contig = ContigO->new( $figO, $genomeId, $contigId); >>
397 :    
398 :     =item $figO: A FIGO object.
399 :    
400 :     =item $genomeId: Taxon-ID for the genome the contig is from.
401 :    
402 :     =item $contigId: Identifier for the contig
403 :    
404 :     =item RETURNS: A "ContigO" object.
405 :    
406 :     =back
407 :    
408 :     =cut
409 : overbeek 1.1
410 :     sub new {
411 :     my($class,$figO,$genomeId,$contigId) = @_;
412 :    
413 :     my $self = {};
414 :     $self->{_figO} = $figO;
415 :     $self->{_id} = $contigId;
416 :     $self->{_genome} = $genomeId;
417 :     return bless $self, $class;
418 :     }
419 :    
420 : overbeek 1.4
421 :    
422 :     =head3 id
423 :    
424 :     =over4
425 :    
426 :     =item RETURNS: Sequence ID string of "ContigO" object
427 :    
428 :     =back
429 :    
430 :     =cut
431 :    
432 : overbeek 1.1 sub id {
433 :     my($self) = @_;
434 :    
435 :     return $self->{_id};
436 :     }
437 :    
438 : overbeek 1.4
439 :     =head3 genome
440 :    
441 :     =over4
442 :    
443 :     =item USAGE:
444 :     C<< my $tax_id = $contig->genome(); >>
445 :    
446 :     =item RETURNS: GenomeO object containing the contig object.
447 :    
448 :     =back
449 :    
450 :     =cut
451 :    
452 : overbeek 1.1 sub genome {
453 :     my($self) = @_;
454 :    
455 :     return $self->{_genome};
456 :     }
457 :    
458 : overbeek 1.4
459 :    
460 :     =head3 contig_length
461 :    
462 :     =over4
463 :    
464 :     =item USAGE:
465 :     C<< my $len = $contig->contig_length(); >>
466 :    
467 :     =item RETURNS: Length of contig's DNA sequence.
468 :    
469 :     =back
470 :    
471 :     =cut
472 :    
473 : overbeek 1.1 sub contig_length {
474 :     my($self) = @_;
475 :    
476 :     my $fig = $self->{_figO}->{_fig};
477 :     my $contig_lengths = $fig->contig_lengths($self->genome);
478 :     return $contig_lengths->{$self->id};
479 :     }
480 :    
481 : overbeek 1.4
482 :     =head3 dna_seq
483 :    
484 :     =over4
485 :    
486 :     =item USAGE:
487 :     C<< my $seq = $contig->dna_seq(beg, $end); >>
488 :    
489 :     =item $beg: Begining point of DNA subsequence
490 :    
491 :     =item $end: End point of DNA subsequence
492 :    
493 :     =item RETURNS: string of DNA sequence from $beg to $end
494 :    
495 :     (NOTE: if $beg > $end, returns reverse complement of DNA subsequence.)
496 :    
497 :     =back
498 :    
499 :     =cut
500 :    
501 : overbeek 1.1 sub dna_seq {
502 :     my($self,$beg,$end) = @_;
503 :    
504 :     my $fig = $self->{_figO}->{_fig};
505 :     my $max = $self->contig_length;
506 :     if (($beg && (&FIG::between(1,$beg,$max))) &&
507 :     ($end && (&FIG::between(1,$end,$max))))
508 :     {
509 :     return $fig->dna_seq($self->genome,join("_",($self->id,$beg,$end)));
510 :     }
511 :     else
512 :     {
513 :     return undef;
514 :     }
515 :     }
516 :    
517 : overbeek 1.4
518 :     =head3 display
519 :    
520 :     Prints summary information about a "ContigO" object to STDOUT:
521 :    
522 :     Genus, species, strain
523 :    
524 :     Contig ID
525 :    
526 :     Contig length
527 :    
528 :     =over4
529 :    
530 :     =item RETURNS: Nil
531 :    
532 :     =back
533 :    
534 :     =cut
535 :    
536 : overbeek 1.1 sub display {
537 :     my($self) = @_;
538 :    
539 :     print join("ContigO",$self->genome,$self->id,$self->contig_length),"\n";
540 :     }
541 :    
542 : overbeek 1.4
543 :    
544 :     ########################################################################
545 : overbeek 1.1 package FeatureO;
546 : overbeek 1.4 ########################################################################
547 :     use Data::Dumper;
548 :    
549 :     =head1 FeatureO
550 :    
551 :     =cut
552 :    
553 : overbeek 1.1
554 : overbeek 1.4
555 :     =head1 new
556 :    
557 :     Constructor of "FeatureO" objects
558 :    
559 :     =cut
560 : overbeek 1.1
561 :     sub new {
562 :     my($class,$figO,$fid) = @_;
563 :    
564 :     ($fid =~ /^fig\|\d+\.\d+\.[^\.]+\.\d+$/) || return undef;
565 :     my $self = {};
566 :     $self->{_figO} = $figO;
567 :     $self->{_id} = $fid;
568 :     return bless $self, $class;
569 :     }
570 :    
571 : overbeek 1.4
572 :     =head3 id
573 :    
574 :     =cut
575 :    
576 : overbeek 1.1 sub id {
577 :     my($self) = @_;
578 :    
579 :     return $self->{_id};
580 :     }
581 :    
582 : overbeek 1.4
583 :    
584 :     =head3 genome
585 :    
586 :     =cut
587 :    
588 : overbeek 1.1 sub genome {
589 :     my($self) = @_;
590 :    
591 :     $self->id =~ /^fig\|(\d+\.\d+)/;
592 :     return $1;
593 :     }
594 :    
595 : overbeek 1.4
596 :    
597 :     =head3 type
598 :    
599 :     =cut
600 :    
601 : overbeek 1.1 sub type {
602 :     my($self) = @_;
603 :    
604 :     $self->id =~ /^fig\|\d+\.\d+\.([^\.]+)/;
605 :     return $1;
606 :     }
607 :    
608 : overbeek 1.4
609 :    
610 :    
611 :     =head3 location
612 :    
613 :     =cut
614 :    
615 : overbeek 1.1 sub location {
616 :     my($self) = @_;
617 :    
618 :     my $fig = $self->{_figO}->{_fig};
619 :     return scalar $fig->feature_location($self->id);
