[Bio] / FigKernelPackages / FIGO.pm Repository:
ViewVC logotype

Annotation of /FigKernelPackages/FIGO.pm

Parent Directory Parent Directory | Revision Log Revision Log


Revision 1.24 - (view) (download) (as text)

1 : overbeek 1.9 ########################################################################
2 : overbeek 1.1 #
3 :     # Copyright (c) 2003-2006 University of Chicago and Fellowship
4 :     # for Interpretations of Genomes. All Rights Reserved.
5 :     #
6 :     # This file is part of the SEED Toolkit.
7 :     #
8 :     # The SEED Toolkit is free software. You can redistribute
9 :     # it and/or modify it under the terms of the SEED Toolkit
10 :     # Public License.
11 :     #
12 :     # You should have received a copy of the SEED Toolkit Public License
13 :     # along with this program; if not write to the University of Chicago
14 :     # at info@ci.uchicago.edu or the Fellowship for Interpretation of
15 :     # Genomes at veronika@thefig.info or download a copy from
16 :     # http://www.theseed.org/LICENSE.TXT.
17 :     #
18 : overbeek 1.9 ########################################################################
19 :    
20 :     =head1 Overview
21 :    
22 :     This module is a set of packages encapsulating the SEED's core methods
23 :     using an "OOP-like" style.
24 :    
25 :     There are several modules clearly related to "individual genomes:"
26 :     FIGO, GenomeO, ContigO, FeatureO (and I<maybe> AnnotationO).
27 :    
28 :     There are also modules that deal with complex relationships between
29 :     pairs or sets of features in one, two, or more genomes,
30 :     rather than any particular single genome:
31 :     BBHO, CouplingO, SubsystemO, FunctionalRoleO, FigFamO.
32 :    
33 :     Finally, the methods in "Attribute" might in principle attach
34 :     "atributes" to any type of object.
35 :     (Likewise, in principle one might like to attach an "annotation"
36 :     to any type of object
37 :    
38 : gdpusch 1.24 The four modules dealing with "genomes" have a reasonable clear
39 : overbeek 1.9 "implied heirarchy:"
40 :    
41 :     =over 4
42 :    
43 :     FIGO > GenomeO > ContigO > FeatureO
44 :    
45 :     =back
46 : overbeek 1.1
47 : overbeek 1.9 However, inheritance is B<NOT> implemented using the C<@ISA> mechanism,
48 :     because some methods deal with "pairwise" or "setwise" relations between objects
49 :     or other more complex relationships that do not naturally fit into any heirarchy ---
50 :     which would get us into the whole quagmire of "multiple inheritance."
51 :    
52 : overbeek 1.13 We have chosen to in many cases sidestep the entire issue of inheritance
53 :     via an I<ad hoc> mechanism:
54 : overbeek 1.9 If a "child" object needs access to its "ancestors'" methods,
55 : gdpusch 1.24 we will explicitly pass it references to its "ancestors,"
56 :     as subroutine arguments.
57 : overbeek 1.9 This is admittedly ugly, clumsy, and potentially error-prone ---
58 :     but it has the advantage that, unlike multiple inheritance,
59 :     we understand how to do it...
60 :    
61 :     MODULE DEPENDENCIES: FIG, FIG_Config, FigFams, SFXlate, SproutFIG, Tracer,
62 :     gjoparseblast, Data::Dumper.
63 :    
64 :     =cut
65 :    
66 :     ########################################################################
67 : overbeek 1.1 package FIGO;
68 : overbeek 1.9 ########################################################################
69 : overbeek 1.1 use strict;
70 :     use FIG;
71 :     use FIG_Config;
72 :     use SFXlate;
73 :     use SproutFIG;
74 :     use Tracer;
75 :     use Data::Dumper;
76 : overbeek 1.23 use Carp;
77 : overbeek 1.1 use FigFams;
78 : overbeek 1.3 use gjoparseblast;
79 : overbeek 1.1
80 : overbeek 1.9 =head1 FIGO
81 :    
82 :     The effective "base class" containing a few "top-level" methods.
83 :    
84 :     =cut
85 :    
86 : overbeek 1.4
87 :     =head3 new
88 :    
89 :     Constructs a new FIGO object.
90 :    
91 : overbeek 1.9 =over 4
92 : overbeek 1.4
93 :     =item USAGE:
94 :    
95 :     C<< my $figo = FIGO->new(); #...Subclass defaults to FIG >>
96 :    
97 :     C<< my $figo = FIGO->new('SPROUT'); #...Subclass is a SPROUT object >>
98 :    
99 :     =back
100 :    
101 :     =cut
102 :    
103 : overbeek 1.1 sub new {
104 :     my($class,$low_level) = @_;
105 :    
106 :     my $fig;
107 :     if ($low_level && ($low_level =~ /sprout/i))
108 :     {
109 :     $fig = new SproutFIG($FIG_Config::sproutDB, $FIG_Config::sproutData);
110 :     }
111 :     else
112 :     {
113 :     $fig = new FIG;
114 :     }
115 :    
116 :     my $self = {};
117 :     $self->{_fig} = $fig;
118 : overbeek 1.3 $self->{_tmp_dir} = $FIG_Config::temp;
119 : overbeek 1.1 return bless $self, $class;
120 :     }
121 :    
122 : overbeek 1.21 sub function_of {
123 :     my($self,$id) = @_;
124 : overbeek 1.4
125 : overbeek 1.21 my $fig = $self->{_fig};
126 :     my $func = $fig->function_of($id);
127 :    
128 :     return ($func ? $func : "");
129 :     }
130 : overbeek 1.4
131 :     =head3 genomes
132 :    
133 :     Returns a list of Taxonomy-IDs, possibly constrained by selection criteria.
134 :     (Default: Empty constraint returns all Tax-IDs in the SEED or SPROUT.)
135 :    
136 : overbeek 1.9 =over 4
137 : overbeek 1.4
138 :     =item USAGE:
139 :    
140 :     C<< my @tax_ids = $figo->genomes(); >>
141 :    
142 :     C<< my @tax_ids = $figo->genomes( @constraints ); >>
143 :    
144 :     =item @constraints
145 : overbeek 1.9
146 :     One or more element of: complete, prokaryotic, eukaryotic, bacterial, archaeal, nmpdr.
147 : overbeek 1.4
148 :     =item RETURNS: List of Tax-IDs.
149 :    
150 : overbeek 1.9 =item EXAMPLE:
151 :    
152 : overbeek 1.13 L<Display all complete, prokaryotic genomes>
153 : overbeek 1.4
154 :     =back
155 :    
156 :     =cut
157 :    
158 : overbeek 1.1 sub genomes {
159 :     my($self,@constraints) = @_;
160 :     my $fig = $self->{_fig};
161 :    
162 :     my %constraints = map { $_ => 1 } @constraints;
163 :     my @genomes = ();
164 :    
165 :     if ($constraints{complete})
166 :     {
167 :     @genomes = $fig->genomes('complete');
168 :     }
169 :     else
170 :     {
171 :     @genomes = $fig->genomes;
172 :     }
173 :    
174 :     if ($constraints{prokaryotic})
175 :     {
176 :     @genomes = grep { $fig->is_prokaryotic($_) } @genomes;
177 :     }
178 :    
179 :     if ($constraints{eukaryotic})
180 :     {
181 :     @genomes = grep { $fig->is_eukaryotic($_) } @genomes;
182 :     }
183 :    
184 :     if ($constraints{bacterial})
185 :     {
186 :     @genomes = grep { $fig->is_bacterial($_) } @genomes;
187 :     }
188 :    
189 :     if ($constraints{archaeal})
190 :     {
191 :     @genomes = grep { $fig->is_archaeal($_) } @genomes;
192 :     }
193 :    
194 :     if ($constraints{nmpdr})
195 :     {
196 :     @genomes = grep { $fig->is_NMPDR_genome($_) } @genomes;
197 :     }
198 :    
199 :     return map { &GenomeO::new('GenomeO',$self,$_) } @genomes;
200 :     }
201 :    
202 : overbeek 1.4
203 :    
204 :     =head3 subsystems
205 :    
206 : overbeek 1.9 =over 4
207 : overbeek 1.4
208 :     =item RETURNS:
209 :    
210 : overbeek 1.9 List of all subsystems.
211 :    
212 :     =item EXAMPLE:
213 :    
214 : overbeek 1.13 L<Accessing Subsystem data>
215 : overbeek 1.4
216 :     =back
217 :    
218 :     =cut
219 :    
220 : overbeek 1.1 sub subsystems {
221 :     my($self) = @_;
222 :     my $fig = $self->{_fig};
223 :    
224 :     return map { &SubsystemO::new('SubsystemO',$self,$_) } $fig->all_subsystems;
225 :     }
226 :    
227 : overbeek 1.4
228 :     =head3 functional_roles
229 :    
230 :     (Not yet implemented)
231 :    
232 : overbeek 1.9 =over
233 : overbeek 1.4
234 :     =item RETURNS:
235 :    
236 :     =item EXAMPLE:
237 :    
238 :     =back
239 :    
240 :     =cut
241 :    
242 : overbeek 1.1 sub functional_roles {
243 :     my($self) = @_;
244 :     my $fig = $self->{_fig};
245 :    
246 :     my @functional_roles = ();
247 :    
248 :     return @functional_roles;
249 :     }
250 :    
251 : overbeek 1.4
252 :    
253 :     =head3 all_figfams
254 :    
255 :     Returns a list of all FIGfam objects.
