[Bio] / FigKernelPackages / FIGO.pm Repository:
ViewVC logotype

Annotation of /FigKernelPackages/FIGO.pm

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.26 - (view) (download) (as text)

1 : overbeek 1.9 ########################################################################
2 : overbeek 1.1 #
3 :     # Copyright (c) 2003-2006 University of Chicago and Fellowship
4 :     # for Interpretations of Genomes. All Rights Reserved.
5 :     #
6 :     # This file is part of the SEED Toolkit.
7 :     #
8 :     # The SEED Toolkit is free software. You can redistribute
9 :     # it and/or modify it under the terms of the SEED Toolkit
10 :     # Public License.
11 :     #
12 :     # You should have received a copy of the SEED Toolkit Public License
13 :     # along with this program; if not write to the University of Chicago
14 :     # at info@ci.uchicago.edu or the Fellowship for Interpretation of
15 :     # Genomes at veronika@thefig.info or download a copy from
16 :     # http://www.theseed.org/LICENSE.TXT.
17 :     #
18 : overbeek 1.9 ########################################################################
19 :    
20 :     =head1 Overview
21 :    
22 :     This module is a set of packages encapsulating the SEED's core methods
23 :     using an "OOP-like" style.
24 :    
25 :     There are several modules clearly related to "individual genomes:"
26 :     FIGO, GenomeO, ContigO, FeatureO (and I<maybe> AnnotationO).
27 :    
28 :     There are also modules that deal with complex relationships between
29 :     pairs or sets of features in one, two, or more genomes,
30 :     rather than any particular single genome:
31 :     BBHO, CouplingO, SubsystemO, FunctionalRoleO, FigFamO.
32 :    
33 :     Finally, the methods in "Attribute" might in principle attach
34 :     "atributes" to any type of object.
35 :     (Likewise, in principle one might like to attach an "annotation"
36 :     to any type of object
37 :    
38 : gdpusch 1.24 The four modules dealing with "genomes" have a reasonable clear
39 : overbeek 1.9 "implied heirarchy:"
40 :    
41 :     =over 4
42 :    
43 :     FIGO > GenomeO > ContigO > FeatureO
44 :    
45 :     =back
46 : overbeek 1.1
47 : overbeek 1.9 However, inheritance is B<NOT> implemented using the C<@ISA> mechanism,
48 :     because some methods deal with "pairwise" or "setwise" relations between objects
49 :     or other more complex relationships that do not naturally fit into any heirarchy ---
50 :     which would get us into the whole quagmire of "multiple inheritance."
51 :    
52 : overbeek 1.13 We have chosen to in many cases sidestep the entire issue of inheritance
53 :     via an I<ad hoc> mechanism:
54 : overbeek 1.9 If a "child" object needs access to its "ancestors'" methods,
55 : gdpusch 1.24 we will explicitly pass it references to its "ancestors,"
56 :     as subroutine arguments.
57 : overbeek 1.9 This is admittedly ugly, clumsy, and potentially error-prone ---
58 :     but it has the advantage that, unlike multiple inheritance,
59 :     we understand how to do it...
60 :    
61 :     MODULE DEPENDENCIES: FIG, FIG_Config, FigFams, SFXlate, SproutFIG, Tracer,
62 :     gjoparseblast, Data::Dumper.
63 :    
64 :     =cut
65 :    
66 :     ########################################################################
67 : overbeek 1.1 package FIGO;
68 : overbeek 1.9 ########################################################################
69 : overbeek 1.1 use strict;
70 :     use FIG;
71 :     use FIG_Config;
72 :     use SFXlate;
73 :     use SproutFIG;
74 :     use Tracer;
75 :     use Data::Dumper;
76 : overbeek 1.23 use Carp;
77 : overbeek 1.1 use FigFams;
78 : overbeek 1.3 use gjoparseblast;
79 : overbeek 1.1
80 : overbeek 1.9 =head1 FIGO
81 :    
82 :     The effective "base class" containing a few "top-level" methods.
83 :    
84 :     =cut
85 :    
86 : overbeek 1.4
87 :     =head3 new
88 :    
89 :     Constructs a new FIGO object.
90 :    
91 : overbeek 1.9 =over 4
92 : overbeek 1.4
93 :     =item USAGE:
94 :    
95 :     C<< my $figo = FIGO->new(); #...Subclass defaults to FIG >>
96 :    
97 :     C<< my $figo = FIGO->new('SPROUT'); #...Subclass is a SPROUT object >>
98 :    
99 :     =back
100 :    
101 :     =cut
102 :    
103 : overbeek 1.1 sub new {
104 :     my($class,$low_level) = @_;
105 :    
106 :     my $fig;
107 :     if ($low_level && ($low_level =~ /sprout/i))
108 :     {
109 :     $fig = new SproutFIG($FIG_Config::sproutDB, $FIG_Config::sproutData);
110 :     }
111 :     else
112 :     {
113 :     $fig = new FIG;
114 :     }
115 :    
116 :     my $self = {};
117 :     $self->{_fig} = $fig;
118 : overbeek 1.3 $self->{_tmp_dir} = $FIG_Config::temp;
119 : overbeek 1.1 return bless $self, $class;
120 :     }
121 :    
122 : overbeek 1.21 sub function_of {
123 :     my($self,$id) = @_;
124 : overbeek 1.4
125 : overbeek 1.21 my $fig = $self->{_fig};
126 :     my $func = $fig->function_of($id);
127 :    
128 :     return ($func ? $func : "");
129 :     }
130 : overbeek 1.4
131 :     =head3 genomes
132 :    
133 :     Returns a list of Taxonomy-IDs, possibly constrained by selection criteria.
134 :     (Default: Empty constraint returns all Tax-IDs in the SEED or SPROUT.)
135 :    
136 : overbeek 1.9 =over 4
137 : overbeek 1.4
138 :     =item USAGE:
139 :    
140 :     C<< my @tax_ids = $figo->genomes(); >>
141 :    
142 :     C<< my @tax_ids = $figo->genomes( @constraints ); >>
143 :    
144 :     =item @constraints
145 : overbeek 1.9
146 :     One or more element of: complete, prokaryotic, eukaryotic, bacterial, archaeal, nmpdr.
147 : overbeek 1.4
148 :     =item RETURNS: List of Tax-IDs.
149 :    
150 : overbeek 1.9 =item EXAMPLE:
151 :    
152 : overbeek 1.13 L<Display all complete, prokaryotic genomes>
153 : overbeek 1.4
154 :     =back
155 :    
156 :     =cut
157 :    
158 : overbeek 1.1 sub genomes {
159 :     my($self,@constraints) = @_;
160 :     my $fig = $self->{_fig};
161 :    
162 :     my %constraints = map { $_ => 1 } @constraints;
163 :     my @genomes = ();
164 :    
165 :     if ($constraints{complete})
166 :     {
167 :     @genomes = $fig->genomes('complete');
168 :     }
169 :     else
170 :     {
171 :     @genomes = $fig->genomes;
172 :     }
173 :    
174 :     if ($constraints{prokaryotic})
175 :     {
176 :     @genomes = grep { $fig->is_prokaryotic($_) } @genomes;
177 :     }
178 :    
179 :     if ($constraints{eukaryotic})
180 :     {
181 :     @genomes = grep { $fig->is_eukaryotic($_) } @genomes;
182 :     }
183 :    
184 :     if ($constraints{bacterial})
185 :     {
186 :     @genomes = grep { $fig->is_bacterial($_) } @genomes;
187 :     }
188 :    
189 :     if ($constraints{archaeal})
190 :     {
191 :     @genomes = grep { $fig->is_archaeal($_) } @genomes;
192 :     }
193 :    
194 :     if ($constraints{nmpdr})
195 :     {
196 :     @genomes = grep { $fig->is_NMPDR_genome($_) } @genomes;
197 :     }
198 :    
199 :     return map { &GenomeO::new('GenomeO',$self,$_) } @genomes;
200 :     }
201 :    
202 : overbeek 1.4
203 :    
204 :     =head3 subsystems
205 :    
206 : overbeek 1.9 =over 4
207 : overbeek 1.4
208 :     =item RETURNS:
209 :    
210 : overbeek 1.9 List of all subsystems.
211 :    
212 :     =item EXAMPLE:
213 :    
214 : overbeek 1.13 L<Accessing Subsystem data>
215 : overbeek 1.4
216 :     =back
217 :    
218 :     =cut
219 :    
220 : overbeek 1.1 sub subsystems {
221 :     my($self) = @_;
222 :     my $fig = $self->{_fig};
223 :    
224 :     return map { &SubsystemO::new('SubsystemO',$self,$_) } $fig->all_subsystems;
225 :     }
226 :    
227 : overbeek 1.4
228 :     =head3 functional_roles
229 :    
230 :     (Not yet implemented)
231 :    
232 : overbeek 1.9 =over
233 : overbeek 1.4
234 :     =item RETURNS:
235 :    
236 :     =item EXAMPLE:
237 :    
238 :     =back
239 :    
240 :     =cut
241 :    
242 : overbeek 1.1 sub functional_roles {
243 :     my($self) = @_;
244 :     my $fig = $self->{_fig};
245 :    
246 :     my @functional_roles = ();
247 :    
248 :     return @functional_roles;
249 :     }
250 :    
251 : overbeek 1.4
252 :    
253 :     =head3 all_figfams
254 :    
255 :     Returns a list of all FIGfam objects.
256 :    
257 : overbeek 1.9 =over 4
258 :    
259 :     =item USAGE:
260 :    
261 : overbeek 1.13 C<< foreach $fam ($figO->all_figfams) { #...Do something } >>
262 : overbeek 1.9
263 :     =item RETURNS:
264 : overbeek 1.4
265 : overbeek 1.9 List of FIGfam Objects
266 : overbeek 1.4
267 : overbeek 1.9 =item EXAMPLE:
268 : overbeek 1.4
269 : overbeek 1.13 L<Accessing FIGfams>
270 : overbeek 1.4
271 :     =back
272 :    
273 :     =cut
274 :    
275 : overbeek 1.1 sub all_figfams {
276 :     my($self) = @_;
277 :     my $fig = $self->{_fig};
278 :     my $fams = new FigFams($fig);
279 :     return map { &FigFamO::new('FigFamO',$self,$_) } $fams->all_families;
280 :     }
281 :    
282 : overbeek 1.4
283 :    
284 :     =head3 family_containing
285 :    
286 : overbeek 1.9 =over 4
287 : overbeek 1.4
288 : overbeek 1.9 =item USAGE:
289 : overbeek 1.4
290 : overbeek 1.13 C<< my ($fam, $sims) = $figO->family_containing($seq); >>
291 : overbeek 1.4
292 : overbeek 1.9 =item $seq:
293 :    
294 :     A protein translation string.
295 :    
296 :     =item RETURNS:
297 :    
298 : overbeek 1.4 $fam: A FIGfam Object.
299 : overbeek 1.9
300 : overbeek 1.4 $sims: A set of similarity objects.
301 :    
302 :     =item EXAMPLE: L<Placing a sequence into a FIGfam>
303 :    
304 :     =back
305 :    
306 :     =cut
307 :    
308 : overbeek 1.1 sub family_containing {
309 :     my($self,$seq) = @_;
310 :    
311 :     my $fig = $self->{_fig};
312 :     my $fams = new FigFams($fig);
313 :     my($fam,$sims) = $fams->place_in_family($seq);
314 :     if ($fam)
315 :     {
316 :     return (&FigFamO::new('FigFamO',$self,$fam->family_id),$sims);
317 :     }
318 :     else
319 :     {
320 :     return undef;
321 :     }
322 :     }
323 :    
324 : overbeek 1.17 =head3 figfam
325 :    
326 :     =over 4
327 :    
328 :     =item USAGE:
329 :    
330 :     C<< my $fam = $figO->figfam($family_id); >>
331 :    
332 :     =item $family_id;
333 :    
334 :     A FigFam ID
335 :    
336 :     =item RETURNS:
337 :    
338 :     $fam: A FIGfam Object.