620 :     }
621 :    
622 : overbeek 1.4
623 :    
624 :     =head3 dna_seq
625 :    
626 :     =cut
627 :    
628 : overbeek 1.1 sub dna_seq {
629 :     my($self) = @_;
630 :    
631 :     my $fig = $self->{_figO}->{_fig};
632 :     my $fid = $self->id;
633 :     my @loc = $fig->feature_location($fid);
634 :     return $fig->dna_seq(&FIG::genome_of($fid),@loc);
635 :     }
636 :    
637 : overbeek 1.4
638 :    
639 :     =head3 prot_seq
640 :    
641 :     =cut
642 :    
643 : overbeek 1.1 sub prot_seq {
644 :     my($self) = @_;
645 :    
646 :     ($self->type eq "peg") || return undef;
647 :     my $fig = $self->{_figO}->{_fig};
648 :     my $fid = $self->id;
649 :     return $fig->get_translation($fid);
650 :     }
651 :    
652 : overbeek 1.4
653 :    
654 :     =head3 function_of
655 :    
656 :     =cut
657 :    
658 : overbeek 1.1 sub function_of {
659 :     my($self) = @_;
660 :    
661 :     my $fig = $self->{_figO}->{_fig};
662 :     my $fid = $self->id;
663 :     return scalar $fig->function_of($fid);
664 :     }
665 :    
666 : overbeek 1.4
667 :    
668 :     =head3 coupled_to
669 :    
670 :     =cut
671 :    
672 : overbeek 1.1 sub coupled_to {
673 :     my($self) = @_;
674 :    
675 :     ($self->type eq "peg") || return undef;
676 :     my $figO = $self->{_figO};
677 :     my $fig = $figO->{_fig};
678 :     my $peg1 = $self->id;
679 :     my @coupled = ();
680 :     foreach my $tuple ($fig->coupled_to($peg1))
681 :     {
682 :     my($peg2,$sc) = @$tuple;
683 :     push(@coupled, &CouplingO::new('CouplingO',$figO,$peg1,$peg2,$sc));
684 :     }
685 :     return @coupled;
686 :     }
687 :    
688 : overbeek 1.4
689 :    
690 :     =head3 annotations
691 :    
692 :     =cut
693 :    
694 : overbeek 1.1 sub annotations {
695 :     my($self) = @_;
696 :    
697 :     my $figO = $self->{_figO};
698 :     my $fig = $figO->{_fig};
699 :    
700 :     return map { &AnnotationO::new('AnnotationO',@$_) } $fig->feature_annotations($self->id,1);
701 :     }
702 :    
703 : overbeek 1.4
704 :    
705 :     =head3 possibly_truncated
706 :    
707 :     =cut
708 :    
709 : overbeek 1.3 sub possibly_truncated {
710 :     my($self) = @_;
711 :     my $figO = $self->{_figO};
712 :     my $fig = $figO->{_fig};
713 :    
714 :     return $fig->possibly_truncated($self->id);
715 :     }
716 :    
717 : overbeek 1.4
718 :    
719 :     =head3 possible_frameshift
720 :    
721 :     =cut
722 :    
723 : overbeek 1.3 sub possible_frameshift {
724 :     my($self) = @_;
725 :     my $figO = $self->{_figO};
726 :     my($tmp_dir) = $figO->{_tmp_dir};
727 :    
728 :     if (! $self->possibly_truncated)
729 :     {
730 :     my @sims = $self->sims( -max => 1, -cutoff => 1.0e-50);
731 :     if (my $sim = shift @sims)
732 :     {
733 :     my $peg2 = $sim->id2;
734 :     my $ln1 = $sim->ln1;
735 :     my $ln2 = $sim->ln2;
736 :     my $b2 = $sim->b2;
737 :     my $e2 = $sim->e2;
738 :     my $adjL = 100 + (($b2-1) * 3);
739 :     my $adjR = 100 + (($ln2 - $e2) * 3);
740 :     if ($ln2 > (1.2 * $ln1))
741 :     {
742 :     my $loc = $self->location;
743 :     if ($loc =~ /^(\S+)_(\d+)_(\d+)/)
744 :     {
745 :     my $contig = $1;
746 :     my $beg = $2;
747 :     my $end = $3;
748 :     my $contigO = new ContigO($figO,$self->genome,$contig);
749 :     my $begA = &max(1,$beg - $adjL);
750 :     my $endA = &min($end+$adjR,$contigO->contig_length);
751 :     my $dna = $contigO->dna_seq($begA,$endA);
752 :     open(TMP,">$tmp_dir/tmp_dna") || die "couild not open tmp_dna";
753 :     print TMP ">dna\n$dna\n";
754 :     close(TMP);
755 :    
756 :     my $peg2O = new FeatureO($figO,$peg2);
757 :     my $prot = $peg2O->prot_seq;
758 :     open(TMP,">$tmp_dir/tmp_prot") || die "could not open tmp_prot";
759 :     print TMP ">tmp_prot\n$prot\n";
760 :     close(TMP);
761 :     &run("formatdb -i $tmp_dir/tmp_dna -pF");
762 :     open(BLAST,"blastall -i $tmp_dir/tmp_prot -d $tmp_dir/tmp_dna -p tblastn -FF -e 1.0e-50 |")
763 :     || die "could not blast";
764 :    
765 :     my $db_seq_out = &gjoparseblast::next_blast_subject(\*BLAST,1);
766 :     my @hsps = sort { $a->[0] <=> $b->[0] }
767 :     map { [$_->[9],$_->[10],$_->[12],$_->[13]] }
768 :     grep { $_->[1] < 1.0e-50 }
769 :     @{$db_seq_out->[6]};
770 :     my @prot = map { [$_->[0],$_->[1]] } @hsps;
771 :     my @dna = map { [$_->[2],$_->[3]] } @hsps;
772 :     if (&covers(\@prot,length($prot),3) && &covers(\@dna,3*length($prot),9))
773 :     {
774 :     return 1;
775 :     }
776 :     }
777 :     }
778 :     }
779 :     }
780 :     return 0;
781 :     }
782 :    
783 : overbeek 1.4
784 :    
785 :     =head3 run
786 :    
787 :     =cut
788 :    
789 : overbeek 1.3 sub run {
790 :     my($cmd) = @_;
791 :     (system($cmd) == 0) || Confess("FAILED: $cmd");
792 :     }
793 :    
794 : overbeek 1.4
795 :    
796 :     =head3 max
797 :    
798 :     =cut
799 :    
800 : overbeek 1.3 sub max {
801 :     my($x,$y) = @_;
802 :     return ($x < $y) ? $y : $x;
803 :     }
804 :    
805 : overbeek 1.4
806 :    
807 :     =head3 min
808 :    
809 :     =cut
810 :    
811 : overbeek 1.3 sub min {
812 :     my($x,$y) = @_;
813 :     return ($x < $y) ? $x : $y;