256 :    
257 : overbeek 1.9 =over 4
258 :    
259 :     =item USAGE:
260 :    
261 : overbeek 1.13 C<< foreach $fam ($figO->all_figfams) { #...Do something } >>
262 : overbeek 1.9
263 :     =item RETURNS:
264 : overbeek 1.4
265 : overbeek 1.9 List of FIGfam Objects
266 : overbeek 1.4
267 : overbeek 1.9 =item EXAMPLE:
268 : overbeek 1.4
269 : overbeek 1.13 L<Accessing FIGfams>
270 : overbeek 1.4
271 :     =back
272 :    
273 :     =cut
274 :    
275 : overbeek 1.1 sub all_figfams {
276 :     my($self) = @_;
277 :     my $fig = $self->{_fig};
278 :     my $fams = new FigFams($fig);
279 :     return map { &FigFamO::new('FigFamO',$self,$_) } $fams->all_families;
280 :     }
281 :    
282 : overbeek 1.4
283 :    
284 :     =head3 family_containing
285 :    
286 : overbeek 1.9 =over 4
287 : overbeek 1.4
288 : overbeek 1.9 =item USAGE:
289 : overbeek 1.4
290 : overbeek 1.13 C<< my ($fam, $sims) = $figO->family_containing($seq); >>
291 : overbeek 1.4
292 : overbeek 1.9 =item $seq:
293 :    
294 :     A protein translation string.
295 :    
296 :     =item RETURNS:
297 :    
298 : overbeek 1.4 $fam: A FIGfam Object.
299 : overbeek 1.9
300 : overbeek 1.4 $sims: A set of similarity objects.
301 :    
302 :     =item EXAMPLE: L<Placing a sequence into a FIGfam>
303 :    
304 :     =back
305 :    
306 :     =cut
307 :    
308 : overbeek 1.1 sub family_containing {
309 :     my($self,$seq) = @_;
310 :    
311 :     my $fig = $self->{_fig};
312 :     my $fams = new FigFams($fig);
313 :     my($fam,$sims) = $fams->place_in_family($seq);
314 :     if ($fam)
315 :     {
316 :     return (&FigFamO::new('FigFamO',$self,$fam->family_id),$sims);
317 :     }
318 :     else
319 :     {
320 :     return undef;
321 :     }
322 :     }
323 :    
324 : overbeek 1.17 =head3 figfam
325 :    
326 :     =over 4
327 :    
328 :     =item USAGE:
329 :    
330 :     C<< my $fam = $figO->figfam($family_id); >>
331 :    
332 :     =item $family_id;
333 :    
334 :     A FigFam ID
335 :    
336 :     =item RETURNS:
337 :    
338 :     $fam: A FIGfam Object.
339 :    
340 :     =back
341 :    
342 :     =cut
343 :    
344 :     sub figfam {
345 :     my($self,$fam_id) = @_;
346 :    
347 :     return &FigFamO::new('FigFamO',$self,$fam_id);
348 :     }
349 :    
350 : overbeek 1.4
351 :     ########################################################################
352 : overbeek 1.1 package GenomeO;
353 : overbeek 1.4 ########################################################################
354 :     use Data::Dumper;
355 :    
356 :     =head1 GenomeO
357 :    
358 :     =cut
359 :    
360 : overbeek 1.13
361 : overbeek 1.4 =head3 new
362 :    
363 :     Constructor of GenomeO objects.
364 : overbeek 1.1
365 : overbeek 1.9 =over 4
366 : gdpusch 1.24
367 : overbeek 1.4 =item USAGE:
368 :    
369 : overbeek 1.13 C<< my $org = GenomeO->new($figo, $tax_id); >>
370 : overbeek 1.9
371 :     =item RETURNS:
372 :    
373 :     A new GenomeO object.
374 : overbeek 1.4
375 :     =back
376 :    
377 :     =cut
378 : overbeek 1.1
379 :     sub new {
380 :     my($class,$figO,$genomeId) = @_;
381 :    
382 :     my $self = {};
383 :     $self->{_figO} = $figO;
384 :     $self->{_id} = $genomeId;
385 :     return bless $self, $class;
386 :     }
387 :    
388 : overbeek 1.4
389 :    
390 :     =head3 id
391 :    
392 : overbeek 1.9 =over 4
393 :    
394 :     =item USAGE:
395 : overbeek 1.4
396 : overbeek 1.13 C<< my $tax_id = $org->id(); >>
397 : overbeek 1.9
398 :     =item RETURNS:
399 : overbeek 1.4
400 : overbeek 1.9 Taxonomy-ID of GenomeO object.
401 : overbeek 1.4
402 :     =back
403 :    
404 :     =cut
405 :    
406 : overbeek 1.1 sub id {
407 :     my($self) = @_;
408 :    
409 :     return $self->{_id};
410 :     }
411 :    
412 : overbeek 1.4
413 :    
414 :     =head3 genus_species
415 :    
416 : overbeek 1.9 =over 4
417 : overbeek 1.4
418 : overbeek 1.9 =item USAGE:
419 :    
420 : overbeek 1.13 C<< $gs = $genome->genus_species(); >>
421 : overbeek 1.9
422 :     =item RETURNS:
423 : overbeek 1.4
424 : overbeek 1.9 Genus-species-strain string
425 : overbeek 1.4
426 :     =back
427 :    
428 :     =cut
429 :    
430 : overbeek 1.1 sub genus_species {
431 :     my($self) = @_;
432 :    
433 :     my $fig = $self->{_figO}->{_fig};
434 :     return $fig->genus_species($self->{_id});
435 :     }
436 :    
437 : overbeek 1.4
438 :     =head3 contigs_of
439 :    
440 : overbeek 1.9 =over 4
441 :    
442 :     =item RETURNS:
443 :    
444 : gdpusch 1.24 List of C<contig> objects contained in a C<GenomeO> object.
445 : overbeek 1.4
446 : overbeek 1.9 =item EXAMPLE:
447 : overbeek 1.4
448 : overbeek 1.13 L<Show how to access contigs and extract sequence>
449 : overbeek 1.4
450 :     =back
451 :    
452 :     =cut
453 :    
454 : overbeek 1.1 sub contigs_of {
455 :     my($self) = @_;
456 :    
457 :     my $figO = $self->{_figO};
458 :     my $fig = $figO->{_fig};
459 :     return map { &ContigO::new('ContigO',$figO,$self->id,$_) } $fig->contigs_of($self->id);
460 :     }
461 :    
462 : overbeek 1.4
463 :    
464 :     =head3 features_of
465 :    
466 :     =cut
467 :    
468 : overbeek 1.1 sub features_of {
469 :     my($self,$type) = @_;
470 :    
471 :     my $figO = $self->{_figO};
472 :     my $fig = $figO->{_fig};
473 :    
474 :     return map { &FeatureO::new('FeatureO',$figO,$_) } $fig->all_features($self->id,$type);
475 :     }
476 :    
477 : overbeek 1.4
478 :     =head3 display
479 :    
480 :     Prints the genus, species, and strain information about a genome to STDOUT.
481 :    
482 : overbeek 1.9 =over 4
483 :    
484 :     =item USAGE:
485 :    
486 : overbeek 1.13 C<< $genome->display(); >>
487 : overbeek 1.4
488 : overbeek 1.9 =item RETURNS:
489 : overbeek 1.4
490 : overbeek 1.9 (Void)
491 : overbeek 1.4
492 :     =back
493 :    
494 :     =cut
495 :    
496 : overbeek 1.1 sub display {
497 :     my($self) = @_;
498 :    
499 :     print join("\t",("Genome",$self->id,$self->genus_species)),"\n";
500 :     }
501 :    
502 : overbeek 1.4
503 :    
504 :     ########################################################################
505 : overbeek 1.1 package ContigO;
506 : overbeek 1.4 ########################################################################
507 :     use Data::Dumper;
508 :    
509 :     =head1 ContigO
510 :    
511 :     Methods for working with DNA sequence objects.
512 :    
513 :     =cut
514 :    
515 :     =head3 new
516 :    
517 :     Contig constructor.
518 : overbeek 1.1
519 : overbeek 1.9 =over 4
520 : overbeek 1.4
521 :     =item USAGE:
522 :    
523 : overbeek 1.13 C<< $contig = ContigO->new( $figO, $genomeId, $contigId); >>
524 : overbeek 1.4
525 : overbeek 1.9 =item $figO:
526 : overbeek 1.4
527 : overbeek 1.9 Parent FIGO object.
528 : overbeek 1.4
529 : overbeek 1.9 =item $genomeId:
530 :    
531 :     Taxon-ID for the genome the contig is from.
532 :    
533 :     =item $contigId:
534 :    
535 :     Identifier for the contig
536 :    
537 :     =item RETURNS:
538 :    
539 :     A "ContigO" object.
540 : overbeek 1.4
541 :     =back
542 :    
543 :     =cut
544 : overbeek 1.1
545 :     sub new {
546 :     my($class,$figO,$genomeId,$contigId) = @_;
547 :    
548 :     my $self = {};
549 :     $self->{_figO} = $figO;
550 :     $self->{_id} = $contigId;
551 :     $self->{_genome} = $genomeId;
552 :     return bless $self, $class;
553 :     }
554 :    
555 : overbeek 1.4
556 :    
557 :     =head3 id
558 :    
559 : overbeek 1.9 =over 4
560 : overbeek 1.4
561 : overbeek 1.9 =item RETURNS:
562 :    
563 :     Sequence ID string of "ContigO" object
564 : overbeek 1.4
565 :     =back
566 :    
567 :     =cut
568 :    
569 : overbeek 1.1 sub id {
570 :     my($self) = @_;
571 :    
572 :     return $self->{_id};
573 :     }
574 :    
575 : overbeek 1.4
576 :     =head3 genome
577 :    
578 : overbeek 1.9 =over 4
579 : overbeek 1.4
580 : overbeek 1.9 =item USAGE:
581 : gdpusch 1.24
582 : overbeek 1.13 C<< my $tax_id = $contig->genome->id(); >>
583 : overbeek 1.4
584 : overbeek 1.9 =item RETURNS:
585 :    
586 :     Tax-ID of the GenomeO object containing the contig object.
587 : overbeek 1.4
588 :     =back
589 :    
590 :     =cut
591 :    
592 : overbeek 1.1 sub genome {
593 :     my($self) = @_;
594 :    
595 : overbeek 1.10 my $figO = $self->{_figO};
596 :     return new GenomeO($figO,$self->{_genome});
597 : overbeek 1.1 }
598 :    
599 : overbeek 1.4
600 :    
601 :     =head3 contig_length
602 :    
603 : overbeek 1.9 =over 4
604 : overbeek 1.4
605 :     =item USAGE:
606 : overbeek 1.9
607 : overbeek 1.13 C<< my $len = $contig->contig_length(); >>
608 : overbeek 1.4
609 : overbeek 1.9 =item RETURNS:
610 :    
611 :     Length of contig's DNA sequence.