339 :    
340 :     =back
341 :    
342 :     =cut
343 :    
344 :     sub figfam {
345 :     my($self,$fam_id) = @_;
346 :    
347 :     return &FigFamO::new('FigFamO',$self,$fam_id);
348 :     }
349 :    
350 : overbeek 1.4
351 :     ########################################################################
352 : overbeek 1.1 package GenomeO;
353 : overbeek 1.4 ########################################################################
354 :     use Data::Dumper;
355 :    
356 :     =head1 GenomeO
357 :    
358 :     =cut
359 :    
360 : overbeek 1.13
361 : overbeek 1.4 =head3 new
362 :    
363 :     Constructor of GenomeO objects.
364 : overbeek 1.1
365 : overbeek 1.9 =over 4
366 : gdpusch 1.24
367 : overbeek 1.4 =item USAGE:
368 :    
369 : gdpusch 1.26 C<< my $orgO = GenomeO->new($figO, $tax_id); >>
370 : overbeek 1.9
371 :     =item RETURNS:
372 :    
373 : gdpusch 1.26 A new "GenomeO" object.
374 : overbeek 1.4
375 :     =back
376 :    
377 :     =cut
378 : overbeek 1.1
379 :     sub new {
380 :     my($class,$figO,$genomeId) = @_;
381 :    
382 :     my $self = {};
383 :     $self->{_figO} = $figO;
384 :     $self->{_id} = $genomeId;
385 :     return bless $self, $class;
386 :     }
387 :    
388 : overbeek 1.4
389 :    
390 :     =head3 id
391 :    
392 : overbeek 1.9 =over 4
393 :    
394 :     =item USAGE:
395 : overbeek 1.4
396 : gdpusch 1.26 C<< my $tax_id = $orgO->id(); >>
397 : overbeek 1.9
398 :     =item RETURNS:
399 : overbeek 1.4
400 : gdpusch 1.26 Taxonomy-ID of "GenomeO" object.
401 : overbeek 1.4
402 :     =back
403 :    
404 :     =cut
405 :    
406 : overbeek 1.1 sub id {
407 :     my($self) = @_;
408 :    
409 :     return $self->{_id};
410 :     }
411 :    
412 : overbeek 1.4
413 :    
414 :     =head3 genus_species
415 :    
416 : overbeek 1.9 =over 4
417 : overbeek 1.4
418 : overbeek 1.9 =item USAGE:
419 :    
420 : gdpusch 1.26 C<< $gs = $orgO->genus_species(); >>
421 : overbeek 1.9
422 :     =item RETURNS:
423 : overbeek 1.4
424 : overbeek 1.9 Genus-species-strain string
425 : overbeek 1.4
426 :     =back
427 :    
428 :     =cut
429 :    
430 : overbeek 1.1 sub genus_species {
431 :     my($self) = @_;
432 :    
433 :     my $fig = $self->{_figO}->{_fig};
434 :     return $fig->genus_species($self->{_id});
435 :     }
436 :    
437 : overbeek 1.4
438 : gdpusch 1.25
439 :    
440 :     =head3 taxonomy_of
441 :    
442 : gdpusch 1.26 =over 4
443 :    
444 :     =item FUNCTION:
445 :    
446 :     Return the TAXONOMY string of a "GenomeO" object.
447 :    
448 :     =item USAGE:
449 :    
450 :     C<< my $taxonomy = $orgO->taxonomy_of(); >>
451 :    
452 :     =item RETURNS:
453 :    
454 :     TAXONOMY string.
455 :    
456 :     =back
457 :    
458 : gdpusch 1.25 =cut
459 :    
460 :     sub taxonomy_of {
461 :     my ($self) = @_;
462 :    
463 :     my $figO = $self->{_figO};
464 :     my $fig = $figO->{_fig};
465 :    
466 : gdpusch 1.26 return $fig->taxonomy_of($self->{_id});
467 : gdpusch 1.25 }
468 :    
469 :    
470 : overbeek 1.4 =head3 contigs_of
471 :    
472 : overbeek 1.9 =over 4
473 :    
474 :     =item RETURNS:
475 :    
476 : gdpusch 1.24 List of C<contig> objects contained in a C<GenomeO> object.
477 : overbeek 1.4
478 : overbeek 1.9 =item EXAMPLE:
479 : overbeek 1.4
480 : overbeek 1.13 L<Show how to access contigs and extract sequence>
481 : overbeek 1.4
482 :     =back
483 :    
484 :     =cut
485 :    
486 : overbeek 1.1 sub contigs_of {
487 :     my($self) = @_;
488 :    
489 :     my $figO = $self->{_figO};
490 :     my $fig = $figO->{_fig};
491 :     return map { &ContigO::new('ContigO',$figO,$self->id,$_) } $fig->contigs_of($self->id);
492 :     }
493 :    
494 : overbeek 1.4
495 :    
496 :     =head3 features_of
497 :    
498 : gdpusch 1.26 =over 4
499 :    
500 :     =item FUNCTION:
501 :    
502 :     Returns a list of "FeatureO" objects contained in a "GenomeO" object.
503 :    
504 :     =item USAGE:
505 :    
506 :     C<< my @featureOs = $orgO->features_of(); #...Fetch all features >>
507 :    
508 :     or
509 :    
510 :     C<< my @featureOs = $orgO->features_of('peg'); #...Fetch only PEGs >>
511 :    
512 :     =item RETURNS:
513 :    
514 :     List of "FeatureO" objects.
515 :    
516 :     =back
517 :    
518 : overbeek 1.4 =cut
519 :    
520 : overbeek 1.1 sub features_of {
521 :     my($self,$type) = @_;
522 :    
523 :     my $figO = $self->{_figO};
524 :     my $fig = $figO->{_fig};
525 :    
526 :     return map { &FeatureO::new('FeatureO',$figO,$_) } $fig->all_features($self->id,$type);
527 :     }
528 :    
529 : overbeek 1.4
530 :     =head3 display
531 :    
532 :     Prints the genus, species, and strain information about a genome to STDOUT.
533 :    
534 : overbeek 1.9 =over 4
535 :    
536 :     =item USAGE:
537 :    
538 : overbeek 1.13 C<< $genome->display(); >>
539 : overbeek 1.4
540 : overbeek 1.9 =item RETURNS:
541 : overbeek 1.4
542 : overbeek 1.9 (Void)
543 : overbeek 1.4
544 :     =back
545 :    
546 :     =cut
547 :    
548 : overbeek 1.1 sub display {
549 :     my($self) = @_;
550 :    
551 :     print join("\t",("Genome",$self->id,$self->genus_species)),"\n";
552 :     }
553 :    
554 : overbeek 1.4
555 :    
556 :     ########################################################################
557 : overbeek 1.1 package ContigO;
558 : overbeek 1.4 ########################################################################
559 :     use Data::Dumper;
560 :    
561 :     =head1 ContigO
562 :    
563 :     Methods for working with DNA sequence objects.
564 :    
565 :     =cut
566 :    
567 :     =head3 new
568 :    
569 :     Contig constructor.
570 : overbeek 1.1
571 : overbeek 1.9 =over 4
572 : overbeek 1.4
573 :     =item USAGE:
574 :    
575 : overbeek 1.13 C<< $contig = ContigO->new( $figO, $genomeId, $contigId); >>
576 : overbeek 1.4
577 : overbeek 1.9 =item $figO:
578 : overbeek 1.4
579 : overbeek 1.9 Parent FIGO object.
580 : overbeek 1.4
581 : overbeek 1.9 =item $genomeId:
582 :    
583 :     Taxon-ID for the genome the contig is from.
584 :    
585 :     =item $contigId:
586 :    
587 :     Identifier for the contig
588 :    
589 :     =item RETURNS:
590 :    
591 :     A "ContigO" object.
592 : overbeek 1.4
593 :     =back
594 :    
595 :     =cut
596 : overbeek 1.1
597 :     sub new {
598 :     my($class,$figO,$genomeId,$contigId) = @_;
599 :    
600 :     my $self = {};
601 :     $self->{_figO} = $figO;
602 :     $self->{_id} = $contigId;
603 :     $self->{_genome} = $genomeId;
604 :     return bless $self, $class;
605 :     }
606 :    
607 : overbeek 1.4
608 :    
609 :     =head3 id
610 :    
611 : overbeek 1.9 =over 4
612 : overbeek 1.4
613 : overbeek 1.9 =item RETURNS:
614 :    
615 :     Sequence ID string of "ContigO" object
616 : overbeek 1.4
617 :     =back
618 :    
619 :     =cut
620 :    
621 : overbeek 1.1 sub id {
622 :     my($self) = @_;
623 :    
624 :     return $self->{_id};
625 :     }
626 :    
627 : overbeek 1.4
628 :     =head3 genome
629 :    
630 : overbeek 1.9 =over 4
631 : overbeek 1.4
632 : overbeek 1.9 =item USAGE:
633 : gdpusch 1.24
634 : overbeek 1.13 C<< my $tax_id = $contig->genome->id(); >>
635 : overbeek 1.4
636 : overbeek 1.9 =item RETURNS:
637 :    
638 :     Tax-ID of the GenomeO object containing the contig object.
639 : overbeek 1.4
640 :     =back
641 :    
642 :     =cut
643 :    
644 : overbeek 1.1 sub genome {
645 :     my($self) = @_;
646 :    
647 : overbeek 1.10 my $figO = $self->{_figO};
648 :     return new GenomeO($figO,$self->{_genome});
649 : overbeek 1.1 }
650 :    
651 : overbeek 1.4
652 :    
653 :     =head3 contig_length
654 :    
655 : overbeek 1.9 =over 4
656 : overbeek 1.4
657 :     =item USAGE:
658 : overbeek 1.9
659 : overbeek 1.13 C<< my $len = $contig->contig_length(); >>
660 : overbeek 1.4
661 : overbeek 1.9 =item RETURNS:
662 :    
663 :     Length of contig's DNA sequence.
664 : overbeek 1.4
665 :     =back
666 :    
667 :     =cut
668 :    
669 : overbeek 1.1 sub contig_length {
670 :     my($self) = @_;
671 :    
672 :     my $fig = $self->{_figO}->{_fig};
673 : overbeek 1.11 my $contig_lengths = $fig->contig_lengths($self->genome->id);
674 : overbeek 1.1 return $contig_lengths->{$self->id};
675 :     }
676 :    
677 : overbeek 1.4
678 :     =head3 dna_seq
679 :    
680 : overbeek 1.9 =over 4
681 : overbeek 1.4
682 :     =item USAGE:
683 : overbeek 1.9
684 : overbeek 1.13 C<< my $seq = $contig->dna_seq(beg, $end); >>
685 : overbeek 1.4
686 : overbeek 1.9 =item $beg:
687 :    
688 :     Begining point of DNA subsequence
689 : overbeek 1.4
690 : overbeek 1.9 =item $end:
691 : overbeek 1.4
692 : overbeek 1.9 End point of DNA subsequence
693 : overbeek 1.4
694 : overbeek 1.9 =item RETURNS:
695 :    
696 :     string of DNA sequence running from $beg to $end
697 :     (NOTE: if $beg > $end, returns reverse complement of DNA subsequence.)
698 : overbeek 1.4
699 :     =back
700 :    
701 :     =cut
702 :    
703 : overbeek 1.1 sub dna_seq {
704 :     my($self,$beg,$end) = @_;
705 :    
706 :     my $fig = $self->{_figO}->{_fig};
707 :     my $max = $self->contig_length;
708 :     if (($beg && (&FIG::between(1,$beg,$max))) &&
709 :     ($end && (&FIG::between(1,$end,$max))))
710 :     {
711 : overbeek 1.11 return $fig->dna_seq($self->genome->id,join("_",($self->id,$beg,$end)));
712 : overbeek 1.1 }
713 :     else
714 :     {
715 :     return undef;
716 :     }
717 :     }
718 :    
719 : overbeek 1.4
720 :     =head3 display
721 :    
722 :     Prints summary information about a "ContigO" object to STDOUT:
723 :    
724 :     Genus, species, strain
725 :    
726 :     Contig ID
727 :    
728 :     Contig length
729 :    
730 : overbeek 1.9 =over 4
731 :    
732 :     =item RETURNS:
733 : overbeek 1.4
734 : overbeek 1.9 (Void)
735 : overbeek 1.4
736 :     =back
737 :    
738 :     =cut
739 :    
740 : overbeek 1.1 sub display {
741 :     my($self) = @_;
742 :    
743 : overbeek 1.11 print join("ContigO",$self->genome->id,$self->id,$self->contig_length),"\n";
744 : overbeek 1.1 }
745 :    
746 : overbeek 1.10 sub features_in_region {
747 :     my($self,$beg,$end) = @_;
748 :     my $figO = $self->{_figO};
749 :     my $fig = $figO->{_fig};
750 : overbeek 1.4
751 : overbeek 1.10 my($features) = $fig->genes_in_region($self->genome->id,$self->id,$beg,$end);
752 :     return map { new FeatureO($figO,$_) } @$features;
753 :     }
754 : overbeek 1.4
755 : overbeek 1.13
756 :    
757 : overbeek 1.4 ########################################################################
758 : overbeek 1.1 package FeatureO;
759 : overbeek 1.4 ########################################################################
760 :     use Data::Dumper;
761 : overbeek 1.23 use Carp;
762 : overbeek 1.4
763 :     =head1 FeatureO
764 :    
765 : overbeek 1.9 Methods for working with features on "ContigO" objects.