814 :     }
815 :    
816 : overbeek 1.4
817 :    
818 :     =head3 covers
819 :    
820 :     =cut
821 :    
822 : overbeek 1.3 sub covers {
823 :     my($hsps,$ln,$diff) = @_;
824 :    
825 :     my $hsp1 = shift @$hsps;
826 :     my $hsp2;
827 :     while ($hsp1 && ($hsp2 = shift @$hsps) && ($hsp1 = &merge($hsp1,$hsp2,$diff))) {}
828 :     return ($hsp1 && (($hsp1->[1] - $hsp1->[0]) > (0.9 * $ln)));
829 :     }
830 :    
831 : overbeek 1.4
832 :    
833 :     =head3 merge
834 :    
835 :     =cut
836 :    
837 : overbeek 1.3 sub merge {
838 :     my($hsp1,$hsp2,$diff) = @_;
839 :    
840 :     my($b1,$e1) = @$hsp1;
841 :     my($b2,$e2) = @$hsp2;
842 :     return (($e2 > $e1) && (abs($b2-$e1) <= $diff)) ? [$b1,$e2] : undef;
843 :     }
844 :    
845 : overbeek 1.4
846 :    
847 :     =head3 sims
848 :    
849 :     =cut
850 :    
851 : overbeek 1.2 use Sim;
852 :     sub sims {
853 :     my($self,%args) = @_;
854 :    
855 :     my $figO = $self->{_figO};
856 :     my $fig = $figO->{_fig};
857 :    
858 :     my $cutoff = $args{-cutoff} ? $args{-cutoff} : 1.0e-5;
859 :     my $all = $args{-all} ? $args{-all} : "fig";
860 :     my $max = $args{-max} ? $args{-max} : 10000;
861 :    
862 :     return $fig->sims($self->id,$max,$cutoff,$all);
863 :     }
864 :    
865 : overbeek 1.4
866 :    
867 :     =head3 bbhs
868 :    
869 :     =cut
870 :    
871 : overbeek 1.2 sub bbhs {
872 :     my($self) = @_;
873 :    
874 :     my $figO = $self->{_figO};
875 :     my $fig = $figO->{_fig};
876 :    
877 :     my @bbhs = $fig->bbhs($self->id);
878 :     return map { my($peg2,$sc,$bs) = @$_; bless({ _peg1 => $self->id,
879 :     _peg2 => $peg2,
880 :     _psc => $sc,
881 :     _bit_score => $bs
882 :     },'BBHO') } @bbhs;
883 :     }
884 :    
885 : overbeek 1.4 =head3 display
886 :    
887 :     =cut
888 :    
889 : overbeek 1.1 sub display {
890 :     my($self) = @_;
891 :    
892 :     print join("\t",$self->id,$self->location,$self->function_of),"\n",
893 :     $self->dna_seq,"\n",
894 :     $self->prot_seq,"\n";
895 :     }
896 :    
897 : overbeek 1.4
898 :    
899 :     ########################################################################
900 : overbeek 1.2 package BBHO;
901 : overbeek 1.4 ########################################################################
902 :    
903 :     =head1 BBHO
904 :    
905 :     =cut
906 :    
907 :    
908 :     =head3 new
909 :    
910 :     =cut
911 : overbeek 1.2
912 :     sub new {
913 :     my($class,$peg1,$peg2,$sc,$normalized_bitscore) = @_;
914 :    
915 :     my $self = {};
916 :     $self->{_peg1} = $peg1;
917 :     $self->{_peg2} = $peg2;
918 :     $self->{_psc} = $sc;
919 :     $self->{_bit_score} = $normalized_bitscore
920 :    
921 :     }
922 :    
923 : overbeek 1.4
924 :     =head3 peg1
925 :    
926 :     =cut
927 :    
928 : overbeek 1.2 sub peg1 {
929 :     my($self) = @_;
930 :    
931 :     return $self->{_peg1};
932 :     }
933 :    
934 : overbeek 1.4
935 :    
936 :     =head3 peg1
937 :    
938 :     =cut
939 :    
940 : overbeek 1.2 sub peg2 {
941 :     my($self) = @_;
942 :    
943 :     return $self->{_peg2};
944 :     }
945 :    
946 : overbeek 1.4
947 :    
948 :     =head3 psc
949 :    
950 :     =cut
951 :    
952 : overbeek 1.2 sub psc {
953 :     my($self) = @_;
954 :    
955 :     return $self->{_psc};
956 :     }
957 :    
958 : overbeek 1.4
959 :    
960 :     =head3 norm_bitscore
961 :    
962 :     =cut
963 :    
964 : overbeek 1.2 sub norm_bitscore {
965 :     my($self) = @_;
966 :    
967 :     return $self->{_bit_score};
968 :     }
969 :    
970 : overbeek 1.4
971 :    
972 :     ########################################################################
973 : overbeek 1.1 package AnnotationO;
974 : overbeek 1.4 ########################################################################
975 :    
976 :     =head1 AnnotationO
977 :    
978 :     =cut
979 :    
980 :    
981 :    
982 :     =head3 new
983 :    
984 :     =cut
985 : overbeek 1.1
986 :     sub new {
987 :     my($class,$fid,$timestamp,$who,$text) = @_;
988 :    
989 :     my $self = {};
990 :     $self->{_fid} = $fid;
991 :     $self->{_timestamp} = $timestamp;
992 :     $self->{_who} = $who;
993 :     $self->{_text} = $text;
994 :     return bless $self, $class;
995 :     }
996 :    
997 : overbeek 1.4
998 :    
999 :     =head3 fid
1000 :    
1001 :     =cut
1002 :    
1003 : overbeek 1.1 sub fid {
1004 :     my($self) = @_;
1005 :    
1006 :     return $self->{_fid};
1007 :     }
1008 :    
1009 : overbeek 1.4
1010 :    
1011 :     =head3 timestamp
1012 :    
1013 :     =cut
1014 :    
1015 : overbeek 1.1 sub timestamp {
1016 :     my($self,$convert) = @_;
1017 :    
1018 :     if ($convert)
1019 :     {
1020 :     return scalar localtime($self->{_timestamp});
1021 :     }
1022 :     else
1023 :     {
1024 :     return $self->{_timestamp};
1025 :     }
1026 :     }
1027 :    
1028 : overbeek 1.4
1029 :    
1030 :     =head3 made_by
1031 :    
1032 :     =cut
1033 :    
1034 : overbeek 1.1 sub made_by {
1035 :     my($self) = @_;
1036 :    
1037 :     my $who = $self->{_who};
1038 :     $who =~ s/^master://i;
1039 :     return $who;
1040 :     }
1041 :    