612 : overbeek 1.4
613 :     =back
614 :    
615 :     =cut
616 :    
617 : overbeek 1.1 sub contig_length {
618 :     my($self) = @_;
619 :    
620 :     my $fig = $self->{_figO}->{_fig};
621 : overbeek 1.11 my $contig_lengths = $fig->contig_lengths($self->genome->id);
622 : overbeek 1.1 return $contig_lengths->{$self->id};
623 :     }
624 :    
625 : overbeek 1.4
626 :     =head3 dna_seq
627 :    
628 : overbeek 1.9 =over 4
629 : overbeek 1.4
630 :     =item USAGE:
631 : overbeek 1.9
632 : overbeek 1.13 C<< my $seq = $contig->dna_seq(beg, $end); >>
633 : overbeek 1.4
634 : overbeek 1.9 =item $beg:
635 :    
636 :     Begining point of DNA subsequence
637 : overbeek 1.4
638 : overbeek 1.9 =item $end:
639 : overbeek 1.4
640 : overbeek 1.9 End point of DNA subsequence
641 : overbeek 1.4
642 : overbeek 1.9 =item RETURNS:
643 :    
644 :     string of DNA sequence running from $beg to $end
645 :     (NOTE: if $beg > $end, returns reverse complement of DNA subsequence.)
646 : overbeek 1.4
647 :     =back
648 :    
649 :     =cut
650 :    
651 : overbeek 1.1 sub dna_seq {
652 :     my($self,$beg,$end) = @_;
653 :    
654 :     my $fig = $self->{_figO}->{_fig};
655 :     my $max = $self->contig_length;
656 :     if (($beg && (&FIG::between(1,$beg,$max))) &&
657 :     ($end && (&FIG::between(1,$end,$max))))
658 :     {
659 : overbeek 1.11 return $fig->dna_seq($self->genome->id,join("_",($self->id,$beg,$end)));
660 : overbeek 1.1 }
661 :     else
662 :     {
663 :     return undef;
664 :     }
665 :     }
666 :    
667 : overbeek 1.4
668 :     =head3 display
669 :    
670 :     Prints summary information about a "ContigO" object to STDOUT:
671 :    
672 :     Genus, species, strain
673 :    
674 :     Contig ID
675 :    
676 :     Contig length
677 :    
678 : overbeek 1.9 =over 4
679 :    
680 :     =item RETURNS:
681 : overbeek 1.4
682 : overbeek 1.9 (Void)
683 : overbeek 1.4
684 :     =back
685 :    
686 :     =cut
687 :    
688 : overbeek 1.1 sub display {
689 :     my($self) = @_;
690 :    
691 : overbeek 1.11 print join("ContigO",$self->genome->id,$self->id,$self->contig_length),"\n";
692 : overbeek 1.1 }
693 :    
694 : overbeek 1.10 sub features_in_region {
695 :     my($self,$beg,$end) = @_;
696 :     my $figO = $self->{_figO};
697 :     my $fig = $figO->{_fig};
698 : overbeek 1.4
699 : overbeek 1.10 my($features) = $fig->genes_in_region($self->genome->id,$self->id,$beg,$end);
700 :     return map { new FeatureO($figO,$_) } @$features;
701 :     }
702 : overbeek 1.4
703 : overbeek 1.13
704 :    
705 : overbeek 1.4 ########################################################################
706 : overbeek 1.1 package FeatureO;
707 : overbeek 1.4 ########################################################################
708 :     use Data::Dumper;
709 : overbeek 1.23 use Carp;
710 : overbeek 1.4
711 :     =head1 FeatureO
712 :    
713 : overbeek 1.9 Methods for working with features on "ContigO" objects.
714 :    
715 : overbeek 1.4 =cut
716 :    
717 : overbeek 1.13
718 : overbeek 1.9 =head3 new
719 : overbeek 1.4
720 : gdpusch 1.24 Constructor of new "FeatureO" objects
721 : overbeek 1.4
722 : overbeek 1.13 =over 4
723 :    
724 :     =item USAGE:
725 :    
726 :     C<< my $feature = FeatureO->new( $figO, $fid ); >>
727 :    
728 :     =item C<$figO>:
729 :    
730 :     "Base" FIGO object.
731 :    
732 :     =item C<$fid>:
733 :    
734 :     Feature-ID for new feature
735 :    
736 :     =item RETURNS:
737 :    
738 :     A newly created "FeatureO" object.
739 :    
740 :     =back
741 :    
742 : overbeek 1.4 =cut
743 : overbeek 1.1
744 :     sub new {
745 :     my($class,$figO,$fid) = @_;
746 :    
747 :     ($fid =~ /^fig\|\d+\.\d+\.[^\.]+\.\d+$/) || return undef;
748 :     my $self = {};
749 :     $self->{_figO} = $figO;
750 :     $self->{_id} = $fid;
751 :     return bless $self, $class;
752 :     }
753 :    
754 : overbeek 1.4
755 : overbeek 1.13
756 : overbeek 1.4 =head3 id
757 :    
758 : overbeek 1.13 =over 4
759 :    
760 :     =item USAGE:
761 :    
762 :     C<< my $fid = $feature->id(); >>
763 :    
764 :     =item RETURNS:
765 :    
766 :     The FID (Feature ID) of a "FeatureO" object.
767 :    
768 :     =back
769 :    
770 : overbeek 1.4 =cut
771 :    
772 : overbeek 1.1 sub id {
773 :     my($self) = @_;
774 :    
775 :     return $self->{_id};
776 :     }
777 :    
778 : overbeek 1.4
779 :    
780 :     =head3 genome
781 :    
782 : overbeek 1.13 =over 4
783 :    
784 :     =item USAGE:
785 :    
786 :     C<< my $taxid = $feature->genome(); >>
787 :    
788 :     =item RETURNS:
789 :    
790 : overbeek 1.22 The Taxon-ID for the "GenomeO" object containing the feature.
791 : overbeek 1.13
792 :     =back
793 :    
794 : overbeek 1.4 =cut
795 :    
796 : overbeek 1.1 sub genome {
797 :     my($self) = @_;
798 : overbeek 1.12 my $figO = $self->{_figO};
799 : overbeek 1.1 $self->id =~ /^fig\|(\d+\.\d+)/;
800 : overbeek 1.12 return new GenomeO($figO,$1);
801 : overbeek 1.1 }
802 :    
803 : overbeek 1.4
804 :    
805 :     =head3 type
806 :    
807 : overbeek 1.13 =over 4
808 :    
809 :     =item USAGE:
810 :    
811 :     C<< my $feature_type = $feature->type(); >>
812 :    
813 :     =item RETURNS:
814 :    
815 :     The feature object's "type" (e.g., "peg," "rna," etc.)
816 :    
817 :     =back
818 :    
819 : overbeek 1.4 =cut
820 :    
821 : overbeek 1.1 sub type {
822 :     my($self) = @_;
823 :    
824 :     $self->id =~ /^fig\|\d+\.\d+\.([^\.]+)/;
825 :     return $1;
826 :     }
827 :    
828 : overbeek 1.4
829 :    
830 : overbeek 1.13 =head3 location
831 :    
832 :     =over 4
833 : overbeek 1.4
834 : overbeek 1.13 =item USAGE:
835 :    
836 :     C<< my $loc = $feature->location(); >>
837 :    
838 :     =item RETURNS:
839 :    
840 :     A string representing the feature object's location on the genome's DNA,
841 :     in SEED "tbl format" (i.e., "contig_beging_end").
842 :    
843 :     =back
844 : overbeek 1.4
845 :     =cut
846 :    
847 : overbeek 1.1 sub location {
848 :     my($self) = @_;
849 :    
850 :     my $fig = $self->{_figO}->{_fig};
851 :     return scalar $fig->feature_location($self->id);
852 :     }
853 :    
854 : overbeek 1.13
855 :     =head3 contig
856 :    
857 :     =over 4
858 :    
859 :     =item USAGE:
860 :    
861 :     C<< my $contig = $feature->contig(); >>
862 :    
863 :     =item RETURNS:
864 :    
865 :     A "ContigO" object to access the contig data
866 :     for the contig the feature is on.
867 :    
868 :     =back
869 :    
870 :     =cut
871 :    
872 : overbeek 1.12 sub contig {
873 :     my($self) = @_;
874 :    
875 :     my $figO = $self->{_figO};
876 :     my $loc = $self->location;
877 :     my $genomeID = $self->genome->id;
878 :     return ($loc =~ /^(\S+)_\d+_\d+$/) ? new ContigO($figO,$genomeID,$1) : undef;
879 :     }
880 :    
881 : overbeek 1.13
882 :    
883 :     =head3 begin
884 :    
885 :     =over 4
886 :    
887 :     =item USAGE:
888 :    
889 :     C<< my $beg = $feature->begin(); >>
890 :    
891 :     =item RETURNS:
892 :    
893 :     The numerical coordinate of the first base of the feature.
894 :    
895 :     =back
896 :    
897 :     =cut
898 :    
899 : overbeek 1.12 sub begin {
900 :     my($self) = @_;
901 :    
902 :     my $loc = $self->location;
903 :     return ($loc =~ /^\S+_(\d+)_\d+$/) ? $1 : undef;
904 :     }
905 : overbeek 1.4
906 : overbeek 1.13
907 :    
908 :     =head3 end
909 :    
910 :     =over 4
911 :    
912 :     =item USAGE:
913 :    
914 :     C<< my $end = $feature->end(); >>
915 :    
916 :     =item RETURNS:
917 :    
918 :     The numerical coordinate of the last base of the feature.
919 :    
920 :     =back
921 :    
922 :     =cut
923 :    
924 : overbeek 1.12 sub end {
925 :     my($self) = @_;
926 :    
927 :     my $loc = $self->location;
928 :     return ($loc =~ /^\S+_\d+_(\d+)$/) ? $1 : undef;
929 :     }
930 : overbeek 1.4
931 : overbeek 1.13
932 :    
933 : overbeek 1.4 =head3 dna_seq
934 :    
935 : overbeek 1.13 =over 4
936 :    
937 :     =item USAGE:
938 :    
939 :     C<< my $dna_seq = $feature->dna_seq(); >>
940 :    
941 :     =item RETURNS:
942 :    
943 :     A string contining the DNA subsequence of the contig
944 :     running from the first to the last base of the feature.