766 :    
767 : overbeek 1.4 =cut
768 :    
769 : overbeek 1.13
770 : overbeek 1.9 =head3 new
771 : overbeek 1.4
772 : gdpusch 1.24 Constructor of new "FeatureO" objects
773 : overbeek 1.4
774 : overbeek 1.13 =over 4
775 :    
776 :     =item USAGE:
777 :    
778 :     C<< my $feature = FeatureO->new( $figO, $fid ); >>
779 :    
780 :     =item C<$figO>:
781 :    
782 :     "Base" FIGO object.
783 :    
784 :     =item C<$fid>:
785 :    
786 :     Feature-ID for new feature
787 :    
788 :     =item RETURNS:
789 :    
790 :     A newly created "FeatureO" object.
791 :    
792 :     =back
793 :    
794 : overbeek 1.4 =cut
795 : overbeek 1.1
796 :     sub new {
797 :     my($class,$figO,$fid) = @_;
798 :    
799 :     ($fid =~ /^fig\|\d+\.\d+\.[^\.]+\.\d+$/) || return undef;
800 :     my $self = {};
801 :     $self->{_figO} = $figO;
802 :     $self->{_id} = $fid;
803 :     return bless $self, $class;
804 :     }
805 :    
806 : overbeek 1.4
807 : overbeek 1.13
808 : overbeek 1.4 =head3 id
809 :    
810 : overbeek 1.13 =over 4
811 :    
812 :     =item USAGE:
813 :    
814 :     C<< my $fid = $feature->id(); >>
815 :    
816 :     =item RETURNS:
817 :    
818 :     The FID (Feature ID) of a "FeatureO" object.
819 :    
820 :     =back
821 :    
822 : overbeek 1.4 =cut
823 :    
824 : overbeek 1.1 sub id {
825 :     my($self) = @_;
826 :    
827 :     return $self->{_id};
828 :     }
829 :    
830 : overbeek 1.4
831 :    
832 :     =head3 genome
833 :    
834 : overbeek 1.13 =over 4
835 :    
836 :     =item USAGE:
837 :    
838 :     C<< my $taxid = $feature->genome(); >>
839 :    
840 :     =item RETURNS:
841 :    
842 : overbeek 1.22 The Taxon-ID for the "GenomeO" object containing the feature.
843 : overbeek 1.13
844 :     =back
845 :    
846 : overbeek 1.4 =cut
847 :    
848 : overbeek 1.1 sub genome {
849 :     my($self) = @_;
850 : overbeek 1.12 my $figO = $self->{_figO};
851 : overbeek 1.1 $self->id =~ /^fig\|(\d+\.\d+)/;
852 : overbeek 1.12 return new GenomeO($figO,$1);
853 : overbeek 1.1 }
854 :    
855 : overbeek 1.4
856 :    
857 :     =head3 type
858 :    
859 : overbeek 1.13 =over 4
860 :    
861 :     =item USAGE:
862 :    
863 :     C<< my $feature_type = $feature->type(); >>
864 :    
865 :     =item RETURNS:
866 :    
867 :     The feature object's "type" (e.g., "peg," "rna," etc.)
868 :    
869 :     =back
870 :    
871 : overbeek 1.4 =cut
872 :    
873 : overbeek 1.1 sub type {
874 :     my($self) = @_;
875 :    
876 :     $self->id =~ /^fig\|\d+\.\d+\.([^\.]+)/;
877 :     return $1;
878 :     }
879 :    
880 : overbeek 1.4
881 :    
882 : overbeek 1.13 =head3 location
883 :    
884 :     =over 4
885 : overbeek 1.4
886 : overbeek 1.13 =item USAGE:
887 :    
888 :     C<< my $loc = $feature->location(); >>
889 :    
890 :     =item RETURNS:
891 :    
892 :     A string representing the feature object's location on the genome's DNA,
893 :     in SEED "tbl format" (i.e., "contig_beging_end").
894 :    
895 :     =back
896 : overbeek 1.4
897 :     =cut
898 :    
899 : overbeek 1.1 sub location {
900 :     my($self) = @_;
901 :    
902 :     my $fig = $self->{_figO}->{_fig};
903 :     return scalar $fig->feature_location($self->id);
904 :     }
905 :    
906 : overbeek 1.13
907 :     =head3 contig
908 :    
909 :     =over 4
910 :    
911 :     =item USAGE:
912 :    
913 :     C<< my $contig = $feature->contig(); >>
914 :    
915 :     =item RETURNS:
916 :    
917 :     A "ContigO" object to access the contig data
918 :     for the contig the feature is on.
919 :    
920 :     =back
921 :    
922 :     =cut
923 :    
924 : overbeek 1.12 sub contig {
925 :     my($self) = @_;
926 :    
927 :     my $figO = $self->{_figO};
928 :     my $loc = $self->location;
929 :     my $genomeID = $self->genome->id;
930 :     return ($loc =~ /^(\S+)_\d+_\d+$/) ? new ContigO($figO,$genomeID,$1) : undef;
931 :     }
932 :    
933 : overbeek 1.13
934 :    
935 :     =head3 begin
936 :    
937 :     =over 4
938 :    
939 :     =item USAGE:
940 :    
941 :     C<< my $beg = $feature->begin(); >>
942 :    
943 :     =item RETURNS:
944 :    
945 :     The numerical coordinate of the first base of the feature.
946 :    
947 :     =back
948 :    
949 :     =cut
950 :    
951 : overbeek 1.12 sub begin {
952 :     my($self) = @_;
953 :    
954 :     my $loc = $self->location;
955 :     return ($loc =~ /^\S+_(\d+)_\d+$/) ? $1 : undef;
956 :     }
957 : overbeek 1.4
958 : overbeek 1.13
959 :    
960 :     =head3 end
961 :    
962 :     =over 4
963 :    
964 :     =item USAGE:
965 :    
966 :     C<< my $end = $feature->end(); >>
967 :    
968 :     =item RETURNS:
969 :    
970 :     The numerical coordinate of the last base of the feature.
971 :    
972 :     =back
973 :    
974 :     =cut
975 :    
976 : overbeek 1.12 sub end {
977 :     my($self) = @_;
978 :    
979 :     my $loc = $self->location;
980 :     return ($loc =~ /^\S+_\d+_(\d+)$/) ? $1 : undef;
981 :     }
982 : overbeek 1.4
983 : overbeek 1.13
984 :    
985 : overbeek 1.4 =head3 dna_seq
986 :    
987 : overbeek 1.13 =over 4
988 :    
989 :     =item USAGE:
990 :    
991 :     C<< my $dna_seq = $feature->dna_seq(); >>
992 :    
993 :     =item RETURNS:
994 :    
995 :     A string contining the DNA subsequence of the contig
996 :     running from the first to the last base of the feature.
997 :    
998 :     If ($beg > $end), the reverse complement subsequence is returned.
999 :    
1000 :     =back
1001 :    
1002 : overbeek 1.4 =cut
1003 :    
1004 : overbeek 1.1 sub dna_seq {
1005 :     my($self) = @_;
1006 :    
1007 :     my $fig = $self->{_figO}->{_fig};
1008 :     my $fid = $self->id;
1009 :     my @loc = $fig->feature_location($fid);
1010 :     return $fig->dna_seq(&FIG::genome_of($fid),@loc);
1011 :     }
1012 :    
1013 : overbeek 1.4
1014 :    
1015 :     =head3 prot_seq
1016 :    
1017 : overbeek 1.13 =over 4
1018 :    
1019 :     =item USAGE:
1020 :    
1021 :     C<< my $dna_seq = $feature->prot_seq(); >>
1022 :    
1023 :     =item RETURNS:
1024 :    
1025 :     A string contining the protein translation of the feature (if it exists),
1026 :     or the "undef" value if the feature does not exist or is not a PEG.
1027 :    
1028 :     =back
1029 :    
1030 : overbeek 1.4 =cut
1031 :    
1032 : overbeek 1.1 sub prot_seq {
1033 :     my($self) = @_;
1034 :    
1035 :     ($self->type eq "peg") || return undef;
1036 :     my $fig = $self->{_figO}->{_fig};
1037 :     my $fid = $self->id;
1038 :     return $fig->get_translation($fid);
1039 :     }
1040 :    
1041 : overbeek 1.4
1042 :    
1043 :     =head3 function_of
1044 :    
1045 : overbeek 1.13 =over 4
1046 :    
1047 :     =item USAGE:
1048 :    
1049 :     C<< my $func = $feature->function_of(); >>
1050 :    
1051 :     =item RETURNS:
1052 :    
1053 :     A string containing the function assigned to the feature,
1054 :     or the "undef" value if no function has been assigned.
1055 :    
1056 :     =back
1057 :    
1058 : overbeek 1.4 =cut
1059 :    
1060 : overbeek 1.1 sub function_of {
1061 :     my($self) = @_;
1062 :    
1063 :     my $fig = $self->{_figO}->{_fig};
1064 :     my $fid = $self->id;
1065 :     return scalar $fig->function_of($fid);
1066 :     }
1067 :    
1068 : overbeek 1.4
1069 :    
1070 :     =head3 coupled_to
1071 :    
1072 : overbeek 1.13 =over 4
1073 :    
1074 :     =item USAGE:
1075 :    
1076 :     C<< my @coupled_features = $feature->coupled_to(); >>
1077 :    
1078 :     =item RETURNS:
1079 :    
1080 : gdpusch 1.24 A list of "CouplingO" objects describing the evidence for functional coupling
1081 : overbeek 1.13 between this feature and other nearby features.
1082 :    
1083 :     =back
1084 :    
1085 : overbeek 1.4 =cut
1086 :    
1087 : overbeek 1.1 sub coupled_to {
1088 :     my($self) = @_;
1089 :    
1090 : overbeek 1.13 ($self->type eq "peg") || return ();
1091 : overbeek 1.1 my $figO = $self->{_figO};
1092 :     my $fig = $figO->{_fig};
1093 :     my $peg1 = $self->id;
1094 :     my @coupled = ();
1095 :     foreach my $tuple ($fig->coupled_to($peg1))
1096 :     {
1097 :     my($peg2,$sc) = @$tuple;
1098 :     push(@coupled, &CouplingO::new('CouplingO',$figO,$peg1,$peg2,$sc));
1099 :     }
1100 :     return @coupled;
1101 :     }
1102 :    
1103 : overbeek 1.4
1104 :    
1105 :     =head3 annotations
1106 :    
1107 : overbeek 1.13 =over 4
1108 :    
1109 :     =item USAGE:
1110 :    
1111 :     C<< my @annot_list = $feature->annotations(); >>
1112 :    
1113 :     =item RETURNS:
1114 :    
1115 : gdpusch 1.24 A list of "AnnotationO" objects allowing access to the annotations for this feature.