1042 : overbeek 1.4
1043 :    
1044 :     =head3 text
1045 :    
1046 :     =cut
1047 :    
1048 : overbeek 1.1 sub text {
1049 :     my($self) = @_;
1050 :    
1051 :     my $text = $self->{_text};
1052 :     return $text;
1053 :     }
1054 :    
1055 : overbeek 1.4
1056 :     =head3 display
1057 :    
1058 :     =cut
1059 :    
1060 : overbeek 1.1 sub display {
1061 :     my($self) = @_;
1062 :    
1063 :     print join("\t",($self->fid,$self->timestamp(1),$self->made_by)),"\n",$self->text,"\n";
1064 :     }
1065 :    
1066 : overbeek 1.4
1067 :    
1068 :     ########################################################################
1069 : overbeek 1.1 package CouplingO;
1070 : overbeek 1.4 ########################################################################
1071 :     use Data::Dumper;
1072 :    
1073 :     =head3 new
1074 : overbeek 1.1
1075 : overbeek 1.4 =cut
1076 : overbeek 1.1
1077 :     sub new {
1078 :     my($class,$figO,$peg1,$peg2,$sc) = @_;
1079 :    
1080 :     ($peg1 =~ /^fig\|\d+\.\d+\.peg\.\d+$/) || return undef;
1081 :     ($peg2 =~ /^fig\|\d+\.\d+\.peg\.\d+$/) || return undef;
1082 :     my $self = {};
1083 :     $self->{_figO} = $figO;
1084 :     $self->{_peg1} = $peg1;
1085 :     $self->{_peg2} = $peg2;
1086 :     $self->{_sc} = $sc;
1087 :     return bless $self, $class;
1088 :     }
1089 :    
1090 : overbeek 1.4
1091 :    
1092 :     =head3 peg1
1093 :    
1094 :     =cut
1095 :    
1096 : overbeek 1.1 sub peg1 {
1097 :     my($self) = @_;
1098 :    
1099 :     return $self->{_peg1};
1100 :     }
1101 :    
1102 : overbeek 1.4
1103 :    
1104 :     =head3 peg1
1105 :    
1106 :     =cut
1107 :    
1108 : overbeek 1.1 sub peg2 {
1109 :     my($self) = @_;
1110 :    
1111 :     return $self->{_peg2};
1112 :     }
1113 :    
1114 : overbeek 1.4
1115 :    
1116 :     =head3 sc
1117 :    
1118 :     =cut
1119 :    
1120 : overbeek 1.1 sub sc {
1121 :     my($self) = @_;
1122 :    
1123 :     return $self->{_sc};
1124 :     }
1125 :    
1126 : overbeek 1.4
1127 :    
1128 :     =head3 evidence
1129 :    
1130 :     =cut
1131 :    
1132 : overbeek 1.1 sub evidence {
1133 :     my($self) = @_;
1134 :    
1135 :     my $figO = $self->{_figO};
1136 :     my $fig = $figO->{_fig};
1137 :     my @ev = ();
1138 :     foreach my $tuple ($fig->coupling_evidence($self->peg1,$self->peg2))
1139 :     {
1140 :     my($peg3,$peg4,$rep) = @$tuple;
1141 :     push(@ev,[&FeatureO::new('FeatureO',$figO,$peg3),
1142 :     &FeatureO::new('FeatureO',$figO,$peg4),
1143 :     $rep]);
1144 :     }
1145 :     return @ev;
1146 :     }
1147 :    
1148 : overbeek 1.4
1149 :    
1150 :     =head3 display
1151 :    
1152 :     =cut
1153 :    
1154 : overbeek 1.1 sub display {
1155 :     my($self) = @_;
1156 :    
1157 :     print join("\t",($self->peg1,$self->peg2,$self->sc)),"\n";
1158 :     }
1159 :    
1160 : overbeek 1.4
1161 :    
1162 :     ########################################################################
1163 : overbeek 1.1 package SubsystemO;
1164 : overbeek 1.4 ########################################################################
1165 : overbeek 1.1 use Data::Dumper;
1166 :     use Subsystem;
1167 :    
1168 : overbeek 1.4 =head1 SubsystemO
1169 :    
1170 :     =cut
1171 :    
1172 :    
1173 :    
1174 :     =head3 new
1175 :    
1176 :     =cut
1177 :    
1178 : overbeek 1.1 sub new {
1179 :     my($class,$figO,$name) = @_;
1180 :    
1181 :     my $self = {};
1182 :     $self->{_figO} = $figO;
1183 :     $self->{_id} = $name;
1184 :    
1185 :     return bless $self, $class;
1186 :     }
1187 :    
1188 : overbeek 1.4
1189 :    
1190 :     =head3 id
1191 :    
1192 :     =cut
1193 :    
1194 : overbeek 1.1 sub id {
1195 :     my($self) = @_;
1196 :    
1197 :     return $self->{_id};
1198 :     }
1199 :    
1200 : overbeek 1.4
1201 :    
1202 :     =head3 usable
1203 :    
1204 :     =cut
1205 :    
1206 : overbeek 1.1 sub usable {
1207 :     my($self) = @_;
1208 :    
1209 :     my $figO = $self->{_figO};
1210 :     my $fig = $figO->{_fig};
1211 :     return $fig->usable_subsystem($self->id);
1212 :     }
1213 :    
1214 : overbeek 1.4
1215 :    
1216 :     =head3 genomes
1217 :    
1218 :     =cut
1219 :    
1220 : overbeek 1.1 sub genomes {
1221 :     my($self) = @_;
1222 :    
1223 :     my $figO = $self->{_figO};
1224 :     my $subO = $self->{_subO};
1225 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
1226 :    
1227 :     return map { &GenomeO::new('GenomeO',$figO,$_) } $subO->get_genomes;
1228 :     }
1229 :    
1230 : overbeek 1.4
1231 :    
1232 :     =head3 roles
1233 :    
1234 :     =cut
1235 :    
1236 : overbeek 1.1 sub roles {
1237 :     my($self) = @_;
1238 :    
1239 :     my $figO = $self->{_figO};
1240 :     my $subO = $self->{_subO};
1241 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
1242 :    
1243 :     return map { &FunctionalRoleO::new('FunctionalRoleO',$figO,$_) } $subO->get_roles($self->id);
1244 :     }
1245 :    
1246 : overbeek 1.4
1247 :    
1248 :     =head3 curator
1249 :    
1250 :     =cut
1251 :    
1252 : overbeek 1.1 sub curator {
1253 :     my($self) = @_;
1254 :    
1255 :     my $figO = $self->{_figO};
1256 :     my $subO = $self->{_subO};