945 :    
946 :     If ($beg > $end), the reverse complement subsequence is returned.
947 :    
948 :     =back
949 :    
950 : overbeek 1.4 =cut
951 :    
952 : overbeek 1.1 sub dna_seq {
953 :     my($self) = @_;
954 :    
955 :     my $fig = $self->{_figO}->{_fig};
956 :     my $fid = $self->id;
957 :     my @loc = $fig->feature_location($fid);
958 :     return $fig->dna_seq(&FIG::genome_of($fid),@loc);
959 :     }
960 :    
961 : overbeek 1.4
962 :    
963 :     =head3 prot_seq
964 :    
965 : overbeek 1.13 =over 4
966 :    
967 :     =item USAGE:
968 :    
969 :     C<< my $dna_seq = $feature->prot_seq(); >>
970 :    
971 :     =item RETURNS:
972 :    
973 :     A string contining the protein translation of the feature (if it exists),
974 :     or the "undef" value if the feature does not exist or is not a PEG.
975 :    
976 :     =back
977 :    
978 : overbeek 1.4 =cut
979 :    
980 : overbeek 1.1 sub prot_seq {
981 :     my($self) = @_;
982 :    
983 :     ($self->type eq "peg") || return undef;
984 :     my $fig = $self->{_figO}->{_fig};
985 :     my $fid = $self->id;
986 :     return $fig->get_translation($fid);
987 :     }
988 :    
989 : overbeek 1.4
990 :    
991 :     =head3 function_of
992 :    
993 : overbeek 1.13 =over 4
994 :    
995 :     =item USAGE:
996 :    
997 :     C<< my $func = $feature->function_of(); >>
998 :    
999 :     =item RETURNS:
1000 :    
1001 :     A string containing the function assigned to the feature,
1002 :     or the "undef" value if no function has been assigned.
1003 :    
1004 :     =back
1005 :    
1006 : overbeek 1.4 =cut
1007 :    
1008 : overbeek 1.1 sub function_of {
1009 :     my($self) = @_;
1010 :    
1011 :     my $fig = $self->{_figO}->{_fig};
1012 :     my $fid = $self->id;
1013 :     return scalar $fig->function_of($fid);
1014 :     }
1015 :    
1016 : overbeek 1.4
1017 :    
1018 :     =head3 coupled_to
1019 :    
1020 : overbeek 1.13 =over 4
1021 :    
1022 :     =item USAGE:
1023 :    
1024 :     C<< my @coupled_features = $feature->coupled_to(); >>
1025 :    
1026 :     =item RETURNS:
1027 :    
1028 : gdpusch 1.24 A list of "CouplingO" objects describing the evidence for functional coupling
1029 : overbeek 1.13 between this feature and other nearby features.
1030 :    
1031 :     =back
1032 :    
1033 : overbeek 1.4 =cut
1034 :    
1035 : overbeek 1.1 sub coupled_to {
1036 :     my($self) = @_;
1037 :    
1038 : overbeek 1.13 ($self->type eq "peg") || return ();
1039 : overbeek 1.1 my $figO = $self->{_figO};
1040 :     my $fig = $figO->{_fig};
1041 :     my $peg1 = $self->id;
1042 :     my @coupled = ();
1043 :     foreach my $tuple ($fig->coupled_to($peg1))
1044 :     {
1045 :     my($peg2,$sc) = @$tuple;
1046 :     push(@coupled, &CouplingO::new('CouplingO',$figO,$peg1,$peg2,$sc));
1047 :     }
1048 :     return @coupled;
1049 :     }
1050 :    
1051 : overbeek 1.4
1052 :    
1053 :     =head3 annotations
1054 :    
1055 : overbeek 1.13 =over 4
1056 :    
1057 :     =item USAGE:
1058 :    
1059 :     C<< my @annot_list = $feature->annotations(); >>
1060 :    
1061 :     =item RETURNS:
1062 :    
1063 : gdpusch 1.24 A list of "AnnotationO" objects allowing access to the annotations for this feature.
1064 : overbeek 1.13
1065 :     =back
1066 :    
1067 : overbeek 1.4 =cut
1068 :    
1069 : overbeek 1.1 sub annotations {
1070 :     my($self) = @_;
1071 :    
1072 :     my $figO = $self->{_figO};
1073 :     my $fig = $figO->{_fig};
1074 :    
1075 :     return map { &AnnotationO::new('AnnotationO',@$_) } $fig->feature_annotations($self->id,1);
1076 :     }
1077 :    
1078 : overbeek 1.13
1079 :     =head3 in_subsystems
1080 :    
1081 :     =over 4
1082 :    
1083 :     =item USAGE:
1084 :    
1085 :     C<< my @subsys_list = $feature->in_subsystems(); >>
1086 :    
1087 :     =item RETURNS:
1088 :    
1089 : gdpusch 1.24 A list of "SubsystemO" objects allowing access to the subsystems
1090 : overbeek 1.13 that this feature particupates in.
1091 :    
1092 :     =back
1093 :    
1094 :     =cut
1095 :    
1096 : overbeek 1.5 sub in_subsystems {
1097 :     my($self) = @_;
1098 :     my $figO = $self->{_figO};
1099 :     my $fig = $figO->{_fig};
1100 :    
1101 :     return map { new SubsystemO($figO,$_) } $fig->peg_to_subsystems($self->id);
1102 :     }
1103 : overbeek 1.4
1104 :    
1105 :     =head3 possibly_truncated
1106 :    
1107 : overbeek 1.13 =over 4
1108 :    
1109 :     =item USAGE:
1110 :    
1111 :     C<< my $trunc = $feature->possibly_truncated(); >>
1112 :    
1113 :     =item RETURNS:
1114 :    
1115 :     Boolean C<TRUE> if the feature may be truncated;
1116 :     boolean C<FALSE> otherwise.
1117 :    
1118 :     =back
1119 :    
1120 : overbeek 1.4 =cut
1121 :    
1122 : overbeek 1.3 sub possibly_truncated {
1123 :     my($self) = @_;
1124 :     my $figO = $self->{_figO};
1125 :     my $fig = $figO->{_fig};
1126 :    
1127 :     return $fig->possibly_truncated($self->id);
1128 :     }
1129 :    
1130 : overbeek 1.4
1131 :    
1132 :     =head3 possible_frameshift
1133 :    
1134 : overbeek 1.13 =over 4
1135 :    
1136 :     =item USAGE:
1137 :    
1138 :     C<< my $fs = $feature->possible_frameshift(); >>
1139 :    
1140 :     =item RETURNS:
1141 :    
1142 :     Boolean C<TRUE> if the feature may be a frameshifted fragment;
1143 :     boolean C<FALSE> otherwise.
1144 :    
1145 :     (NOTE: This is a crude prototype implementation,
1146 :     and is mostly as an example of how to code using FIGO.)
1147 :    
1148 :     =back
1149 :    
1150 : overbeek 1.4 =cut
1151 :    
1152 : overbeek 1.3 sub possible_frameshift {
1153 :     my($self) = @_;
1154 :     my $figO = $self->{_figO};
1155 :     my($tmp_dir) = $figO->{_tmp_dir};
1156 : overbeek 1.22
1157 :     #...Skip tests and return '0' if truncated...