1116 : overbeek 1.13
1117 :     =back
1118 :    
1119 : overbeek 1.4 =cut
1120 :    
1121 : overbeek 1.1 sub annotations {
1122 :     my($self) = @_;
1123 :    
1124 :     my $figO = $self->{_figO};
1125 :     my $fig = $figO->{_fig};
1126 :    
1127 :     return map { &AnnotationO::new('AnnotationO',@$_) } $fig->feature_annotations($self->id,1);
1128 :     }
1129 :    
1130 : overbeek 1.13
1131 :     =head3 in_subsystems
1132 :    
1133 :     =over 4
1134 :    
1135 :     =item USAGE:
1136 :    
1137 :     C<< my @subsys_list = $feature->in_subsystems(); >>
1138 :    
1139 :     =item RETURNS:
1140 :    
1141 : gdpusch 1.24 A list of "SubsystemO" objects allowing access to the subsystems
1142 : overbeek 1.13 that this feature particupates in.
1143 :    
1144 :     =back
1145 :    
1146 :     =cut
1147 :    
1148 : overbeek 1.5 sub in_subsystems {
1149 :     my($self) = @_;
1150 :     my $figO = $self->{_figO};
1151 :     my $fig = $figO->{_fig};
1152 :    
1153 :     return map { new SubsystemO($figO,$_) } $fig->peg_to_subsystems($self->id);
1154 :     }
1155 : overbeek 1.4
1156 :    
1157 :     =head3 possibly_truncated
1158 :    
1159 : overbeek 1.13 =over 4
1160 :    
1161 :     =item USAGE:
1162 :    
1163 :     C<< my $trunc = $feature->possibly_truncated(); >>
1164 :    
1165 :     =item RETURNS:
1166 :    
1167 :     Boolean C<TRUE> if the feature may be truncated;
1168 :     boolean C<FALSE> otherwise.
1169 :    
1170 :     =back
1171 :    
1172 : overbeek 1.4 =cut
1173 :    
1174 : overbeek 1.3 sub possibly_truncated {
1175 :     my($self) = @_;
1176 :     my $figO = $self->{_figO};
1177 :     my $fig = $figO->{_fig};
1178 :    
1179 :     return $fig->possibly_truncated($self->id);
1180 :     }
1181 :    
1182 : overbeek 1.4
1183 :    
1184 :     =head3 possible_frameshift
1185 :    
1186 : overbeek 1.13 =over 4
1187 :    
1188 :     =item USAGE:
1189 :    
1190 :     C<< my $fs = $feature->possible_frameshift(); >>
1191 :    
1192 :     =item RETURNS:
1193 :    
1194 :     Boolean C<TRUE> if the feature may be a frameshifted fragment;
1195 :     boolean C<FALSE> otherwise.
1196 :    
1197 :     (NOTE: This is a crude prototype implementation,
1198 :     and is mostly as an example of how to code using FIGO.)
1199 :    
1200 :     =back
1201 :    
1202 : overbeek 1.4 =cut
1203 :    
1204 : overbeek 1.3 sub possible_frameshift {
1205 :     my($self) = @_;
1206 :     my $figO = $self->{_figO};
1207 :     my($tmp_dir) = $figO->{_tmp_dir};
1208 : overbeek 1.22
1209 :     #...Skip tests and return '0' if truncated...
1210 : overbeek 1.3 if (! $self->possibly_truncated)
1211 :     {
1212 : overbeek 1.22 #...Get best precomputed BLAST hit if E-value < 1.0e-50:
1213 : overbeek 1.3 my @sims = $self->sims( -max => 1, -cutoff => 1.0e-50);
1214 : overbeek 1.22
1215 :     #...If a sim was returned:
1216 : overbeek 1.3 if (my $sim = shift @sims)
1217 :     {
1218 : overbeek 1.22 #...Get best hit FID and boundaries:
1219 : overbeek 1.3 my $peg2 = $sim->id2;
1220 :     my $ln1 = $sim->ln1;
1221 :     my $ln2 = $sim->ln2;
1222 :     my $b2 = $sim->b2;
1223 :     my $e2 = $sim->e2;
1224 : overbeek 1.22
1225 :     #...Convert from AA to BP, and pad out w/ 100 bp guard region:
1226 : overbeek 1.3 my $adjL = 100 + (($b2-1) * 3);
1227 :     my $adjR = 100 + (($ln2 - $e2) * 3);
1228 : overbeek 1.22
1229 :     #...If hit is more than 20% longer than query:
1230 : overbeek 1.3 if ($ln2 > (1.2 * $ln1))
1231 :     {
1232 : overbeek 1.22 #...Get and parse query location:
1233 : overbeek 1.3 my $loc = $self->location;
1234 :     if ($loc =~ /^(\S+)_(\d+)_(\d+)/)
1235 :     {
1236 :     my $contig = $1;
1237 :     my $beg = $2;
1238 : overbeek 1.22 my $end = $3;
1239 :    
1240 :     #...Create new ContigO object:
1241 :     my $contigO = new ContigO($figO, $self->genome->id, $contig);
1242 :    
1243 :     #...Extract DNA subsequence, including guard regions:
1244 :     my $begA = &max(1, $beg - $adjL);
1245 :     my $endA = &min($end+$adjR, $contigO->contig_length);
1246 : overbeek 1.3 my $dna = $contigO->dna_seq($begA,$endA);
1247 : overbeek 1.23 if (defined($dna) && (length($dna) > 90))
1248 :     {
1249 :     #...Open tmp-file and write FASTA containing DNA subregion to be BLASTed:
1250 :     open( TMP, ">$tmp_dir/tmp_dna") || die "could not open tmp_dna";
1251 :     print TMP ">dna\n$dna\n";
1252 :     close(TMP);
1253 : overbeek 1.22
1254 : overbeek 1.23 #...Create new FeatureO object corresponding tp $peg2:
1255 :     my $pegO2 = new FeatureO($figO,$peg2);
1256 : overbeek 1.22
1257 : overbeek 1.23 #...Fetch its translation, and print to tmp FASTA file for BLASTing:
1258 :     my $prot = $pegO2->prot_seq;
1259 :     if (defined($prot) && (length($prot) > 30))
1260 :     {
1261 :     open( TMP, ">$tmp_dir/tmp_prot") || die "could not open tmp_prot";
1262 :     print TMP ">tmp_prot\n$prot\n";
1263 :     close(TMP);
1264 : overbeek 1.22
1265 : overbeek 1.23 #...Build BLAST nucleotide database for extracted DNA region,
1266 :     # and TBLASTN $peg2 against the DNA:
1267 :     &run("formatdb -i $tmp_dir/tmp_dna -pF");
1268 :     open(BLAST,"blastall -i $tmp_dir/tmp_prot -d $tmp_dir/tmp_dna -p tblastn -FF -e 1.0e-50 |")
1269 :     || die "could not blast";
1270 :    
1271 :     #...Parse the TBLASTN output; find and sort HSPs by left boundary:
1272 :     my $db_seq_out = &gjoparseblast::next_blast_subject(\*BLAST,1);
1273 :     my @hsps = sort { $a->[0] <=> $b->[0] }
1274 :     map { [$_->[9], $_->[10], $_->[12], $_->[13]] }
1275 :     grep { $_->[1] < 1.0e-50 }
1276 :     @ { $db_seq_out->[6] };
1277 : overbeek 1.22
1278 : overbeek 1.23 #...Extract HSP boundary pairs:
1279 :     my @prot = map { [$_->[0], $_->[1]] } @hsps;
1280 :     my @dna = map { [$_->[2], $_->[3]] } @hsps;
1281 :    
1282 :     #...If the "cover" of the HSPs covers more than 90% of $peg2 w gaps < 3 AA,
1283 :     # and the "cover" of the HPSs cover more than 90% of the extracted DNA
1284 :     # w/ gaps < 9 bp (but not a multiple of 3), suspect a possible frameshift:
1285 :     if (&covers(\@prot,length($prot),3,0) && &covers(\@dna,3*length($prot),9,1))
1286 :     {
1287 :     return 1;
1288 :     }
1289 :     }
1290 : overbeek 1.3 }
1291 :     }
1292 :     }
1293 :     }
1294 :     }
1295 :     return 0;
1296 :     }
1297 :    
1298 : overbeek 1.4
1299 :    
1300 :     =head3 run
1301 :    
1302 : overbeek 1.13 (Note: This function should be considered "PRIVATE")
1303 :    
1304 :     =over 4
1305 :    
1306 :     =item FUNCTION:
1307 :    
1308 :     Passes a string containing a command to be execture by the "system" shell command.
1309 :    
1310 :     =item USAGE:
1311 :    
1312 :     C<< $feature->run($cmd); >>
1313 :    
1314 :     =item RETURNS:
1315 :    
1316 :     Nil if the execution of C<$cmd> was successful;
1317 :     aborts with traceback if C<$cmd> fails.
1318 : overbeek 1.4
1319 : overbeek 1.13 =back
1320 :    
1321 :     =cut
1322 :    
1323 :     sub run {
1324 : overbeek 1.3 my($cmd) = @_;
1325 : overbeek 1.23 (system($cmd) == 0) || confess("FAILED: $cmd");
1326 : overbeek 1.3 }
1327 :    
1328 : overbeek 1.4
1329 :    
1330 :     =head3 max
1331 :    
1332 : overbeek 1.13 (Note: This function should be considered "PRIVATE")
1333 :    
1334 :     =over 4
1335 :    
1336 :     =item USAGE:
1337 :    
1338 :     C<< my $max = $feature->max($x, $y); >>
1339 :    
1340 : gdpusch 1.24 =item C<$x> and C<$y>
1341 : overbeek 1.13
1342 : gdpusch 1.24 Numerical values.
1343 : overbeek 1.13
1344 : gdpusch 1.24 =item RETURNS:
1345 : overbeek 1.13
1346 :     The larger of the two numerical values C<$x> and C<$y>.
1347 :    
1348 :     =back
1349 :    
1350 : overbeek 1.4 =cut
1351 :    
1352 : overbeek 1.3 sub max {
1353 :     my($x,$y) = @_;
1354 :     return ($x < $y) ? $y : $x;
1355 :     }
1356 :    
1357 : overbeek 1.4
1358 :    
1359 :     =head3 min
1360 :    
1361 : overbeek 1.13 (Note: This function should be considered "PRIVATE")
1362 :    
1363 :     =over 4
1364 :    
1365 :     =item USAGE:
1366 :    
1367 :     C<< my $min = $feature->min($x, $y); >>
1368 :    
1369 : gdpusch 1.24 =item C<$x> and C<$y>
1370 : overbeek 1.13
1371 : gdpusch 1.24 Numerical values.
1372 : overbeek 1.13
1373 : overbeek 1.16 =item RETURNS:
1374 : overbeek 1.13
1375 :     The smaller of the two numerical values C<$x> and C<$y>.
1376 :    
1377 :     =back
1378 :    
1379 : overbeek 1.4 =cut
1380 :    
1381 : overbeek 1.3 sub min {
1382 :     my($x,$y) = @_;
1383 :     return ($x < $y) ? $x : $y;
1384 :     }
1385 :    
1386 : overbeek 1.4
1387 :    
1388 :     =head3 covers
1389 :    
1390 : overbeek 1.16 (Question: Should this function be considered "PRIVATE" ???)
1391 :    
1392 :     USAGE:
1393 :     C<< if (&covers(\@hits, $len, $diff, $must_shift)) { #...Do stuff } >>
1394 :    
1395 :     Returns boolean C<TRUE> if a set of BLAST HSPs "cover" more than 90%
1396 :     of the database sequence(?).
1397 :    
1398 : overbeek 1.4 =cut
1399 :    
1400 : overbeek 1.3 sub covers {
1401 : overbeek 1.14 my($hsps,$ln,$diff,$must_shift) = @_;
1402 : overbeek 1.3
1403 :     my $hsp1 = shift @$hsps;
1404 :     my $hsp2;
1405 : overbeek 1.15 my $merged = 0;
1406 : overbeek 1.14 while ($hsp1 && ($hsp2 = shift @$hsps) &&
1407 :     ($must_shift ? &diff_frames($hsp1,$hsp2) : 1) &&
1408 : overbeek 1.15 ($hsp1 = &merge($hsp1,$hsp2,$diff))) { $merged = 1 }
1409 :     return ($merged && $hsp1 && (($hsp1->[1] - $hsp1->[0]) > (0.9 * $ln)));
1410 : overbeek 1.3 }
1411 :    
1412 : overbeek 1.14 sub diff_frames {
1413 :     my($hsp1,$hsp2) = @_;
1414 :     return (($hsp1->[0] % 3) != ($hsp2->[0] % 3));
1415 :     }
1416 : overbeek 1.4
1417 : overbeek 1.16
1418 :    
1419 : overbeek 1.4 =head3 merge
1420 :    
1421 : overbeek 1.16 Merge two HSPs unless their overlap or separation is too large.