1257 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
1258 :    
1259 :     return $subO->get_curator;
1260 :     }
1261 :    
1262 : overbeek 1.4
1263 :    
1264 :    
1265 :     =head3 variant
1266 :    
1267 :     =cut
1268 :    
1269 : overbeek 1.1 sub variant {
1270 :     my($self,$genome) = @_;
1271 :    
1272 :     my $figO = $self->{_figO};
1273 :     my $subO = $self->{_subO};
1274 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
1275 :    
1276 :     return $subO->get_variant_code_for_genome($genome->id);
1277 :     }
1278 : overbeek 1.4
1279 :    
1280 :    
1281 :     =head3 pegs_in_cell
1282 :    
1283 :     =cut
1284 :    
1285 : overbeek 1.1 sub pegs_in_cell {
1286 :     my($self,$genome,$role) = @_;
1287 :    
1288 :     my $figO = $self->{_figO};
1289 :     my $subO = $self->{_subO};
1290 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
1291 :    
1292 :     return $subO->get_pegs_from_cell($genome->id,$role->id);
1293 :     }
1294 :    
1295 : overbeek 1.4
1296 :    
1297 :     ########################################################################
1298 : overbeek 1.1 package FunctionalRoleO;
1299 : overbeek 1.4 ########################################################################
1300 :     use Data::Dumper;
1301 : overbeek 1.1
1302 : overbeek 1.4 =head1 FunctionalRoleO
1303 :    
1304 :     =cut
1305 :    
1306 :    
1307 :     =head3 new
1308 :    
1309 :     =cut
1310 : overbeek 1.1
1311 :     sub new {
1312 :     my($class,$figO,$fr) = @_;
1313 :    
1314 :     my $self = {};
1315 :     $self->{_figO} = $figO;
1316 :     $self->{_id} = $fr;
1317 :     return bless $self, $class;
1318 :     }
1319 :    
1320 : overbeek 1.4
1321 :    
1322 :     =head3 id
1323 :    
1324 :     =cut
1325 :    
1326 : overbeek 1.1 sub id {
1327 :     my($self) = @_;
1328 :    
1329 :     return $self->{_id};
1330 :     }
1331 :    
1332 : overbeek 1.4
1333 :    
1334 :     ########################################################################
1335 : overbeek 1.1 package FigFamO;
1336 : overbeek 1.4 ########################################################################
1337 : overbeek 1.1 use FigFams;
1338 :     use FigFam;
1339 :    
1340 : overbeek 1.4
1341 :     =head1 FigFamO
1342 :    
1343 :     =cut
1344 :    
1345 :    
1346 :     =head3 new
1347 :    
1348 :     =cut
1349 :    
1350 : overbeek 1.1 sub new {
1351 :     my($class,$figO,$id) = @_;
1352 :    
1353 :     my $self = {};
1354 :     $self->{_figO} = $figO;
1355 :     $self->{_id} = $id;
1356 :     return bless $self, $class;
1357 :     }
1358 :    
1359 : overbeek 1.4
1360 :    
1361 :     =head3 id
1362 :    
1363 :     =cut
1364 :    
1365 : overbeek 1.1 sub id {
1366 :     my($self) = @_;
1367 :    
1368 :     return $self->{_id};
1369 :     }
1370 :    
1371 : overbeek 1.4
1372 :     =head3 function
1373 :    
1374 :     =cut
1375 :    
1376 : overbeek 1.1 sub function {
1377 :     my($self) = @_;
1378 :    
1379 :     my $fig = $self->{_figO}->{_fig};
1380 :     my $famO = $self->{_famO};
1381 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
1382 :    
1383 :     return $famO->family_function;
1384 :     }
1385 :    
1386 : overbeek 1.4
1387 :    
1388 :     =head3 members
1389 :    
1390 :     =cut
1391 :    
1392 : overbeek 1.1 sub members {
1393 :     my($self) = @_;
1394 :    
1395 :     my $figO = $self->{_figO};
1396 :     my $fig = $figO->{_fig};
1397 :     my $famO = $self->{_famO};
1398 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
1399 :    
1400 :     return map { &FigFamO::new('FigFamO',$figO,$_) } $famO->list_members;
1401 :     }
1402 :    
1403 : overbeek 1.4
1404 :    
1405 :     =head3 rep_seqs
1406 :    
1407 :     =cut
1408 :    
1409 : overbeek 1.1 sub rep_seqs {
1410 :     my($self) = @_;
1411 :    
1412 :     my $figO = $self->{_figO};
1413 :     my $fig = $figO->{_fig};
1414 :     my $famO = $self->{_famO};
1415 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
1416 :    
1417 :     return $famO->representatives;
1418 :     }
1419 :    
1420 : overbeek 1.4
1421 :    
1422 :     =head3 should_be_member
1423 :    
1424 :     =cut
1425 :    
1426 : overbeek 1.1 sub should_be_member {
1427 :     my($self,$seq) = @_;
1428 :    
1429 :     my $figO = $self->{_figO};
1430 :     my $fig = $figO->{_fig};
1431 :     my $famO = $self->{_famO};
1432 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
1433 :    
1434 :     return $famO->should_be_member($seq);
1435 :     }
1436 :    
1437 :    
1438 :    
1439 : overbeek 1.4 =head3 display
1440 :    
1441 :     =cut
1442 :    
1443 : overbeek 1.1 sub display {
1444 :     my($self) = @_;
1445 :    
1446 :     print join("\t",($self->id,$self->function)),"\n";
1447 :     }
1448 :    
1449 :    
1450 :    
1451 : overbeek 1.4 ########################################################################
1452 : overbeek 1.1 package Attribute;
1453 : overbeek 1.4 ########################################################################
1454 :     =head1 Attribute
1455 :    
1456 :     =cut
1457 : overbeek 1.1
1458 :     1;
1459 : overbeek 1.4 __END__
1460 :    
1461 :     =head1 Examples
1462 :    
1463 :     =head3 Display all complete, prokaryotic genomes