1158 : overbeek 1.3 if (! $self->possibly_truncated)
1159 :     {
1160 : overbeek 1.22 #...Get best precomputed BLAST hit if E-value < 1.0e-50:
1161 : overbeek 1.3 my @sims = $self->sims( -max => 1, -cutoff => 1.0e-50);
1162 : overbeek 1.22
1163 :     #...If a sim was returned:
1164 : overbeek 1.3 if (my $sim = shift @sims)
1165 :     {
1166 : overbeek 1.22 #...Get best hit FID and boundaries:
1167 : overbeek 1.3 my $peg2 = $sim->id2;
1168 :     my $ln1 = $sim->ln1;
1169 :     my $ln2 = $sim->ln2;
1170 :     my $b2 = $sim->b2;
1171 :     my $e2 = $sim->e2;
1172 : overbeek 1.22
1173 :     #...Convert from AA to BP, and pad out w/ 100 bp guard region:
1174 : overbeek 1.3 my $adjL = 100 + (($b2-1) * 3);
1175 :     my $adjR = 100 + (($ln2 - $e2) * 3);
1176 : overbeek 1.22
1177 :     #...If hit is more than 20% longer than query:
1178 : overbeek 1.3 if ($ln2 > (1.2 * $ln1))
1179 :     {
1180 : overbeek 1.22 #...Get and parse query location:
1181 : overbeek 1.3 my $loc = $self->location;
1182 :     if ($loc =~ /^(\S+)_(\d+)_(\d+)/)
1183 :     {
1184 :     my $contig = $1;
1185 :     my $beg = $2;
1186 : overbeek 1.22 my $end = $3;
1187 :    
1188 :     #...Create new ContigO object:
1189 :     my $contigO = new ContigO($figO, $self->genome->id, $contig);
1190 :    
1191 :     #...Extract DNA subsequence, including guard regions:
1192 :     my $begA = &max(1, $beg - $adjL);
1193 :     my $endA = &min($end+$adjR, $contigO->contig_length);
1194 : overbeek 1.3 my $dna = $contigO->dna_seq($begA,$endA);
1195 : overbeek 1.23 if (defined($dna) && (length($dna) > 90))
1196 :     {
1197 :     #...Open tmp-file and write FASTA containing DNA subregion to be BLASTed:
1198 :     open( TMP, ">$tmp_dir/tmp_dna") || die "could not open tmp_dna";
1199 :     print TMP ">dna\n$dna\n";
1200 :     close(TMP);
1201 : overbeek 1.22
1202 : overbeek 1.23 #...Create new FeatureO object corresponding tp $peg2:
1203 :     my $pegO2 = new FeatureO($figO,$peg2);
1204 : overbeek 1.22
1205 : overbeek 1.23 #...Fetch its translation, and print to tmp FASTA file for BLASTing:
1206 :     my $prot = $pegO2->prot_seq;
1207 :     if (defined($prot) && (length($prot) > 30))
1208 :     {
1209 :     open( TMP, ">$tmp_dir/tmp_prot") || die "could not open tmp_prot";
1210 :     print TMP ">tmp_prot\n$prot\n";
1211 :     close(TMP);
1212 : overbeek 1.22
1213 : overbeek 1.23 #...Build BLAST nucleotide database for extracted DNA region,
1214 :     # and TBLASTN $peg2 against the DNA:
1215 :     &run("formatdb -i $tmp_dir/tmp_dna -pF");
1216 :     open(BLAST,"blastall -i $tmp_dir/tmp_prot -d $tmp_dir/tmp_dna -p tblastn -FF -e 1.0e-50 |")
1217 :     || die "could not blast";
1218 :    
1219 :     #...Parse the TBLASTN output; find and sort HSPs by left boundary:
1220 :     my $db_seq_out = &gjoparseblast::next_blast_subject(\*BLAST,1);
1221 :     my @hsps = sort { $a->[0] <=> $b->[0] }
1222 :     map { [$_->[9], $_->[10], $_->[12], $_->[13]] }
1223 :     grep { $_->[1] < 1.0e-50 }
1224 :     @ { $db_seq_out->[6] };
1225 : overbeek 1.22
1226 : overbeek 1.23 #...Extract HSP boundary pairs:
1227 :     my @prot = map { [$_->[0], $_->[1]] } @hsps;
1228 :     my @dna = map { [$_->[2], $_->[3]] } @hsps;
1229 :    
1230 :     #...If the "cover" of the HSPs covers more than 90% of $peg2 w gaps < 3 AA,
1231 :     # and the "cover" of the HPSs cover more than 90% of the extracted DNA
1232 :     # w/ gaps < 9 bp (but not a multiple of 3), suspect a possible frameshift:
1233 :     if (&covers(\@prot,length($prot),3,0) && &covers(\@dna,3*length($prot),9,1))
1234 :     {
1235 :     return 1;
1236 :     }
1237 :     }
1238 : overbeek 1.3 }
1239 :     }
1240 :     }
1241 :     }
1242 :     }
1243 :     return 0;
1244 :     }
1245 :    
1246 : overbeek 1.4
1247 :    
1248 :     =head3 run
1249 :    
1250 : overbeek 1.13 (Note: This function should be considered "PRIVATE")
1251 :    
1252 :     =over 4
1253 :    
1254 :     =item FUNCTION:
1255 :    
1256 :     Passes a string containing a command to be execture by the "system" shell command.
1257 :    
1258 :     =item USAGE:
1259 :    
1260 :     C<< $feature->run($cmd); >>
1261 :    
1262 :     =item RETURNS:
1263 :    
1264 :     Nil if the execution of C<$cmd> was successful;
1265 :     aborts with traceback if C<$cmd> fails.
1266 : overbeek 1.4
1267 : overbeek 1.13 =back
1268 :    
1269 :     =cut
1270 :    
1271 :     sub run {
1272 : overbeek 1.3 my($cmd) = @_;
1273 : overbeek 1.23 (system($cmd) == 0) || confess("FAILED: $cmd");
1274 : overbeek 1.3 }
1275 :    
1276 : overbeek 1.4
1277 :    
1278 :     =head3 max
1279 :    
1280 : overbeek 1.13 (Note: This function should be considered "PRIVATE")
1281 :    
1282 :     =over 4
1283 :    
1284 :     =item USAGE:
1285 :    
1286 :     C<< my $max = $feature->max($x, $y); >>
1287 :    
1288 : gdpusch 1.24 =item C<$x> and C<$y>
1289 : overbeek 1.13
1290 : gdpusch 1.24 Numerical values.
1291 : overbeek 1.13
1292 : gdpusch 1.24 =item RETURNS:
1293 : overbeek 1.13
1294 :     The larger of the two numerical values C<$x> and C<$y>.
1295 :    
1296 :     =back
1297 :    
1298 : overbeek 1.4 =cut
1299 :    
1300 : overbeek 1.3 sub max {
1301 :     my($x,$y) = @_;
1302 :     return ($x < $y) ? $y : $x;
1303 :     }
1304 :    
1305 : overbeek 1.4
1306 :    
1307 :     =head3 min
1308 :    
1309 : overbeek 1.13 (Note: This function should be considered "PRIVATE")
1310 :    
1311 :     =over 4
1312 :    
1313 :     =item USAGE:
1314 :    
1315 :     C<< my $min = $feature->min($x, $y); >>
1316 :    
1317 : gdpusch 1.24 =item C<$x> and C<$y>
1318 : overbeek 1.13
1319 : gdpusch 1.24 Numerical values.
1320 : overbeek 1.13
1321 : overbeek 1.16 =item RETURNS:
1322 : overbeek 1.13
1323 :     The smaller of the two numerical values C<$x> and C<$y>.
1324 :    
1325 :     =back
1326 :    
1327 : overbeek 1.4 =cut
1328 :    
1329 : overbeek 1.3 sub min {
1330 :     my($x,$y) = @_;
1331 :     return ($x < $y) ? $x : $y;
1332 :     }
1333 :    
1334 : overbeek 1.4
1335 :    
1336 :     =head3 covers
1337 :    
1338 : overbeek 1.16 (Question: Should this function be considered "PRIVATE" ???)
1339 :    
1340 :     USAGE:
1341 :     C<< if (&covers(\@hits, $len, $diff, $must_shift)) { #...Do stuff } >>
1342 :    
1343 :     Returns boolean C<TRUE> if a set of BLAST HSPs "cover" more than 90%
1344 :     of the database sequence(?).
1345 :    
1346 : overbeek 1.4 =cut
1347 :    
1348 : overbeek 1.3 sub covers {
1349 : overbeek 1.14 my($hsps,$ln,$diff,$must_shift) = @_;
1350 : overbeek 1.3
1351 :     my $hsp1 = shift @$hsps;
1352 :     my $hsp2;
1353 : overbeek 1.15 my $merged = 0;
1354 : overbeek 1.14 while ($hsp1 && ($hsp2 = shift @$hsps) &&
1355 :     ($must_shift ? &diff_frames($hsp1,$hsp2) : 1) &&
1356 : overbeek 1.15 ($hsp1 = &merge($hsp1,$hsp2,$diff))) { $merged = 1 }
1357 :     return ($merged && $hsp1 && (($hsp1->[1] - $hsp1->[0]) > (0.9 * $ln)));
1358 : overbeek 1.3 }
1359 :    
1360 : overbeek 1.14 sub diff_frames {
1361 :     my($hsp1,$hsp2) = @_;
1362 :     return (($hsp1->[0] % 3) != ($hsp2->[0] % 3));
1363 :     }
1364 : overbeek 1.4
1365 : overbeek 1.16
1366 :    
1367 : overbeek 1.4 =head3 merge
1368 :    
1369 : overbeek 1.16 Merge two HSPs unless their overlap or separation is too large.
1370 :    
1371 :     RETURNS: Merged boundaries if merger succeeds, and C<undef> if merger fails.
1372 :    
1373 : overbeek 1.4 =cut
1374 :    
1375 : overbeek 1.3 sub merge {
1376 :     my($hsp1,$hsp2,$diff) = @_;
1377 :    
1378 :     my($b1,$e1) = @$hsp1;
1379 :     my($b2,$e2) = @$hsp2;
1380 :     return (($e2 > $e1) && (abs($b2-$e1) <= $diff)) ? [$b1,$e2] : undef;
1381 :     }
1382 :    
1383 : overbeek 1.4
1384 :    
1385 :     =head3 sims
1386 :    
1387 : overbeek 1.16 =over 4
1388 :    
1389 :     =item FUNCTION:
1390 :    
1391 :     Returns precomputed "Sim.pm" objects from the SEED.
1392 :    
1393 :     =item USAGE:
1394 : gdpusch 1.24
1395 : overbeek 1.16 C<< my @sims = $pegO->sims( -all, -cutoff => 1.0e-10); >>
1396 :    
1397 :     C<< my @sims = $pegO->sims( -max => 50, -cutoff => 1.0e-10); >>
1398 :    
1399 :     =item RETURNS: List of sim objects.
1400 :    
1401 :     =back
1402 :    
1403 : overbeek 1.4 =cut
1404 :    
1405 : overbeek 1.2 use Sim;
1406 :     sub sims {
1407 :     my($self,%args) = @_;
1408 :    
1409 :     my $figO = $self->{_figO};
1410 :     my $fig = $figO->{_fig};
1411 :    
1412 :     my $cutoff = $args{-cutoff} ? $args{-cutoff} : 1.0e-5;
1413 : overbeek 1.21 my $all = $args{-all} ? 'all' : "fig";
1414 : overbeek 1.2 my $max = $args{-max} ? $args{-max} : 10000;
1415 : overbeek 1.20
1416 :     my @sims = $fig->sims($self->id,$max,$cutoff,$all);
1417 :    
1418 :     if (@sims) {
1419 :     my $peg1 = FeatureO->new($figO, $sims[0]->[0]);
1420 :    
1421 :     foreach my $sim (@sims) {
1422 : overbeek 1.21 # $sim->[0] = $peg1;
1423 :     # $sim->[1] = FeatureO->new($figO, $sim->[1]);
1424 : overbeek 1.20 }
1425 :     }
1426 :    
1427 :     return @sims;
1428 : overbeek 1.2 }
1429 :    
1430 : overbeek 1.4
1431 :    
1432 :     =head3 bbhs
1433 :    
1434 : overbeek 1.16 =over 4
1435 :    
1436 : gdpusch 1.24 =item FUNCTION:
1437 : overbeek 1.16
1438 :     Given a PEG-type "FeatureO" object, returns the list of BBHO objects
1439 :     corresponding to the pre-computed BBHs for that PEG.