1422 :    
1423 :     RETURNS: Merged boundaries if merger succeeds, and C<undef> if merger fails.
1424 :    
1425 : overbeek 1.4 =cut
1426 :    
1427 : overbeek 1.3 sub merge {
1428 :     my($hsp1,$hsp2,$diff) = @_;
1429 :    
1430 :     my($b1,$e1) = @$hsp1;
1431 :     my($b2,$e2) = @$hsp2;
1432 :     return (($e2 > $e1) && (abs($b2-$e1) <= $diff)) ? [$b1,$e2] : undef;
1433 :     }
1434 :    
1435 : overbeek 1.4
1436 :    
1437 :     =head3 sims
1438 :    
1439 : overbeek 1.16 =over 4
1440 :    
1441 :     =item FUNCTION:
1442 :    
1443 :     Returns precomputed "Sim.pm" objects from the SEED.
1444 :    
1445 :     =item USAGE:
1446 : gdpusch 1.24
1447 : overbeek 1.16 C<< my @sims = $pegO->sims( -all, -cutoff => 1.0e-10); >>
1448 :    
1449 :     C<< my @sims = $pegO->sims( -max => 50, -cutoff => 1.0e-10); >>
1450 :    
1451 :     =item RETURNS: List of sim objects.
1452 :    
1453 :     =back
1454 :    
1455 : overbeek 1.4 =cut
1456 :    
1457 : overbeek 1.2 use Sim;
1458 :     sub sims {
1459 :     my($self,%args) = @_;
1460 :    
1461 :     my $figO = $self->{_figO};
1462 :     my $fig = $figO->{_fig};
1463 :    
1464 :     my $cutoff = $args{-cutoff} ? $args{-cutoff} : 1.0e-5;
1465 : overbeek 1.21 my $all = $args{-all} ? 'all' : "fig";
1466 : overbeek 1.2 my $max = $args{-max} ? $args{-max} : 10000;
1467 : overbeek 1.20
1468 :     my @sims = $fig->sims($self->id,$max,$cutoff,$all);
1469 :    
1470 :     if (@sims) {
1471 :     my $peg1 = FeatureO->new($figO, $sims[0]->[0]);
1472 :    
1473 :     foreach my $sim (@sims) {
1474 : overbeek 1.21 # $sim->[0] = $peg1;
1475 :     # $sim->[1] = FeatureO->new($figO, $sim->[1]);
1476 : overbeek 1.20 }
1477 :     }
1478 :    
1479 :     return @sims;
1480 : overbeek 1.2 }
1481 :    
1482 : overbeek 1.4
1483 :    
1484 :     =head3 bbhs
1485 :    
1486 : overbeek 1.16 =over 4
1487 :    
1488 : gdpusch 1.24 =item FUNCTION:
1489 : overbeek 1.16
1490 :     Given a PEG-type "FeatureO" object, returns the list of BBHO objects
1491 :     corresponding to the pre-computed BBHs for that PEG.
1492 :    
1493 :     =item USAGE:
1494 :    
1495 :     C<< my @bbhs = $pegO->bbhs(); >>
1496 :    
1497 : gdpusch 1.24 =item RETURNS:
1498 :    
1499 :     List of BBHO objects.
1500 : overbeek 1.16
1501 :     =back
1502 :    
1503 : overbeek 1.4 =cut
1504 :    
1505 : overbeek 1.2 sub bbhs {
1506 :     my($self) = @_;
1507 :    
1508 :     my $figO = $self->{_figO};
1509 :     my $fig = $figO->{_fig};
1510 :    
1511 :     my @bbhs = $fig->bbhs($self->id);
1512 : overbeek 1.6 return map { my($peg2,$sc,$bs) = @$_; bless({ _figO => $figO,
1513 :     _peg1 => $self->id,
1514 : overbeek 1.2 _peg2 => $peg2,
1515 :     _psc => $sc,
1516 :     _bit_score => $bs
1517 :     },'BBHO') } @bbhs;
1518 :     }
1519 :    
1520 : gdpusch 1.24
1521 : overbeek 1.4 =head3 display
1522 :    
1523 : gdpusch 1.24 =over 4
1524 :    
1525 :     =item FUNCTION:
1526 :    
1527 : overbeek 1.16 Prints info about a "FeatureO" object to STDOUT.
1528 :    
1529 : gdpusch 1.24 =item USAGE:
1530 : overbeek 1.16
1531 :     C<< $pegO->display(); >>
1532 :    
1533 : gdpusch 1.24 =item RETURNS;
1534 :    
1535 :     (void)
1536 :    
1537 :     =back
1538 :    
1539 : overbeek 1.4 =cut
1540 :    
1541 : overbeek 1.1 sub display {
1542 :     my($self) = @_;
1543 :    
1544 :     print join("\t",$self->id,$self->location,$self->function_of),"\n",
1545 :     $self->dna_seq,"\n",
1546 :     $self->prot_seq,"\n";
1547 :     }
1548 :    
1549 : overbeek 1.4
1550 :    
1551 :     ########################################################################
1552 : overbeek 1.2 package BBHO;
1553 : overbeek 1.4 ########################################################################
1554 :    
1555 :     =head1 BBHO
1556 :    
1557 : overbeek 1.16 Methods for accessing "Bidirectiona Best Hits" (BBHs).
1558 :    
1559 : overbeek 1.4 =cut
1560 :    
1561 :    
1562 :     =head3 new
1563 :    
1564 : overbeek 1.16 Constructor of BBHO objects.
1565 :    
1566 :     (NOTE: The "average user" should never need to invoke this method.)
1567 :    
1568 : overbeek 1.4 =cut
1569 : overbeek 1.2
1570 :     sub new {
1571 : overbeek 1.6 my($class,$figO,$peg1,$peg2,$sc,$normalized_bitscore) = @_;
1572 : overbeek 1.2
1573 :     my $self = {};
1574 : overbeek 1.6 $self->{_figO} = $figO;
1575 : overbeek 1.2 $self->{_peg1} = $peg1;
1576 :     $self->{_peg2} = $peg2;
1577 :     $self->{_psc} = $sc;
1578 :     $self->{_bit_score} = $normalized_bitscore
1579 :    
1580 : overbeek 1.16 }
1581 :    
1582 : overbeek 1.2
1583 : overbeek 1.4
1584 :     =head3 peg1
1585 :    
1586 : overbeek 1.16 =over 4
1587 :    
1588 :     =item USAGE:
1589 :    
1590 :     C<< my $peg1 = $bbh->peg1(); >>
1591 :    
1592 :     =item RETURNS:
1593 :    
1594 :     A "FeatureO" object corresponding to the "query" sequence
1595 :     in a BBH pair.
1596 :    
1597 :     =back
1598 :    
1599 : overbeek 1.4 =cut
1600 :    
1601 : overbeek 1.2 sub peg1 {
1602 :     my($self) = @_;
1603 :    
1604 : overbeek 1.6 my $figO = $self->{_figO};
1605 :     return new FeatureO($figO,$self->{_peg1});
1606 : overbeek 1.2 }
1607 :    
1608 : overbeek 1.6 =head3 peg2
1609 : overbeek 1.4
1610 : overbeek 1.16 =over 4
1611 :    
1612 :     =item USAGE:
1613 :    
1614 :     C<< my $peg2 = $bbh->peg2(); >>
1615 :    
1616 :     =item RETURNS:
1617 :    
1618 :     A "FeatureO" object corresponding to the "database" sequence
1619 :     in a BBH pair.
1620 :    
1621 :     =back
1622 :    
1623 : overbeek 1.4 =cut
1624 :    
1625 : overbeek 1.2 sub peg2 {
1626 :     my($self) = @_;
1627 :    
1628 : overbeek 1.6 my $figO = $self->{_figO};
1629 :     return new FeatureO($figO,$self->{_peg2});
1630 : overbeek 1.2 }
1631 :    
1632 : overbeek 1.4
1633 :    
1634 :     =head3 psc
1635 :    
1636 : overbeek 1.16 =over 4
1637 :    
1638 :     =item USAGE:
1639 :    
1640 :     C<< my $psc = $bbh->psc(); >>
1641 :    
1642 :     =item RETURNS:
1643 :    
1644 :     The numerical value of the BLAST E-value for the pair.
1645 :    
1646 :     =back
1647 :    
1648 : overbeek 1.4 =cut
1649 :    
1650 : overbeek 1.2 sub psc {
1651 :     my($self) = @_;
1652 :    
1653 :     return $self->{_psc};
1654 :     }
1655 :    
1656 : overbeek 1.4
1657 :    
1658 :     =head3 norm_bitscore
1659 :    
1660 : overbeek 1.16
1661 :     =over 4
1662 :    
1663 :     =item USAGE:
1664 :    
1665 :     C<< my $bsc = $bbh->norm_bitscore(); >>
1666 :    
1667 :     =item RETURNS:
1668 :    
1669 :     The "BLAST bit-score per aligned character" for the pair.
1670 :    
1671 :     =back
1672 :    
1673 : overbeek 1.4 =cut
1674 :    
1675 : overbeek 1.2 sub norm_bitscore {
1676 :     my($self) = @_;
1677 :    
1678 :     return $self->{_bit_score};
1679 :     }
1680 :    
1681 : overbeek 1.4
1682 :    
1683 :     ########################################################################
1684 : overbeek 1.1 package AnnotationO;
1685 : overbeek 1.4 ########################################################################
1686 :    
1687 :     =head1 AnnotationO
1688 :    
1689 : overbeek 1.16 Methods for accessing SEED annotations.
1690 :    
1691 : overbeek 1.4 =cut
1692 :    
1693 :    
1694 :    
1695 :     =head3 new
1696 :    
1697 : gdpusch 1.24 =over 4
1698 :    
1699 :     =item FUNCTION:
1700 :    
1701 :     Cronstruct a new "AnnotationO" object
1702 :    
1703 :     =item USAGE:
1704 :    
1705 :     C<< my $annotO = AnnotationO->new( $fid, $timestamp, $who, $text); >>
1706 :    
1707 :     =item C<$fid>
1708 :    
1709 :     A feature identifier.
1710 :    
1711 :     =item C<$timestamp>
1712 :    
1713 :     The C<UN*X> timestamp one wishes to associate with the annotation.
1714 :    
1715 :     =item C<$who>
1716 :    
1717 :     The annotator's user-name.
1718 :    
1719 :     =item C<$text>
1720 :    
1721 :     The textual content of the annotation.
1722 :    
1723 :     =item RETURNS:
1724 :    
1725 :     An "AnnotationO" object.
1726 :    
1727 :     =back
1728 :    
1729 : overbeek 1.4 =cut
1730 : overbeek 1.1
1731 :     sub new {
1732 :     my($class,$fid,$timestamp,$who,$text) = @_;
1733 :    
1734 :     my $self = {};
1735 :     $self->{_fid} = $fid;
1736 :     $self->{_timestamp} = $timestamp;
1737 :     $self->{_who} = $who;
1738 :     $self->{_text} = $text;
1739 :     return bless $self, $class;
1740 :     }
1741 :    
1742 : overbeek 1.4
1743 :    
1744 :     =head3 fid
1745 :    
1746 : gdpusch 1.24 =over 4
1747 :    
1748 :     =item FUNCTION:
1749 :    
1750 :     Extract the feature-ID that was annotated.
1751 :    
1752 :     =item USAGE:
1753 :    
1754 :     C<< my $fid = $annotO->fid(); >>
1755 :    
1756 :     =item RETURNS;
1757 :    
1758 :     The feature-ID as a string.
1759 :    
1760 :     =back
1761 :    
1762 : overbeek 1.4 =cut
1763 :    
1764 : overbeek 1.1 sub fid {
1765 :     my($self) = @_;
1766 :    
1767 :     return $self->{_fid};
1768 :     }
1769 :    
1770 : overbeek 1.4
1771 :    
1772 :     =head3 timestamp
1773 :    
1774 : gdpusch 1.24 =over 4
1775 :    
1776 :     =item FUNCTION:
1777 :    
1778 :     Extract the C<UN*X> timestamp of the annotation.