1464 :    
1465 :     use FIGO;
1466 :     my $figO = new FIGO;
1467 :    
1468 :     foreach $genome ($figO->genomes('complete','prokaryotic'))
1469 :     {
1470 :     $genome->display;
1471 :     }
1472 :    
1473 :     #---------------------------------------------
1474 :    
1475 :     use FIG;
1476 :     my $fig = new FIG;
1477 :    
1478 :     foreach $genome (grep { $fig->is_prokaryotic($_) } $fig->genomes('complete'))
1479 :     {
1480 :     print join("\t",("Genome",$genome,$fig->genus_species($genome))),"\n";
1481 :     }
1482 :    
1483 :     ###############################################
1484 :    
1485 :     =head3 Show how to access contigs and extract sequence
1486 :    
1487 :     use FIGO;
1488 :     my $figO = new FIGO;
1489 :    
1490 :     $genomeId = '83333.1';
1491 :     my $genome = new GenomeO($figO,$genomeId);
1492 :    
1493 :     foreach $contig ($genome->contigs_of)
1494 :     {
1495 :     $tag1 = $contig->dna_seq(1,10);
1496 :     $tag2 = $contig->dna_seq(10,1);
1497 :     print join("\t",($tag1,$tag2,$contig->id,$contig->contig_length)),"\n";
1498 :     }
1499 :    
1500 :     #---------------------------------------------
1501 :    
1502 :     use FIG;
1503 :     my $fig = new FIG;
1504 :    
1505 :     $genomeId = '83333.1';
1506 :    
1507 :     $contig_lengths = $fig->contig_lengths($genomeId);
1508 :    
1509 :     foreach $contig ($fig->contigs_of($genomeId))
1510 :     {
1511 :     $tag1 = $fig->dna_seq($genomeId,join("_",($contig,1,10)));
1512 :     $tag2 = $fig->dna_seq($genomeId,join("_",($contig,10,1)));
1513 :     print join("\t",($tag1,$tag2,$contig,$contig_lengths->{$contig})),"\n";
1514 :     }
1515 :    
1516 :     ###############################################
1517 :    
1518 :     ### accessing data related to features
1519 :    
1520 :     use FIGO;
1521 :     my $figO = new FIGO;
1522 :    
1523 :     my $genome = new GenomeO($figO,"83333.1");
1524 :     my $peg = "fig|83333.1.peg.4";
1525 :     my $pegO = new FeatureO($figO,$peg);
1526 :    
1527 :     print join("\t",$pegO->id,$pegO->location,$pegO->function_of),"\n",
1528 :     $pegO->dna_seq,"\n",
1529 :     $pegO->prot_seq,"\n";
1530 :    
1531 :     foreach $fidO ($genome->features_of('rna'))
1532 :     {
1533 :     print join("\t",$fidO->id,$fidO->location,$fidO->function_of),"\n";
1534 :     }
1535 :    
1536 :     #---------------------------------------------
1537 :    
1538 :    
1539 :     use FIG;
1540 :     my $fig = new FIG;
1541 :    
1542 :     my $genome = "83333.1";
1543 :     my $peg = "fig|83333.1.peg.4";
1544 :    
1545 :     print join("\t",$peg,scalar $fig->feature_location($peg),scalar $fig->function_of($peg)),"\n",
1546 :     $fig->dna_seq($genome,$fig->feature_location($peg)),"\n",
1547 :     $fig->get_translation($peg),"\n";
1548 :    
1549 :     foreach $fid ($fig->all_features($genome,'rna'))
1550 :     {
1551 :     print join("\t",$fid,scalar $fig->feature_location($fid),scalar $fig->function_of($fid)),"\n";
1552 :     }
1553 :    
1554 :     ###############################################
1555 :    
1556 :     ### accessing similarities
1557 :    
1558 :     use FIGO;
1559 :     my $figO = new FIGO;
1560 :    
1561 :     $peg = "fig|83333.1.peg.4";
1562 :     $pegO = new FeatureO($figO,$peg);
1563 :    
1564 :     @sims = $pegO->sims; # use sims( -all => 1, -max => 10000, -cutoff => 1.0e-20) to all
1565 :     # sims (including non-FIG sequences
1566 :     foreach $sim (@sims)
1567 :     {
1568 :     $peg2 = $sim->id2;
1569 :     $pegO2 = new FeatureO($figO,$peg2);
1570 :     $func = $pegO2->function_of;
1571 :     $sc = $sim->psc;
1572 :     print join("\t",($peg2,$sc,$func)),"\n";
1573 :     }
1574 :    
1575 :     #---------------------------------------------
1576 :    
1577 :    
1578 :     use FIG;
1579 :     my $fig = new FIG;
1580 :    
1581 :     $peg = "fig|83333.1.peg.4";
1582 :    
1583 :     @sims = $fig->sims($peg,1000,1.0e-5,"fig");
1584 :     foreach $sim (@sims)
1585 :     {
1586 :     $peg2 = $sim->id2;
1587 :     $func = $fig->function_of($peg2);
1588 :     $sc = $sim->psc;
1589 :     print join("\t",($peg2,$sc,$func)),"\n";
1590 :     }
1591 :    
1592 :     ###############################################
1593 :    
1594 :     ### accessing BBHs
1595 :    
1596 :     use FIGO;
1597 :     my $figO = new FIGO;
1598 :    
1599 :     $peg = "fig|83333.1.peg.4";
1600 :     $pegO = new FeatureO($figO,$peg);
1601 :    
1602 :     @bbhs = $pegO->bbhs;
1603 :     foreach $bbh (@bbhs)
1604 :     {
1605 :     $peg2 = $bbh->peg2;
1606 :     $pegO2 = new FeatureO($figO,$peg2);
1607 :     $func = $pegO2->function_of;
1608 :     $sc = $bbh->psc;
1609 :     print join("\t",($peg2,$sc,$func)),"\n";
1610 :     }
1611 :    
1612 :     #---------------------------------------------
1613 :    
1614 :     use FIG;
1615 :     my $fig = new FIG;
1616 :    
1617 :     $peg = "fig|83333.1.peg.4";
1618 :    
1619 :     @bbhs = $fig->bbhs($peg);
1620 :     foreach $bbh (@bbhs)
1621 :     {
1622 :     ($peg2,$sc,$bit_score) = @$bbh;
1623 :     $func = $fig->function_of($peg2);
1624 :     print join("\t",($peg2,$sc,$func)),"\n";
1625 :     }
1626 :    