1440 :    
1441 :     =item USAGE:
1442 :    
1443 :     C<< my @bbhs = $pegO->bbhs(); >>
1444 :    
1445 : gdpusch 1.24 =item RETURNS:
1446 :    
1447 :     List of BBHO objects.
1448 : overbeek 1.16
1449 :     =back
1450 :    
1451 : overbeek 1.4 =cut
1452 :    
1453 : overbeek 1.2 sub bbhs {
1454 :     my($self) = @_;
1455 :    
1456 :     my $figO = $self->{_figO};
1457 :     my $fig = $figO->{_fig};
1458 :    
1459 :     my @bbhs = $fig->bbhs($self->id);
1460 : overbeek 1.6 return map { my($peg2,$sc,$bs) = @$_; bless({ _figO => $figO,
1461 :     _peg1 => $self->id,
1462 : overbeek 1.2 _peg2 => $peg2,
1463 :     _psc => $sc,
1464 :     _bit_score => $bs
1465 :     },'BBHO') } @bbhs;
1466 :     }
1467 :    
1468 : gdpusch 1.24
1469 : overbeek 1.4 =head3 display
1470 :    
1471 : gdpusch 1.24 =over 4
1472 :    
1473 :     =item FUNCTION:
1474 :    
1475 : overbeek 1.16 Prints info about a "FeatureO" object to STDOUT.
1476 :    
1477 : gdpusch 1.24 =item USAGE:
1478 : overbeek 1.16
1479 :     C<< $pegO->display(); >>
1480 :    
1481 : gdpusch 1.24 =item RETURNS;
1482 :    
1483 :     (void)
1484 :    
1485 :     =back
1486 :    
1487 : overbeek 1.4 =cut
1488 :    
1489 : overbeek 1.1 sub display {
1490 :     my($self) = @_;
1491 :    
1492 :     print join("\t",$self->id,$self->location,$self->function_of),"\n",
1493 :     $self->dna_seq,"\n",
1494 :     $self->prot_seq,"\n";
1495 :     }
1496 :    
1497 : overbeek 1.4
1498 :    
1499 :     ########################################################################
1500 : overbeek 1.2 package BBHO;
1501 : overbeek 1.4 ########################################################################
1502 :    
1503 :     =head1 BBHO
1504 :    
1505 : overbeek 1.16 Methods for accessing "Bidirectiona Best Hits" (BBHs).
1506 :    
1507 : overbeek 1.4 =cut
1508 :    
1509 :    
1510 :     =head3 new
1511 :    
1512 : overbeek 1.16 Constructor of BBHO objects.
1513 :    
1514 :     (NOTE: The "average user" should never need to invoke this method.)
1515 :    
1516 : overbeek 1.4 =cut
1517 : overbeek 1.2
1518 :     sub new {
1519 : overbeek 1.6 my($class,$figO,$peg1,$peg2,$sc,$normalized_bitscore) = @_;
1520 : overbeek 1.2
1521 :     my $self = {};
1522 : overbeek 1.6 $self->{_figO} = $figO;
1523 : overbeek 1.2 $self->{_peg1} = $peg1;
1524 :     $self->{_peg2} = $peg2;
1525 :     $self->{_psc} = $sc;
1526 :     $self->{_bit_score} = $normalized_bitscore
1527 :    
1528 : overbeek 1.16 }
1529 :    
1530 : overbeek 1.2
1531 : overbeek 1.4
1532 :     =head3 peg1
1533 :    
1534 : overbeek 1.16 =over 4
1535 :    
1536 :     =item USAGE:
1537 :    
1538 :     C<< my $peg1 = $bbh->peg1(); >>
1539 :    
1540 :     =item RETURNS:
1541 :    
1542 :     A "FeatureO" object corresponding to the "query" sequence
1543 :     in a BBH pair.
1544 :    
1545 :     =back
1546 :    
1547 : overbeek 1.4 =cut
1548 :    
1549 : overbeek 1.2 sub peg1 {
1550 :     my($self) = @_;
1551 :    
1552 : overbeek 1.6 my $figO = $self->{_figO};
1553 :     return new FeatureO($figO,$self->{_peg1});
1554 : overbeek 1.2 }
1555 :    
1556 : overbeek 1.6 =head3 peg2
1557 : overbeek 1.4
1558 : overbeek 1.16 =over 4
1559 :    
1560 :     =item USAGE:
1561 :    
1562 :     C<< my $peg2 = $bbh->peg2(); >>
1563 :    
1564 :     =item RETURNS:
1565 :    
1566 :     A "FeatureO" object corresponding to the "database" sequence
1567 :     in a BBH pair.
1568 :    
1569 :     =back
1570 :    
1571 : overbeek 1.4 =cut
1572 :    
1573 : overbeek 1.2 sub peg2 {
1574 :     my($self) = @_;
1575 :    
1576 : overbeek 1.6 my $figO = $self->{_figO};
1577 :     return new FeatureO($figO,$self->{_peg2});
1578 : overbeek 1.2 }
1579 :    
1580 : overbeek 1.4
1581 :    
1582 :     =head3 psc
1583 :    
1584 : overbeek 1.16 =over 4
1585 :    
1586 :     =item USAGE:
1587 :    
1588 :     C<< my $psc = $bbh->psc(); >>
1589 :    
1590 :     =item RETURNS:
1591 :    
1592 :     The numerical value of the BLAST E-value for the pair.
1593 :    
1594 :     =back
1595 :    
1596 : overbeek 1.4 =cut
1597 :    
1598 : overbeek 1.2 sub psc {
1599 :     my($self) = @_;
1600 :    
1601 :     return $self->{_psc};
1602 :     }
1603 :    
1604 : overbeek 1.4
1605 :    
1606 :     =head3 norm_bitscore
1607 :    
1608 : overbeek 1.16
1609 :     =over 4
1610 :    
1611 :     =item USAGE:
1612 :    
1613 :     C<< my $bsc = $bbh->norm_bitscore(); >>
1614 :    
1615 :     =item RETURNS:
1616 :    
1617 :     The "BLAST bit-score per aligned character" for the pair.
1618 :    
1619 :     =back
1620 :    
1621 : overbeek 1.4 =cut
1622 :    
1623 : overbeek 1.2 sub norm_bitscore {
1624 :     my($self) = @_;
1625 :    
1626 :     return $self->{_bit_score};
1627 :     }
1628 :    
1629 : overbeek 1.4
1630 :    
1631 :     ########################################################################
1632 : overbeek 1.1 package AnnotationO;
1633 : overbeek 1.4 ########################################################################
1634 :    
1635 :     =head1 AnnotationO
1636 :    
1637 : overbeek 1.16 Methods for accessing SEED annotations.
1638 :    
1639 : overbeek 1.4 =cut
1640 :    
1641 :    
1642 :    
1643 :     =head3 new
1644 :    
1645 : gdpusch 1.24 =over 4
1646 :    
1647 :     =item FUNCTION:
1648 :    
1649 :     Cronstruct a new "AnnotationO" object
1650 :    
1651 :     =item USAGE:
1652 :    
1653 :     C<< my $annotO = AnnotationO->new( $fid, $timestamp, $who, $text); >>
1654 :    
1655 :     =item C<$fid>
1656 :    
1657 :     A feature identifier.
1658 :    
1659 :     =item C<$timestamp>
1660 :    
1661 :     The C<UN*X> timestamp one wishes to associate with the annotation.
1662 :    
1663 :     =item C<$who>
1664 :    
1665 :     The annotator's user-name.
1666 :    
1667 :     =item C<$text>
1668 :    
1669 :     The textual content of the annotation.
1670 :    
1671 :     =item RETURNS:
1672 :    
1673 :     An "AnnotationO" object.
1674 :    
1675 :     =back
1676 :    
1677 : overbeek 1.4 =cut
1678 : overbeek 1.1
1679 :     sub new {
1680 :     my($class,$fid,$timestamp,$who,$text) = @_;
1681 :    
1682 :     my $self = {};
1683 :     $self->{_fid} = $fid;
1684 :     $self->{_timestamp} = $timestamp;
1685 :     $self->{_who} = $who;
1686 :     $self->{_text} = $text;
1687 :     return bless $self, $class;
1688 :     }
1689 :    
1690 : overbeek 1.4
1691 :    
1692 :     =head3 fid
1693 :    
1694 : gdpusch 1.24 =over 4
1695 :    
1696 :     =item FUNCTION:
1697 :    
1698 :     Extract the feature-ID that was annotated.
1699 :    
1700 :     =item USAGE:
1701 :    
1702 :     C<< my $fid = $annotO->fid(); >>
1703 :    
1704 :     =item RETURNS;
1705 :    
1706 :     The feature-ID as a string.
1707 :    
1708 :     =back
1709 :    
1710 : overbeek 1.4 =cut
1711 :    
1712 : overbeek 1.1 sub fid {
1713 :     my($self) = @_;
1714 :    
1715 :     return $self->{_fid};
1716 :     }
1717 :    
1718 : overbeek 1.4
1719 :    
1720 :     =head3 timestamp
1721 :    
1722 : gdpusch 1.24 =over 4
1723 :    
1724 :     =item FUNCTION:
1725 :    
1726 :     Extract the C<UN*X> timestamp of the annotation.
1727 :    
1728 :     =item USAGE:
1729 :    
1730 :     C<< my $fid = $annotO->timestamp(); >>
1731 :    
1732 :     =item RETURNS;
1733 :    
1734 :     The timestamp as a string.
1735 :    
1736 :     =back
1737 :    
1738 : overbeek 1.4 =cut
1739 :    
1740 : overbeek 1.1 sub timestamp {
1741 :     my($self,$convert) = @_;
1742 :    
1743 :     if ($convert)
1744 :     {
1745 :     return scalar localtime($self->{_timestamp});
1746 :     }
1747 :     else
1748 :     {
1749 :     return $self->{_timestamp};
1750 :     }
1751 :     }
1752 :    
1753 : overbeek 1.4
1754 :    
1755 :     =head3 made_by
1756 :    
1757 : gdpusch 1.24 =over 4
1758 :    
1759 :     =item FUNCTION:
1760 :    
1761 :     Extract the annotator's user-name.