1779 :    
1780 :     =item USAGE:
1781 :    
1782 :     C<< my $fid = $annotO->timestamp(); >>
1783 :    
1784 :     =item RETURNS;
1785 :    
1786 :     The timestamp as a string.
1787 :    
1788 :     =back
1789 :    
1790 : overbeek 1.4 =cut
1791 :    
1792 : overbeek 1.1 sub timestamp {
1793 :     my($self,$convert) = @_;
1794 :    
1795 :     if ($convert)
1796 :     {
1797 :     return scalar localtime($self->{_timestamp});
1798 :     }
1799 :     else
1800 :     {
1801 :     return $self->{_timestamp};
1802 :     }
1803 :     }
1804 :    
1805 : overbeek 1.4
1806 :    
1807 :     =head3 made_by
1808 :    
1809 : gdpusch 1.24 =over 4
1810 :    
1811 :     =item FUNCTION:
1812 :    
1813 :     Extract the annotator's user-name.
1814 :    
1815 :     =item USAGE:
1816 :    
1817 :     C<< my $fid = $annotO->made_by(); >>
1818 :    
1819 :     =item RETURNS;
1820 :    
1821 :     The username of the annotator, as a string.
1822 :    
1823 :     =back
1824 :    
1825 : overbeek 1.4 =cut
1826 :    
1827 : overbeek 1.1 sub made_by {
1828 :     my($self) = @_;
1829 :    
1830 :     my $who = $self->{_who};
1831 :     $who =~ s/^master://i;
1832 :     return $who;
1833 :     }
1834 :    
1835 : overbeek 1.4
1836 :    
1837 :     =head3 text
1838 :    
1839 : gdpusch 1.24 =over 4
1840 :    
1841 :     =item FUNCTION:
1842 :    
1843 :     Extract the text of the annotation.
1844 :    
1845 :     =item USGAE:
1846 :    
1847 :     C<< my $text = $annotO->text(); >>
1848 :    
1849 :     =item RETURNS:
1850 :    
1851 :     The text of the annotation, as a string.
1852 :    
1853 :     =back
1854 :    
1855 : overbeek 1.4 =cut
1856 :    
1857 : overbeek 1.1 sub text {
1858 :     my($self) = @_;
1859 :    
1860 :     my $text = $self->{_text};
1861 :     return $text;
1862 :     }
1863 :    
1864 : overbeek 1.4
1865 :     =head3 display
1866 :    
1867 : gdpusch 1.24 =over 4
1868 :    
1869 :     =item FUNCTION:
1870 :    
1871 :     Print the contents of an "AnnotationO" object to B<STDOUT>
1872 :     in human-readable form.
1873 :    
1874 :     =item USAGE:
1875 :    
1876 :     C<< my $annotO->display(); >>
1877 :    
1878 :     =item RETURNS:
1879 :    
1880 :     (void)
1881 :    
1882 :     =back
1883 :    
1884 : overbeek 1.4 =cut
1885 :    
1886 : overbeek 1.1 sub display {
1887 :     my($self) = @_;
1888 :    
1889 :     print join("\t",($self->fid,$self->timestamp(1),$self->made_by)),"\n",$self->text,"\n";
1890 :     }
1891 :    
1892 : overbeek 1.4
1893 :    
1894 :     ########################################################################
1895 : overbeek 1.1 package CouplingO;
1896 : overbeek 1.4 ########################################################################
1897 :     use Data::Dumper;
1898 :    
1899 : overbeek 1.13 =head1 CouplingO
1900 :    
1901 : overbeek 1.16 Methods for accessing the "Functional coupling scores"
1902 :     of PEGs in close physical proximity to each other.
1903 :    
1904 : overbeek 1.13 =cut
1905 :    
1906 :    
1907 :    
1908 : overbeek 1.4 =head3 new
1909 : overbeek 1.1
1910 : gdpusch 1.24 =over 4
1911 :    
1912 :     =item FUNCTION:
1913 :    
1914 :     Construct a new "CouplingO" object
1915 :     encapsulating the "functional coupling" score
1916 :     between a pair of features in some genome.
1917 :    
1918 :     =item USAGE:
1919 :    
1920 :     C<< $couplingO = CouplingO->new($figO, $fid1, $fid2, $sc); >>
1921 :    
1922 :     =item C<$figO>
1923 :    
1924 :     Parent "FIGO" object.
1925 :    
1926 :     =item C<$fid1> and C<$fid2>
1927 :    
1928 :     A pair of feature-IDs.
1929 :    
1930 :     =item C<$sc>
1931 :    
1932 :     A functional-coupling score
1933 :    
1934 :     =item RETURNS:
1935 :    
1936 :     A "CouplingO" object.
1937 :    
1938 :     =back
1939 :    
1940 : overbeek 1.4 =cut
1941 : overbeek 1.1
1942 :     sub new {
1943 :     my($class,$figO,$peg1,$peg2,$sc) = @_;
1944 :    
1945 :     ($peg1 =~ /^fig\|\d+\.\d+\.peg\.\d+$/) || return undef;
1946 :     ($peg2 =~ /^fig\|\d+\.\d+\.peg\.\d+$/) || return undef;
1947 :     my $self = {};
1948 :     $self->{_figO} = $figO;
1949 :     $self->{_peg1} = $peg1;
1950 :     $self->{_peg2} = $peg2;
1951 :     $self->{_sc} = $sc;
1952 :     return bless $self, $class;
1953 :     }
1954 :    
1955 : overbeek 1.4
1956 :    
1957 :     =head3 peg1
1958 :    
1959 : gdpusch 1.24 =over 4
1960 :    
1961 :     =item FUNCTION:
1962 :    
1963 :     Returns a "FeatureO" object corresponding to the first FID in a coupled pair.
1964 :    
1965 :     =item USAGE:
1966 :    
1967 :     C<< my $peg1 = $couplingO->peg1(); >>
1968 :    
1969 :     =item RETURNS:
1970 :    
1971 :     A "FeatureO" object.
1972 :    
1973 :     =back
1974 :    
1975 : overbeek 1.4 =cut
1976 :    
1977 : overbeek 1.1 sub peg1 {
1978 :     my($self) = @_;
1979 :    
1980 : overbeek 1.5 my $figO = $self->{_figO};
1981 :     return new FeatureO($figO,$self->{_peg1});
1982 : overbeek 1.1 }
1983 :    
1984 : overbeek 1.4
1985 :    
1986 : gdpusch 1.24 =head3 peg2
1987 :    
1988 :     =over 4
1989 :    
1990 :     =item FUNCTION:
1991 :    
1992 :     Returns a "FeatureO" object corresponding to the second FID in a coupled pair.
1993 :    
1994 :     =item USAGE:
1995 :    
1996 :     C<< my $peg2 = $couplingO->peg2(); >>
1997 :    
1998 :     =item RETURNS:
1999 :    
2000 :     A "FeatureO" object.
2001 :    
2002 :     =back
2003 : overbeek 1.4
2004 :     =cut
2005 :    
2006 : overbeek 1.1 sub peg2 {
2007 :     my($self) = @_;
2008 :    
2009 : overbeek 1.5 my $figO = $self->{_figO};
2010 :     return new FeatureO($figO,$self->{_peg2});
2011 : overbeek 1.1 }
2012 :    
2013 : overbeek 1.4
2014 :    
2015 :     =head3 sc
2016 :    
2017 : gdpusch 1.24 =over 4
2018 :    
2019 :     =item FUNCTION:
2020 :    
2021 :     Extracts the "functional coupling" score from a "CouplingO" object.
2022 :    
2023 :     =item USAGE:
2024 :    
2025 :     C<< my $sc = $couplingO->sc(); >>
2026 :    
2027 :     =item RETURNS:
2028 :    
2029 :     A scalar score.
2030 :    
2031 :     =back
2032 :    
2033 : overbeek 1.4 =cut
2034 :    
2035 : overbeek 1.1 sub sc {
2036 :     my($self) = @_;
2037 :    
2038 :     return $self->{_sc};
2039 :     }
2040 :    
2041 : overbeek 1.4
2042 :    
2043 :     =head3 evidence
2044 :    
2045 : gdpusch 1.24 =over 4
2046 :    
2047 :     =item FUNCTION:
2048 :    
2049 :     Fetch the evidence for a "functional coupling" between two close PEGs,
2050 :     in the form of a list of objects describing the "Pairs of Close Homologs" (PCHs)
2051 :     supporting the existence of a functional coupling between the two close PEGs.
2052 :    
2053 :     =item USAGE:
2054 :    
2055 :     C<< my $evidence = $couplingO->evidence(); >>
2056 :    
2057 :     =item RETURNS
2058 :    
2059 :     List of pairs of "FeatureO" objects.
2060 :    
2061 :     =back
2062 :    
2063 : overbeek 1.4 =cut
2064 :    
2065 : overbeek 1.1 sub evidence {
2066 :     my($self) = @_;
2067 :    
2068 :     my $figO = $self->{_figO};
2069 :     my $fig = $figO->{_fig};
2070 :     my @ev = ();
2071 : overbeek 1.19 foreach my $tuple ($fig->coupling_evidence($self->peg1->id,$self->peg2->id))
2072 : overbeek 1.1 {
2073 :     my($peg3,$peg4,$rep) = @$tuple;
2074 :     push(@ev,[&FeatureO::new('FeatureO',$figO,$peg3),
2075 :     &FeatureO::new('FeatureO',$figO,$peg4),
2076 :     $rep]);
2077 :     }
2078 :     return @ev;
2079 :     }
2080 :    
2081 : overbeek 1.4
2082 :    
2083 :     =head3 display
2084 :    
2085 : gdpusch 1.24 =over 4
2086 :    
2087 :     =item FUNCTION:
2088 :    
2089 :     Print the contents of a "CouplingO" object to B<STDOUT> in human-readable form.