1627 :     ###############################################
1628 :    
1629 :     ### accessing annotations
1630 :    
1631 :     use FIGO;
1632 :     my $figO = new FIGO;
1633 :    
1634 :     $peg = "fig|83333.1.peg.4";
1635 :     $pegO = new FeatureO($figO,$peg);
1636 :    
1637 :     @annotations = $pegO->annotations;
1638 :    
1639 :     foreach $ann (@annotations)
1640 :     {
1641 :     print join("\n",$ann->fid,$ann->timestamp(1),$ann->made_by,$ann->text),"\n\n";
1642 :     }
1643 :    
1644 :     #---------------------------------------------
1645 :    
1646 :     use FIG;
1647 :     my $fig = new FIG;
1648 :    
1649 :     $peg = "fig|83333.1.peg.4";
1650 :     @annotations = $fig->feature_annotations($peg);
1651 :     foreach $_ (@annotations)
1652 :     {
1653 :     (undef,$ts,$who,$text) = @$_;
1654 :     $who =~ s/master://i;
1655 :     print "$ts\n$who\n$text\n\n";
1656 :     }
1657 :    
1658 :     ###############################################
1659 :    
1660 :     ### accessing coupling data
1661 :    
1662 :    
1663 :     use FIGO;
1664 :     my $figO = new FIGO;
1665 :    
1666 :     my $peg = "fig|83333.1.peg.4";
1667 :     my $pegO = new FeatureO($figO,$peg);
1668 :     foreach $coupled ($pegO->coupled_to)
1669 :     {
1670 :     print join("\t",($coupled->peg1,$coupled->peg2,$coupled->sc)),"\n";
1671 :     foreach $tuple ($coupled->evidence)
1672 :     {
1673 :     my($peg3O,$peg4O,$rep) = @$tuple;
1674 :     print "\t",join("\t",($peg3O->id,$peg4O->id,$rep)),"\n";
1675 :     }
1676 :     print "\n";
1677 :     }
1678 :    
1679 :     #---------------------------------------------
1680 :    
1681 :    
1682 :     use FIG;
1683 :     my $fig = new FIG;
1684 :    
1685 :     my $peg1 = "fig|83333.1.peg.4";
1686 :     foreach $coupled ($fig->coupled_to($peg1))
1687 :     {
1688 :     ($peg2,$sc) = @$coupled;
1689 :     print join("\t",($peg1,$peg2,$sc)),"\n";
1690 :     foreach $tuple ($fig->coupling_evidence($peg1,$peg2))
1691 :     {
1692 :     my($peg3,$peg4,$rep) = @$tuple;
1693 :     print "\t",join("\t",($peg3,$peg4,$rep)),"\n";
1694 :     }
1695 :     print "\n";
1696 :     }
1697 :    
1698 :     ###############################################
1699 :    
1700 :     =head3 Accessing Subsystem data
1701 :    
1702 :     use FIGO;
1703 :     my $figO = new FIGO;
1704 :    
1705 :     foreach $sub ($figO->subsystems)
1706 :     {
1707 :     if ($sub->usable)
1708 :     {
1709 :     print join("\t",($sub->id,$sub->curator)),"\n";
1710 :    
1711 :     print "\tRoles\n";
1712 :     @roles = $sub->roles;
1713 :     foreach $role (@roles)
1714 :     {
1715 :     print "\t\t",join("\t",($role->id)),"\n";
1716 :     }
1717 :    
1718 :     print "\tGenomes\n";
1719 :     foreach $genome ($sub->genomes)
1720 :     {
1721 :     print "\t\t",join("\t",($sub->variant($genome),
1722 :     $genome->id,
1723 :     $genome->genus_species)),"\n";
1724 :     @pegs = ();
1725 :     foreach $role (@roles)
1726 :     {
1727 :     push(@pegs,$sub->pegs_in_cell($genome,$role));
1728 :     }
1729 :     print "\t\t\t",join(",",@pegs),"\n";
1730 :     }
1731 :     }
1732 :     }
1733 :    
1734 :     #---------------------------------------------
1735 :    
1736 :     use FIG;
1737 :     my $fig = new FIG;
1738 :    
1739 :     foreach $sub (grep { $fig->usable_subsystem($_) } $fig->all_subsystems)
1740 :     {
1741 :     $subO = new Subsystem($sub,$fig);
1742 :     $curator = $subO->get_curator;
1743 :     print join("\t",($sub,$curator)),"\n";
1744 :    
1745 :     print "\tRoles\n";
1746 :     @roles = $subO->get_roles;
1747 :     foreach $role (@roles)
1748 :     {
1749 :     print "\t\t",join("\t",($role)),"\n";
1750 :     }
1751 :    
1752 :     print "\tGenomes\n";
1753 :     foreach $genome ($subO->get_genomes)
1754 :     {
1755 :     print "\t\t",join("\t",($subO->get_variant_code_for_genome($genome),
1756 :     $genome,
1757 :     $fig->genus_species($genome))),"\n";
1758 :     foreach $role (@roles)
1759 :     {
1760 :     push(@pegs,$subO->get_pegs_from_cell($genome,$role));
1761 :     }
1762 :     print "\t\t\t",join(",",@pegs),"\n";
1763 :     }
1764 :     print "\n";
1765 :     }
1766 :    
1767 :     ###############################################
1768 :    
1769 :     =head3 Accessing FIGfams
1770 :    
1771 :     use FIGO;
1772 :     my $figO = new FIGO;
1773 :    
1774 :     foreach $fam ($figO->all_figfams)
1775 :     {
1776 :     print join("\t",($fam->id,$fam->function)),"\n";
1777 :     foreach $pegO ($fam->members)
1778 :     {
1779 :     $peg = $pegO->id;
1780 :     print "\t$peg\n";
1781 :     }
1782 :     }
1783 :    
1784 :     #---------------------------------------------
1785 :    
1786 :     use FIG;
1787 :     use FigFam;
1788 :     use FigFams;
1789 :    
1790 :     my $fig = new FIG;
1791 :     my $figfams = new FigFams($fig);
1792 :    
1793 :     foreach $fam ($figfams->all_families)
1794 :     {
1795 :     my $figfam = new FigFam($fig,$fam);
1796 :     print join("\t",($fam,$figfam->family_function)),"\n";
1797 :     foreach $peg ($figfam->list_members)
1798 :     {
1799 :     print "\t$peg\n";
1800 :     }
1801 :     }
1802 :    