1762 :    
1763 :     =item USAGE:
1764 :    
1765 :     C<< my $fid = $annotO->made_by(); >>
1766 :    
1767 :     =item RETURNS;
1768 :    
1769 :     The username of the annotator, as a string.
1770 :    
1771 :     =back
1772 :    
1773 : overbeek 1.4 =cut
1774 :    
1775 : overbeek 1.1 sub made_by {
1776 :     my($self) = @_;
1777 :    
1778 :     my $who = $self->{_who};
1779 :     $who =~ s/^master://i;
1780 :     return $who;
1781 :     }
1782 :    
1783 : overbeek 1.4
1784 :    
1785 :     =head3 text
1786 :    
1787 : gdpusch 1.24 =over 4
1788 :    
1789 :     =item FUNCTION:
1790 :    
1791 :     Extract the text of the annotation.
1792 :    
1793 :     =item USGAE:
1794 :    
1795 :     C<< my $text = $annotO->text(); >>
1796 :    
1797 :     =item RETURNS:
1798 :    
1799 :     The text of the annotation, as a string.
1800 :    
1801 :     =back
1802 :    
1803 : overbeek 1.4 =cut
1804 :    
1805 : overbeek 1.1 sub text {
1806 :     my($self) = @_;
1807 :    
1808 :     my $text = $self->{_text};
1809 :     return $text;
1810 :     }
1811 :    
1812 : overbeek 1.4
1813 :     =head3 display
1814 :    
1815 : gdpusch 1.24 =over 4
1816 :    
1817 :     =item FUNCTION:
1818 :    
1819 :     Print the contents of an "AnnotationO" object to B<STDOUT>
1820 :     in human-readable form.
1821 :    
1822 :     =item USAGE:
1823 :    
1824 :     C<< my $annotO->display(); >>
1825 :    
1826 :     =item RETURNS:
1827 :    
1828 :     (void)
1829 :    
1830 :     =back
1831 :    
1832 : overbeek 1.4 =cut
1833 :    
1834 : overbeek 1.1 sub display {
1835 :     my($self) = @_;
1836 :    
1837 :     print join("\t",($self->fid,$self->timestamp(1),$self->made_by)),"\n",$self->text,"\n";
1838 :     }
1839 :    
1840 : overbeek 1.4
1841 :    
1842 :     ########################################################################
1843 : overbeek 1.1 package CouplingO;
1844 : overbeek 1.4 ########################################################################
1845 :     use Data::Dumper;
1846 :    
1847 : overbeek 1.13 =head1 CouplingO
1848 :    
1849 : overbeek 1.16 Methods for accessing the "Functional coupling scores"
1850 :     of PEGs in close physical proximity to each other.
1851 :    
1852 : overbeek 1.13 =cut
1853 :    
1854 :    
1855 :    
1856 : overbeek 1.4 =head3 new
1857 : overbeek 1.1
1858 : gdpusch 1.24 =over 4
1859 :    
1860 :     =item FUNCTION:
1861 :    
1862 :     Construct a new "CouplingO" object
1863 :     encapsulating the "functional coupling" score
1864 :     between a pair of features in some genome.
1865 :    
1866 :     =item USAGE:
1867 :    
1868 :     C<< $couplingO = CouplingO->new($figO, $fid1, $fid2, $sc); >>
1869 :    
1870 :     =item C<$figO>
1871 :    
1872 :     Parent "FIGO" object.
1873 :    
1874 :     =item C<$fid1> and C<$fid2>
1875 :    
1876 :     A pair of feature-IDs.
1877 :    
1878 :     =item C<$sc>
1879 :    
1880 :     A functional-coupling score
1881 :    
1882 :     =item RETURNS:
1883 :    
1884 :     A "CouplingO" object.
1885 :    
1886 :     =back
1887 :    
1888 : overbeek 1.4 =cut
1889 : overbeek 1.1
1890 :     sub new {
1891 :     my($class,$figO,$peg1,$peg2,$sc) = @_;
1892 :    
1893 :     ($peg1 =~ /^fig\|\d+\.\d+\.peg\.\d+$/) || return undef;
1894 :     ($peg2 =~ /^fig\|\d+\.\d+\.peg\.\d+$/) || return undef;
1895 :     my $self = {};
1896 :     $self->{_figO} = $figO;
1897 :     $self->{_peg1} = $peg1;
1898 :     $self->{_peg2} = $peg2;
1899 :     $self->{_sc} = $sc;
1900 :     return bless $self, $class;
1901 :     }
1902 :    
1903 : overbeek 1.4
1904 :    
1905 :     =head3 peg1
1906 :    
1907 : gdpusch 1.24 =over 4
1908 :    
1909 :     =item FUNCTION:
1910 :    
1911 :     Returns a "FeatureO" object corresponding to the first FID in a coupled pair.
1912 :    
1913 :     =item USAGE:
1914 :    
1915 :     C<< my $peg1 = $couplingO->peg1(); >>
1916 :    
1917 :     =item RETURNS:
1918 :    
1919 :     A "FeatureO" object.
1920 :    
1921 :     =back
1922 :    
1923 : overbeek 1.4 =cut
1924 :    
1925 : overbeek 1.1 sub peg1 {
1926 :     my($self) = @_;
1927 :    
1928 : overbeek 1.5 my $figO = $self->{_figO};
1929 :     return new FeatureO($figO,$self->{_peg1});
1930 : overbeek 1.1 }
1931 :    
1932 : overbeek 1.4
1933 :    
1934 : gdpusch 1.24 =head3 peg2
1935 :    
1936 :     =over 4
1937 :    
1938 :     =item FUNCTION:
1939 :    
1940 :     Returns a "FeatureO" object corresponding to the second FID in a coupled pair.
1941 :    
1942 :     =item USAGE:
1943 :    
1944 :     C<< my $peg2 = $couplingO->peg2(); >>
1945 :    
1946 :     =item RETURNS:
1947 :    
1948 :     A "FeatureO" object.
1949 :    
1950 :     =back
1951 : overbeek 1.4
1952 :     =cut
1953 :    
1954 : overbeek 1.1 sub peg2 {
1955 :     my($self) = @_;
1956 :    
1957 : overbeek 1.5 my $figO = $self->{_figO};
1958 :     return new FeatureO($figO,$self->{_peg2});
1959 : overbeek 1.1 }
1960 :    
1961 : overbeek 1.4
1962 :    
1963 :     =head3 sc
1964 :    
1965 : gdpusch 1.24 =over 4
1966 :    
1967 :     =item FUNCTION:
1968 :    
1969 :     Extracts the "functional coupling" score from a "CouplingO" object.
1970 :    
1971 :     =item USAGE:
1972 :    
1973 :     C<< my $sc = $couplingO->sc(); >>
1974 :    
1975 :     =item RETURNS:
1976 :    
1977 :     A scalar score.
1978 :    
1979 :     =back
1980 :    
1981 : overbeek 1.4 =cut
1982 :    
1983 : overbeek 1.1 sub sc {
1984 :     my($self) = @_;
1985 :    
1986 :     return $self->{_sc};
1987 :     }
1988 :    
1989 : overbeek 1.4
1990 :    
1991 :     =head3 evidence
1992 :    
1993 : gdpusch 1.24 =over 4
1994 :    
1995 :     =item FUNCTION:
1996 :    
1997 :     Fetch the evidence for a "functional coupling" between two close PEGs,
1998 :     in the form of a list of objects describing the "Pairs of Close Homologs" (PCHs)
1999 :     supporting the existence of a functional coupling between the two close PEGs.
2000 :    
2001 :     =item USAGE:
2002 :    
2003 :     C<< my $evidence = $couplingO->evidence(); >>
2004 :    
2005 :     =item RETURNS
2006 :    
2007 :     List of pairs of "FeatureO" objects.
2008 :    
2009 :     =back
2010 :    
2011 : overbeek 1.4 =cut
2012 :    
2013 : overbeek 1.1 sub evidence {
2014 :     my($self) = @_;
2015 :    
2016 :     my $figO = $self->{_figO};
2017 :     my $fig = $figO->{_fig};
2018 :     my @ev = ();
2019 : overbeek 1.19 foreach my $tuple ($fig->coupling_evidence($self->peg1->id,$self->peg2->id))
2020 : overbeek 1.1 {
2021 :     my($peg3,$peg4,$rep) = @$tuple;
2022 :     push(@ev,[&FeatureO::new('FeatureO',$figO,$peg3),
2023 :     &FeatureO::new('FeatureO',$figO,$peg4),
2024 :     $rep]);
2025 :     }
2026 :     return @ev;
2027 :     }
2028 :    
2029 : overbeek 1.4
2030 :    
2031 :     =head3 display
2032 :    
2033 : gdpusch 1.24 =over 4
2034 :    
2035 :     =item FUNCTION:
2036 :    
2037 :     Print the contents of a "CouplingO" object to B<STDOUT> in human-readable form.