2090 :    
2091 :     =item USAGE:
2092 :    
2093 :     C<< $couplingO->display(); >>
2094 :    
2095 :     =item RETURNS:
2096 :    
2097 :     (Void)
2098 :    
2099 :     =back
2100 :    
2101 : overbeek 1.4 =cut
2102 :    
2103 : overbeek 1.1 sub display {
2104 :     my($self) = @_;
2105 :    
2106 :     print join("\t",($self->peg1,$self->peg2,$self->sc)),"\n";
2107 :     }
2108 :    
2109 : overbeek 1.4
2110 :    
2111 :     ########################################################################
2112 : overbeek 1.1 package SubsystemO;
2113 : overbeek 1.4 ########################################################################
2114 : overbeek 1.1 use Data::Dumper;
2115 :     use Subsystem;
2116 :    
2117 : overbeek 1.4 =head1 SubsystemO
2118 :    
2119 :     =cut
2120 :    
2121 :    
2122 :    
2123 :     =head3 new
2124 :    
2125 :     =cut
2126 :    
2127 : overbeek 1.1 sub new {
2128 :     my($class,$figO,$name) = @_;
2129 :    
2130 :     my $self = {};
2131 :     $self->{_figO} = $figO;
2132 :     $self->{_id} = $name;
2133 :    
2134 :     return bless $self, $class;
2135 :     }
2136 :    
2137 : overbeek 1.4
2138 :    
2139 :     =head3 id
2140 :    
2141 :     =cut
2142 :    
2143 : overbeek 1.1 sub id {
2144 :     my($self) = @_;
2145 :    
2146 :     return $self->{_id};
2147 :     }
2148 :    
2149 : overbeek 1.4
2150 :    
2151 :     =head3 usable
2152 :    
2153 : overbeek 1.16
2154 : overbeek 1.4 =cut
2155 :    
2156 : overbeek 1.1 sub usable {
2157 :     my($self) = @_;
2158 :    
2159 :     my $figO = $self->{_figO};
2160 :     my $fig = $figO->{_fig};
2161 :     return $fig->usable_subsystem($self->id);
2162 :     }
2163 :    
2164 : overbeek 1.4
2165 :    
2166 :     =head3 genomes
2167 :    
2168 :     =cut
2169 :    
2170 : overbeek 1.1 sub genomes {
2171 :     my($self) = @_;
2172 :    
2173 :     my $figO = $self->{_figO};
2174 :     my $subO = $self->{_subO};
2175 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2176 :    
2177 :     return map { &GenomeO::new('GenomeO',$figO,$_) } $subO->get_genomes;
2178 :     }
2179 :    
2180 : overbeek 1.9
2181 :    
2182 : overbeek 1.4 =head3 roles
2183 :    
2184 :     =cut
2185 :    
2186 : overbeek 1.1 sub roles {
2187 :     my($self) = @_;
2188 :    
2189 :     my $figO = $self->{_figO};
2190 :     my $subO = $self->{_subO};
2191 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2192 : overbeek 1.9
2193 : overbeek 1.1 return map { &FunctionalRoleO::new('FunctionalRoleO',$figO,$_) } $subO->get_roles($self->id);
2194 :     }
2195 :    
2196 : overbeek 1.9
2197 :    
2198 : overbeek 1.4 =head3 curator
2199 :    
2200 :     =cut
2201 :    
2202 : overbeek 1.1 sub curator {
2203 :     my($self) = @_;
2204 :    
2205 :     my $figO = $self->{_figO};
2206 :     my $subO = $self->{_subO};
2207 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2208 : overbeek 1.9
2209 :     return $subO->get_curator;
2210 : overbeek 1.1 }
2211 :    
2212 : overbeek 1.4
2213 :    
2214 :    
2215 :     =head3 variant
2216 :    
2217 :     =cut
2218 :    
2219 : overbeek 1.1 sub variant {
2220 :     my($self,$genome) = @_;
2221 :    
2222 :     my $figO = $self->{_figO};
2223 :     my $subO = $self->{_subO};
2224 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2225 :    
2226 :     return $subO->get_variant_code_for_genome($genome->id);
2227 :     }
2228 : overbeek 1.4
2229 :    
2230 :    
2231 :     =head3 pegs_in_cell
2232 :    
2233 :     =cut
2234 :    
2235 : overbeek 1.1 sub pegs_in_cell {
2236 :     my($self,$genome,$role) = @_;
2237 :    
2238 :     my $figO = $self->{_figO};
2239 :     my $subO = $self->{_subO};
2240 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2241 :    
2242 :     return $subO->get_pegs_from_cell($genome->id,$role->id);
2243 :     }
2244 :    
2245 : overbeek 1.4
2246 :    
2247 :     ########################################################################
2248 : overbeek 1.1 package FunctionalRoleO;
2249 : overbeek 1.4 ########################################################################
2250 :     use Data::Dumper;
2251 : overbeek 1.1
2252 : overbeek 1.4 =head1 FunctionalRoleO
2253 :    
2254 : overbeek 1.9 Methods for accessing the functional roles of features.
2255 :    
2256 : overbeek 1.4 =cut
2257 :    
2258 :    
2259 :     =head3 new
2260 :    
2261 :     =cut
2262 : overbeek 1.1
2263 :     sub new {
2264 :     my($class,$figO,$fr) = @_;
2265 :    
2266 :     my $self = {};
2267 :     $self->{_figO} = $figO;
2268 :     $self->{_id} = $fr;
2269 :     return bless $self, $class;
2270 :     }
2271 :    
2272 : overbeek 1.4
2273 :    
2274 :     =head3 id
2275 :    
2276 :     =cut
2277 :    
2278 : overbeek 1.1 sub id {
2279 :     my($self) = @_;
2280 :    
2281 :     return $self->{_id};
2282 :     }
2283 :    
2284 : overbeek 1.4
2285 :    
2286 :     ########################################################################
2287 : overbeek 1.1 package FigFamO;
2288 : overbeek 1.4 ########################################################################
2289 : overbeek 1.1 use FigFams;
2290 :     use FigFam;
2291 :    
2292 : overbeek 1.4
2293 :     =head1 FigFamO
2294 :    
2295 :     =cut
2296 :    
2297 :    
2298 :     =head3 new
2299 :    
2300 :     =cut
2301 :    
2302 : overbeek 1.1 sub new {
2303 :     my($class,$figO,$id) = @_;
2304 :    
2305 :     my $self = {};
2306 :     $self->{_figO} = $figO;
2307 :     $self->{_id} = $id;
2308 :     return bless $self, $class;
2309 :     }
2310 :    
2311 : overbeek 1.4
2312 :    
2313 :     =head3 id
2314 :    
2315 :     =cut
2316 :    
2317 : overbeek 1.1 sub id {
2318 :     my($self) = @_;
2319 :    
2320 :     return $self->{_id};
2321 :     }
2322 :    
2323 : overbeek 1.4
2324 :     =head3 function
2325 :    
2326 :     =cut
2327 :    
2328 : overbeek 1.1 sub function {
2329 :     my($self) = @_;
2330 :    
2331 :     my $fig = $self->{_figO}->{_fig};
2332 :     my $famO = $self->{_famO};
2333 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2334 :    
2335 :     return $famO->family_function;
2336 :     }
2337 :    
2338 : overbeek 1.4
2339 :    
2340 :     =head3 members
2341 :    
2342 :     =cut
2343 :    
2344 : overbeek 1.1 sub members {
2345 :     my($self) = @_;
2346 :    
2347 :     my $figO = $self->{_figO};
2348 :     my $fig = $figO->{_fig};
2349 :     my $famO = $self->{_famO};
2350 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2351 :    
2352 : overbeek 1.18 return map { &FeatureO::new('FeatureO',$figO,$_) } $famO->list_members;
2353 : overbeek 1.1 }
2354 :    
2355 : overbeek 1.4 =head3 rep_seqs
2356 :    
2357 :     =cut
2358 :    
2359 : overbeek 1.1 sub rep_seqs {
2360 :     my($self) = @_;
2361 :    
2362 :     my $figO = $self->{_figO};
2363 :     my $fig = $figO->{_fig};
2364 :     my $famO = $self->{_famO};
2365 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2366 :    
2367 :     return $famO->representatives;
2368 :     }
2369 :    
2370 : overbeek 1.4
2371 :    
2372 :     =head3 should_be_member
2373 :    
2374 :     =cut
2375 :    
2376 : overbeek 1.1 sub should_be_member {
2377 :     my($self,$seq) = @_;
2378 :    
2379 :     my $figO = $self->{_figO};
2380 :     my $fig = $figO->{_fig};
2381 :     my $famO = $self->{_famO};
2382 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2383 :    
2384 :     return $famO->should_be_member($seq);
2385 :     }
2386 :    
2387 :    
2388 :    
2389 : overbeek 1.4 =head3 display
2390 :    
2391 :     =cut
2392 :    
2393 : overbeek 1.1 sub display {
2394 :     my($self) = @_;
2395 :    
2396 :     print join("\t",($self->id,$self->function)),"\n";
2397 :     }
2398 :    
2399 :    
2400 :    
2401 : overbeek 1.4 ########################################################################
2402 : overbeek 1.1 package Attribute;
2403 : overbeek 1.4 ########################################################################
2404 :     =head1 Attribute
2405 :    
2406 : overbeek 1.9 (Note yet implemented.)
2407 :    
2408 : overbeek 1.4 =cut
2409 : overbeek 1.1
2410 :     1;
2411 : overbeek 1.4 __END__
2412 :    
2413 :     =head1 Examples
2414 :    
2415 :     =head3 Display all complete, prokaryotic genomes
2416 :    
2417 :     use FIGO;
2418 :     my $figO = new FIGO;
2419 :    
2420 :     foreach $genome ($figO->genomes('complete','prokaryotic'))
2421 :     {
2422 :     $genome->display;
2423 :     }
2424 :    
2425 :     #---------------------------------------------
2426 :    
2427 :     use FIG;
2428 :     my $fig = new FIG;
2429 :    
2430 :     foreach $genome (grep { $fig->is_prokaryotic($_) } $fig->genomes('complete'))
2431 :     {
2432 :     print join("\t",("Genome",$genome,$fig->genus_species($genome))),"\n";
2433 :     }
2434 :    
2435 :     ###############################################
2436 :    
2437 :     =head3 Show how to access contigs and extract sequence
2438 :    
2439 :     use FIGO;
2440 :     my $figO = new FIGO;
2441 :    
2442 :     $genomeId = '83333.1';
2443 :     my $genome = new GenomeO($figO,$genomeId);
2444 :    
2445 :     foreach $contig ($genome->contigs_of)
2446 :     {
2447 :     $tag1 = $contig->dna_seq(1,10);
2448 :     $tag2 = $contig->dna_seq(10,1);
2449 :     print join("\t",($tag1,$tag2,$contig->id,$contig->contig_length)),"\n";
2450 :     }
2451 :    
2452 :     #---------------------------------------------
2453 :    
2454 :     use FIG;
2455 :     my $fig = new FIG;
2456 :    
2457 :     $genomeId = '83333.1';
2458 :    
2459 :     $contig_lengths = $fig->contig_lengths($genomeId);
2460 :    
2461 :     foreach $contig ($fig->contigs_of($genomeId))
2462 :     {
2463 :     $tag1 = $fig->dna_seq($genomeId,join("_",($contig,1,10)));
2464 :     $tag2 = $fig->dna_seq($genomeId,join("_",($contig,10,1)));
2465 :     print join("\t",($tag1,$tag2,$contig,$contig_lengths->{$contig})),"\n";
2466 :     }
2467 :    
2468 :     ###############################################
2469 :    
2470 :     ### accessing data related to features
2471 :    
2472 :     use FIGO;
2473 :     my $figO = new FIGO;
2474 :    
2475 :     my $genome = new GenomeO($figO,"83333.1");
2476 :     my $peg = "fig|83333.1.peg.4";
2477 :     my $pegO = new FeatureO($figO,$peg);
2478 :    
2479 :     print join("\t",$pegO->id,$pegO->location,$pegO->function_of),"\n",
2480 :     $pegO->dna_seq,"\n",
2481 :     $pegO->prot_seq,"\n";
2482 :    
2483 :     foreach $fidO ($genome->features_of('rna'))
2484 :     {
2485 :     print join("\t",$fidO->id,$fidO->location,$fidO->function_of),"\n";
2486 :     }
2487 :    
2488 :     #---------------------------------------------
2489 :    
2490 :    
2491 :     use FIG;
2492 :     my $fig = new FIG;
2493 :    
2494 :     my $genome = "83333.1";
2495 :     my $peg = "fig|83333.1.peg.4";
2496 :    
2497 :     print join("\t",$peg,scalar $fig->feature_location($peg),scalar $fig->function_of($peg)),"\n",
2498 :     $fig->dna_seq($genome,$fig->feature_location($peg)),"\n",
2499 :     $fig->get_translation($peg),"\n";
2500 :    
2501 :     foreach $fid ($fig->all_features($genome,'rna'))
2502 :     {
2503 :     print join("\t",$fid,scalar $fig->feature_location($fid),scalar $fig->function_of($fid)),"\n";
2504 :     }
2505 :    
2506 :     ###############################################
2507 :    
2508 :     ### accessing similarities
2509 :    
2510 :     use FIGO;
2511 :     my $figO = new FIGO;
2512 :    
2513 :     $peg = "fig|83333.1.peg.4";
2514 :     $pegO = new FeatureO($figO,$peg);
2515 :    
2516 :     @sims = $pegO->sims; # use sims( -all => 1, -max => 10000, -cutoff => 1.0e-20) to all
2517 :     # sims (including non-FIG sequences
2518 :     foreach $sim (@sims)
2519 :     {
2520 :     $peg2 = $sim->id2;
2521 :     $pegO2 = new FeatureO($figO,$peg2);
2522 :     $func = $pegO2->function_of;
2523 :     $sc = $sim->psc;
2524 :     print join("\t",($peg2,$sc,$func)),"\n";