1803 :     ###############################################
1804 :    
1805 :     =head3 Placing a sequence into a FIGfam
1806 :    
1807 :     use FIGO;
1808 :     my $figO = new FIGO;
1809 :    
1810 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
1811 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
1812 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
1813 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
1814 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
1815 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
1816 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
1817 :     RKLMMNHQ";
1818 :     $seq =~ s/\n//gs;
1819 :    
1820 :     my($fam,$sims) = $figO->family_containing($seq);
1821 :    
1822 :     if ($fam)
1823 :     {
1824 :     print join("\t",($fam->id,$fam->function)),"\n";
1825 :     print &Dumper($sims);
1826 :     }
1827 :     else
1828 :     {
1829 :     print "Could not place it in a family\n";
1830 :     }
1831 :    
1832 :     #---------------------------------------------
1833 :    
1834 :     use FIG;
1835 :     use FigFam;
1836 :     use FigFams;
1837 :    
1838 :     my $fig = new FIG;
1839 :     my $figfams = new FigFams($fig);
1840 :    
1841 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
1842 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
1843 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
1844 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
1845 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
1846 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
1847 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
1848 :     RKLMMNHQ";
1849 :     $seq =~ s/\n//gs;
1850 :    
1851 :     my($fam,$sims) = $figfams->place_in_family($seq);
1852 :    
1853 :     if ($fam)
1854 :     {
1855 :     print join("\t",($fam->family_id,$fam->family_function)),"\n";
1856 :     print &Dumper($sims);
1857 :     }
1858 :     else
1859 :     {
1860 :     print "Could not place it in a family\n";
1861 :     }
1862 :    
1863 :     ###############################################
1864 :    
1865 :     =head3 Getting representative sequences for a FIGfam
1866 :    
1867 :     use FIGO;
1868 :     my $figO = new FIGO;
1869 :    
1870 :     $fam = "FIG102446";
1871 :     my $famO = &FigFamO::new('FigFamO',$figO,$fam);
1872 :     my @rep_seqs = $famO->rep_seqs;
1873 :    
1874 :     foreach $seq (@rep_seqs)
1875 :     {
1876 :     print ">query\n$seq\n";
1877 :     }
1878 :    
1879 :     #---------------------------------------------
1880 :    
1881 :     use FIG;
1882 :     use FigFam;
1883 :     use FigFams;
1884 :    
1885 :     my $fig = new FIG;
1886 :    
1887 :     $fam = "FIG102446";
1888 :     my $famO = new FigFam($fig,$fam);
1889 :     my @rep_seqs = $famO->representatives;
1890 :    
1891 :     foreach $seq (@rep_seqs)
1892 :     {
1893 :     print ">query\n$seq\n";
1894 :     }
1895 :    
1896 :    
1897 :     ###############################################
1898 :    
1899 :    
1900 :     =head3 Testing for membership in FIGfam
1901 :    
1902 :     use FIGO;
1903 :     my $figO = new FIGO;
1904 :    
1905 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
1906 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
1907 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
1908 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
1909 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
1910 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
1911 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
1912 :     RKLMMNHQ";
1913 :     $seq =~ s/\n//gs;
1914 :    
1915 :     $fam = "FIG102446";
1916 :     my $famO = &FigFamO::new('FigFamO',$figO,$fam);
1917 :     my($should_be, $sims) = $famO->should_be_member($seq);
1918 :    
1919 :     if ($should_be)
1920 :     {
1921 :     print join("\t",($famO->id,$famO->function)),"\n";
1922 :     print &Dumper($sims);
1923 :     }
1924 :     else
1925 :     {
1926 :     print "Sequence should not be added to family\n";
1927 :     }
1928 :    
1929 :     #---------------------------------------------
1930 :    
1931 :     use FIG;
1932 :     use FigFam;
1933 :     use FigFams;
1934 :    
1935 :     my $fig = new FIG;
1936 :    
1937 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
1938 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
1939 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
1940 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
1941 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
1942 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
1943 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
1944 :     RKLMMNHQ";
1945 :     $seq =~ s/\n//gs;
1946 :    
1947 :     $fam = "FIG102446";
1948 :     my $famO = new FigFam($fig,$fam);
1949 :     my($should_be, $sims) = $famO->should_be_member($seq);
1950 :    
1951 :     if ($should_be)
1952 :     {
1953 :     print join("\t",($famO->family_id,$famO->family_function)),"\n";
1954 :     print &Dumper($sims);
1955 :     }
1956 :     else
1957 :     {
1958 :     print "Sequence should not be added to family\n";
1959 :     }
1960 :    
1961 :     =cut
1962 :    

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3