2525 :     }
2526 :    
2527 :     #---------------------------------------------
2528 :    
2529 :    
2530 :     use FIG;
2531 :     my $fig = new FIG;
2532 :    
2533 :     $peg = "fig|83333.1.peg.4";
2534 :    
2535 :     @sims = $fig->sims($peg,1000,1.0e-5,"fig");
2536 :     foreach $sim (@sims)
2537 :     {
2538 :     $peg2 = $sim->id2;
2539 :     $func = $fig->function_of($peg2);
2540 :     $sc = $sim->psc;
2541 :     print join("\t",($peg2,$sc,$func)),"\n";
2542 :     }
2543 :    
2544 :     ###############################################
2545 :    
2546 :     ### accessing BBHs
2547 :    
2548 :     use FIGO;
2549 :     my $figO = new FIGO;
2550 :    
2551 :     $peg = "fig|83333.1.peg.4";
2552 :     $pegO = new FeatureO($figO,$peg);
2553 :    
2554 :     @bbhs = $pegO->bbhs;
2555 :     foreach $bbh (@bbhs)
2556 :     {
2557 :     $peg2 = $bbh->peg2;
2558 :     $pegO2 = new FeatureO($figO,$peg2);
2559 :     $func = $pegO2->function_of;
2560 :     $sc = $bbh->psc;
2561 :     print join("\t",($peg2,$sc,$func)),"\n";
2562 :     }
2563 :    
2564 :     #---------------------------------------------
2565 :    
2566 :     use FIG;
2567 :     my $fig = new FIG;
2568 :    
2569 :     $peg = "fig|83333.1.peg.4";
2570 :    
2571 :     @bbhs = $fig->bbhs($peg);
2572 :     foreach $bbh (@bbhs)
2573 :     {
2574 :     ($peg2,$sc,$bit_score) = @$bbh;
2575 :     $func = $fig->function_of($peg2);
2576 :     print join("\t",($peg2,$sc,$func)),"\n";
2577 :     }
2578 :    
2579 :     ###############################################
2580 :    
2581 :     ### accessing annotations
2582 :    
2583 :     use FIGO;
2584 :     my $figO = new FIGO;
2585 :    
2586 :     $peg = "fig|83333.1.peg.4";
2587 :     $pegO = new FeatureO($figO,$peg);
2588 :    
2589 :     @annotations = $pegO->annotations;
2590 :    
2591 :     foreach $ann (@annotations)
2592 :     {
2593 :     print join("\n",$ann->fid,$ann->timestamp(1),$ann->made_by,$ann->text),"\n\n";
2594 :     }
2595 :    
2596 :     #---------------------------------------------
2597 :    
2598 :     use FIG;
2599 :     my $fig = new FIG;
2600 :    
2601 :     $peg = "fig|83333.1.peg.4";
2602 :     @annotations = $fig->feature_annotations($peg);
2603 :     foreach $_ (@annotations)
2604 :     {
2605 :     (undef,$ts,$who,$text) = @$_;
2606 :     $who =~ s/master://i;
2607 :     print "$ts\n$who\n$text\n\n";
2608 :     }
2609 :    
2610 :     ###############################################
2611 :    
2612 :     ### accessing coupling data
2613 :    
2614 :    
2615 :     use FIGO;
2616 :     my $figO = new FIGO;
2617 :    
2618 :     my $peg = "fig|83333.1.peg.4";
2619 :     my $pegO = new FeatureO($figO,$peg);
2620 :     foreach $coupled ($pegO->coupled_to)
2621 :     {
2622 :     print join("\t",($coupled->peg1,$coupled->peg2,$coupled->sc)),"\n";
2623 :     foreach $tuple ($coupled->evidence)
2624 :     {
2625 :     my($peg3O,$peg4O,$rep) = @$tuple;
2626 :     print "\t",join("\t",($peg3O->id,$peg4O->id,$rep)),"\n";
2627 :     }
2628 :     print "\n";
2629 :     }
2630 :    
2631 :     #---------------------------------------------
2632 :    
2633 :    
2634 :     use FIG;
2635 :     my $fig = new FIG;
2636 :    
2637 :     my $peg1 = "fig|83333.1.peg.4";
2638 :     foreach $coupled ($fig->coupled_to($peg1))
2639 :     {
2640 :     ($peg2,$sc) = @$coupled;
2641 :     print join("\t",($peg1,$peg2,$sc)),"\n";
2642 :     foreach $tuple ($fig->coupling_evidence($peg1,$peg2))
2643 :     {
2644 :     my($peg3,$peg4,$rep) = @$tuple;
2645 :     print "\t",join("\t",($peg3,$peg4,$rep)),"\n";
2646 :     }
2647 :     print "\n";
2648 :     }
2649 :    
2650 :     ###############################################
2651 :    
2652 :     =head3 Accessing Subsystem data
2653 :    
2654 :     use FIGO;
2655 :     my $figO = new FIGO;
2656 :    
2657 :     foreach $sub ($figO->subsystems)
2658 :     {
2659 :     if ($sub->usable)
2660 :     {
2661 :     print join("\t",($sub->id,$sub->curator)),"\n";
2662 :    
2663 :     print "\tRoles\n";
2664 :     @roles = $sub->roles;
2665 :     foreach $role (@roles)
2666 :     {
2667 :     print "\t\t",join("\t",($role->id)),"\n";
2668 :     }
2669 :    
2670 :     print "\tGenomes\n";
2671 :     foreach $genome ($sub->genomes)
2672 :     {
2673 :     print "\t\t",join("\t",($sub->variant($genome),
2674 :     $genome->id,
2675 :     $genome->genus_species)),"\n";
2676 :     @pegs = ();
2677 :     foreach $role (@roles)
2678 :     {
2679 :     push(@pegs,$sub->pegs_in_cell($genome,$role));
2680 :     }
2681 :     print "\t\t\t",join(",",@pegs),"\n";
2682 :     }
2683 :     }
2684 :     }
2685 :    
2686 :     #---------------------------------------------
2687 :    
2688 :     use FIG;
2689 :     my $fig = new FIG;
2690 :    
2691 :     foreach $sub (grep { $fig->usable_subsystem($_) } $fig->all_subsystems)
2692 :     {
2693 :     $subO = new Subsystem($sub,$fig);
2694 :     $curator = $subO->get_curator;
2695 :     print join("\t",($sub,$curator)),"\n";
2696 :    
2697 :     print "\tRoles\n";
2698 :     @roles = $subO->get_roles;
2699 :     foreach $role (@roles)
2700 :     {
2701 :     print "\t\t",join("\t",($role)),"\n";
2702 :     }
2703 :    
2704 :     print "\tGenomes\n";
2705 :     foreach $genome ($subO->get_genomes)
2706 :     {
2707 :     print "\t\t",join("\t",($subO->get_variant_code_for_genome($genome),
2708 :     $genome,
2709 :     $fig->genus_species($genome))),"\n";
2710 :     foreach $role (@roles)
2711 :     {
2712 :     push(@pegs,$subO->get_pegs_from_cell($genome,$role));
2713 :     }
2714 :     print "\t\t\t",join(",",@pegs),"\n";
2715 :     }
2716 :     print "\n";
2717 :     }
2718 :    
2719 :     ###############################################
2720 :    
2721 :     =head3 Accessing FIGfams
2722 :    
2723 :     use FIGO;
2724 :     my $figO = new FIGO;
2725 :    
2726 :     foreach $fam ($figO->all_figfams)
2727 :     {
2728 :     print join("\t",($fam->id,$fam->function)),"\n";
2729 :     foreach $pegO ($fam->members)
2730 :     {
2731 :     $peg = $pegO->id;
2732 :     print "\t$peg\n";
2733 :     }
2734 :     }
2735 :    
2736 :     #---------------------------------------------
2737 :    
2738 :     use FIG;
2739 :     use FigFam;
2740 :     use FigFams;
2741 :    
2742 :     my $fig = new FIG;
2743 :     my $figfams = new FigFams($fig);
2744 :    
2745 :     foreach $fam ($figfams->all_families)
2746 :     {
2747 :     my $figfam = new FigFam($fig,$fam);
2748 :     print join("\t",($fam,$figfam->family_function)),"\n";
2749 :     foreach $peg ($figfam->list_members)
2750 :     {
2751 :     print "\t$peg\n";
2752 :     }
2753 :     }
2754 :    
2755 :     ###############################################
2756 :    
2757 :     =head3 Placing a sequence into a FIGfam
2758 :    
2759 :     use FIGO;
2760 :     my $figO = new FIGO;
2761 :    
2762 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2763 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2764 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2765 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2766 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2767 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2768 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2769 :     RKLMMNHQ";
2770 :     $seq =~ s/\n//gs;
2771 :    
2772 :     my($fam,$sims) = $figO->family_containing($seq);
2773 :    
2774 :     if ($fam)
2775 :     {
2776 :     print join("\t",($fam->id,$fam->function)),"\n";
2777 :     print &Dumper($sims);
2778 :     }
2779 :     else
2780 :     {
2781 :     print "Could not place it in a family\n";
2782 :     }
2783 :    
2784 :     #---------------------------------------------
2785 :    
2786 :     use FIG;
2787 :     use FigFam;
2788 :     use FigFams;
2789 :    
2790 :     my $fig = new FIG;
2791 :     my $figfams = new FigFams($fig);
2792 :    
2793 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2794 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2795 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2796 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2797 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2798 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2799 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2800 :     RKLMMNHQ";
2801 :     $seq =~ s/\n//gs;
2802 :    
2803 :     my($fam,$sims) = $figfams->place_in_family($seq);
2804 :    
2805 :     if ($fam)
2806 :     {
2807 :     print join("\t",($fam->family_id,$fam->family_function)),"\n";
2808 :     print &Dumper($sims);
2809 :     }
2810 :     else
2811 :     {
2812 :     print "Could not place it in a family\n";
2813 :     }
2814 :    
2815 :     ###############################################
2816 :    
2817 :     =head3 Getting representative sequences for a FIGfam
2818 :    
2819 :     use FIGO;
2820 :     my $figO = new FIGO;
2821 :    
2822 :     $fam = "FIG102446";
2823 :     my $famO = &FigFamO::new('FigFamO',$figO,$fam);
2824 :     my @rep_seqs = $famO->rep_seqs;
2825 :    
2826 :     foreach $seq (@rep_seqs)
2827 :     {
2828 :     print ">query\n$seq\n";
2829 :     }
2830 :    
2831 :     #---------------------------------------------
2832 :    
2833 :     use FIG;
2834 :     use FigFam;
2835 :     use FigFams;
2836 :    
2837 :     my $fig = new FIG;
2838 :    
2839 :     $fam = "FIG102446";
2840 :     my $famO = new FigFam($fig,$fam);
2841 :     my @rep_seqs = $famO->representatives;
2842 :    
2843 :     foreach $seq (@rep_seqs)
2844 :     {
2845 :     print ">query\n$seq\n";
2846 :     }
2847 :    
2848 :    
2849 :     ###############################################
2850 :    
2851 :    
2852 :     =head3 Testing for membership in FIGfam
2853 :    
2854 :     use FIGO;
2855 :     my $figO = new FIGO;
2856 :    
2857 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2858 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2859 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2860 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2861 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2862 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2863 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2864 :     RKLMMNHQ";
2865 :     $seq =~ s/\n//gs;
2866 :    
2867 :     $fam = "FIG102446";
2868 :     my $famO = &FigFamO::new('FigFamO',$figO,$fam);
2869 :     my($should_be, $sims) = $famO->should_be_member($seq);
2870 :    
2871 :     if ($should_be)
2872 :     {
2873 :     print join("\t",($famO->id,$famO->function)),"\n";
2874 :     print &Dumper($sims);
2875 :     }
2876 :     else
2877 :     {
2878 :     print "Sequence should not be added to family\n";
2879 :     }
2880 :    
2881 :     #---------------------------------------------
2882 :    
2883 :     use FIG;
2884 :     use FigFam;
2885 :     use FigFams;
2886 :    
2887 :     my $fig = new FIG;
2888 :    
2889 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2890 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2891 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2892 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2893 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2894 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2895 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2896 :     RKLMMNHQ";
2897 :     $seq =~ s/\n//gs;
2898 :    
2899 :     $fam = "FIG102446";
2900 :     my $famO = new FigFam($fig,$fam);
2901 :     my($should_be, $sims) = $famO->should_be_member($seq);
2902 :    
2903 :     if ($should_be)
2904 :     {
2905 :     print join("\t",($famO->family_id,$famO->family_function)),"\n";
2906 :     print &Dumper($sims);
2907 :     }
2908 :     else
2909 :     {
2910 :     print "Sequence should not be added to family\n";
2911 :     }
2912 :    
2913 :     =cut
2914 :    

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3