2038 :    
2039 :     =item USAGE:
2040 :    
2041 :     C<< $couplingO->display(); >>
2042 :    
2043 :     =item RETURNS:
2044 :    
2045 :     (Void)
2046 :    
2047 :     =back
2048 :    
2049 : overbeek 1.4 =cut
2050 :    
2051 : overbeek 1.1 sub display {
2052 :     my($self) = @_;
2053 :    
2054 :     print join("\t",($self->peg1,$self->peg2,$self->sc)),"\n";
2055 :     }
2056 :    
2057 : overbeek 1.4
2058 :    
2059 :     ########################################################################
2060 : overbeek 1.1 package SubsystemO;
2061 : overbeek 1.4 ########################################################################
2062 : overbeek 1.1 use Data::Dumper;
2063 :     use Subsystem;
2064 :    
2065 : overbeek 1.4 =head1 SubsystemO
2066 :    
2067 :     =cut
2068 :    
2069 :    
2070 :    
2071 :     =head3 new
2072 :    
2073 :     =cut
2074 :    
2075 : overbeek 1.1 sub new {
2076 :     my($class,$figO,$name) = @_;
2077 :    
2078 :     my $self = {};
2079 :     $self->{_figO} = $figO;
2080 :     $self->{_id} = $name;
2081 :    
2082 :     return bless $self, $class;
2083 :     }
2084 :    
2085 : overbeek 1.4
2086 :    
2087 :     =head3 id
2088 :    
2089 :     =cut
2090 :    
2091 : overbeek 1.1 sub id {
2092 :     my($self) = @_;
2093 :    
2094 :     return $self->{_id};
2095 :     }
2096 :    
2097 : overbeek 1.4
2098 :    
2099 :     =head3 usable
2100 :    
2101 : overbeek 1.16
2102 : overbeek 1.4 =cut
2103 :    
2104 : overbeek 1.1 sub usable {
2105 :     my($self) = @_;
2106 :    
2107 :     my $figO = $self->{_figO};
2108 :     my $fig = $figO->{_fig};
2109 :     return $fig->usable_subsystem($self->id);
2110 :     }
2111 :    
2112 : overbeek 1.4
2113 :    
2114 :     =head3 genomes
2115 :    
2116 :     =cut
2117 :    
2118 : overbeek 1.1 sub genomes {
2119 :     my($self) = @_;
2120 :    
2121 :     my $figO = $self->{_figO};
2122 :     my $subO = $self->{_subO};
2123 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2124 :    
2125 :     return map { &GenomeO::new('GenomeO',$figO,$_) } $subO->get_genomes;
2126 :     }
2127 :    
2128 : overbeek 1.9
2129 :    
2130 : overbeek 1.4 =head3 roles
2131 :    
2132 :     =cut
2133 :    
2134 : overbeek 1.1 sub roles {
2135 :     my($self) = @_;
2136 :    
2137 :     my $figO = $self->{_figO};
2138 :     my $subO = $self->{_subO};
2139 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2140 : overbeek 1.9
2141 : overbeek 1.1 return map { &FunctionalRoleO::new('FunctionalRoleO',$figO,$_) } $subO->get_roles($self->id);
2142 :     }
2143 :    
2144 : overbeek 1.9
2145 :    
2146 : overbeek 1.4 =head3 curator
2147 :    
2148 :     =cut
2149 :    
2150 : overbeek 1.1 sub curator {
2151 :     my($self) = @_;
2152 :    
2153 :     my $figO = $self->{_figO};
2154 :     my $subO = $self->{_subO};
2155 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2156 : overbeek 1.9
2157 :     return $subO->get_curator;
2158 : overbeek 1.1 }
2159 :    
2160 : overbeek 1.4
2161 :    
2162 :    
2163 :     =head3 variant
2164 :    
2165 :     =cut
2166 :    
2167 : overbeek 1.1 sub variant {
2168 :     my($self,$genome) = @_;
2169 :    
2170 :     my $figO = $self->{_figO};
2171 :     my $subO = $self->{_subO};
2172 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2173 :    
2174 :     return $subO->get_variant_code_for_genome($genome->id);
2175 :     }
2176 : overbeek 1.4
2177 :    
2178 :    
2179 :     =head3 pegs_in_cell
2180 :    
2181 :     =cut
2182 :    
2183 : overbeek 1.1 sub pegs_in_cell {
2184 :     my($self,$genome,$role) = @_;
2185 :    
2186 :     my $figO = $self->{_figO};
2187 :     my $subO = $self->{_subO};
2188 :     if (! $subO) { $subO = $self->{_subO} = new Subsystem($self->{_id},$figO->{_fig}); }
2189 :    
2190 :     return $subO->get_pegs_from_cell($genome->id,$role->id);
2191 :     }
2192 :    
2193 : overbeek 1.4
2194 :    
2195 :     ########################################################################
2196 : overbeek 1.1 package FunctionalRoleO;
2197 : overbeek 1.4 ########################################################################
2198 :     use Data::Dumper;
2199 : overbeek 1.1
2200 : overbeek 1.4 =head1 FunctionalRoleO
2201 :    
2202 : overbeek 1.9 Methods for accessing the functional roles of features.
2203 :    
2204 : overbeek 1.4 =cut
2205 :    
2206 :    
2207 :     =head3 new
2208 :    
2209 :     =cut
2210 : overbeek 1.1
2211 :     sub new {
2212 :     my($class,$figO,$fr) = @_;
2213 :    
2214 :     my $self = {};
2215 :     $self->{_figO} = $figO;
2216 :     $self->{_id} = $fr;
2217 :     return bless $self, $class;
2218 :     }
2219 :    
2220 : overbeek 1.4
2221 :    
2222 :     =head3 id
2223 :    
2224 :     =cut
2225 :    
2226 : overbeek 1.1 sub id {
2227 :     my($self) = @_;
2228 :    
2229 :     return $self->{_id};
2230 :     }
2231 :    
2232 : overbeek 1.4
2233 :    
2234 :     ########################################################################
2235 : overbeek 1.1 package FigFamO;
2236 : overbeek 1.4 ########################################################################
2237 : overbeek 1.1 use FigFams;
2238 :     use FigFam;
2239 :    
2240 : overbeek 1.4
2241 :     =head1 FigFamO
2242 :    
2243 :     =cut
2244 :    
2245 :    
2246 :     =head3 new
2247 :    
2248 :     =cut
2249 :    
2250 : overbeek 1.1 sub new {
2251 :     my($class,$figO,$id) = @_;
2252 :    
2253 :     my $self = {};
2254 :     $self->{_figO} = $figO;
2255 :     $self->{_id} = $id;
2256 :     return bless $self, $class;
2257 :     }
2258 :    
2259 : overbeek 1.4
2260 :    
2261 :     =head3 id
2262 :    
2263 :     =cut
2264 :    
2265 : overbeek 1.1 sub id {
2266 :     my($self) = @_;
2267 :    
2268 :     return $self->{_id};
2269 :     }
2270 :    
2271 : overbeek 1.4
2272 :     =head3 function
2273 :    
2274 :     =cut
2275 :    
2276 : overbeek 1.1 sub function {
2277 :     my($self) = @_;
2278 :    
2279 :     my $fig = $self->{_figO}->{_fig};
2280 :     my $famO = $self->{_famO};
2281 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2282 :    
2283 :     return $famO->family_function;
2284 :     }
2285 :    
2286 : overbeek 1.4
2287 :    
2288 :     =head3 members
2289 :    
2290 :     =cut
2291 :    
2292 : overbeek 1.1 sub members {
2293 :     my($self) = @_;
2294 :    
2295 :     my $figO = $self->{_figO};
2296 :     my $fig = $figO->{_fig};
2297 :     my $famO = $self->{_famO};
2298 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2299 :    
2300 : overbeek 1.18 return map { &FeatureO::new('FeatureO',$figO,$_) } $famO->list_members;
2301 : overbeek 1.1 }
2302 :    
2303 : overbeek 1.4 =head3 rep_seqs
2304 :    
2305 :     =cut
2306 :    
2307 : overbeek 1.1 sub rep_seqs {
2308 :     my($self) = @_;
2309 :    
2310 :     my $figO = $self->{_figO};
2311 :     my $fig = $figO->{_fig};
2312 :     my $famO = $self->{_famO};
2313 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2314 :    
2315 :     return $famO->representatives;
2316 :     }
2317 :    
2318 : overbeek 1.4
2319 :    
2320 :     =head3 should_be_member
2321 :    
2322 :     =cut
2323 :    
2324 : overbeek 1.1 sub should_be_member {
2325 :     my($self,$seq) = @_;
2326 :    
2327 :     my $figO = $self->{_figO};
2328 :     my $fig = $figO->{_fig};
2329 :     my $famO = $self->{_famO};
2330 :     if (! $famO) { $famO = $self->{_famO} = &FigFam::new('FigFam',$fig,$self->id) }
2331 :    
2332 :     return $famO->should_be_member($seq);
2333 :     }
2334 :    
2335 :    
2336 :    
2337 : overbeek 1.4 =head3 display
2338 :    
2339 :     =cut
2340 :    
2341 : overbeek 1.1 sub display {
2342 :     my($self) = @_;
2343 :    
2344 :     print join("\t",($self->id,$self->function)),"\n";
2345 :     }
2346 :    
2347 :    
2348 :    
2349 : overbeek 1.4 ########################################################################
2350 : overbeek 1.1 package Attribute;
2351 : overbeek 1.4 ########################################################################
2352 :     =head1 Attribute
2353 :    
2354 : overbeek 1.9 (Note yet implemented.)
2355 :    
2356 : overbeek 1.4 =cut
2357 : overbeek 1.1
2358 :     1;
2359 : overbeek 1.4 __END__
2360 :    
2361 :     =head1 Examples
2362 :    
2363 :     =head3 Display all complete, prokaryotic genomes
2364 :    
2365 :     use FIGO;
2366 :     my $figO = new FIGO;
2367 :    
2368 :     foreach $genome ($figO->genomes('complete','prokaryotic'))
2369 :     {
2370 :     $genome->display;
2371 :     }
2372 :    
2373 :     #---------------------------------------------
2374 :    
2375 :     use FIG;
2376 :     my $fig = new FIG;
2377 :    
2378 :     foreach $genome (grep { $fig->is_prokaryotic($_) } $fig->genomes('complete'))
2379 :     {
2380 :     print join("\t",("Genome",$genome,$fig->genus_species($genome))),"\n";
2381 :     }
2382 :    
2383 :     ###############################################
2384 :    
2385 :     =head3 Show how to access contigs and extract sequence
2386 :    
2387 :     use FIGO;
2388 :     my $figO = new FIGO;
2389 :    
2390 :     $genomeId = '83333.1';
2391 :     my $genome = new GenomeO($figO,$genomeId);
2392 :    
2393 :     foreach $contig ($genome->contigs_of)
2394 :     {
2395 :     $tag1 = $contig->dna_seq(1,10);
2396 :     $tag2 = $contig->dna_seq(10,1);
2397 :     print join("\t",($tag1,$tag2,$contig->id,$contig->contig_length)),"\n";
2398 :     }
2399 :    
2400 :     #---------------------------------------------
2401 :    
2402 :     use FIG;
2403 :     my $fig = new FIG;
2404 :    
2405 :     $genomeId = '83333.1';
2406 :    
2407 :     $contig_lengths = $fig->contig_lengths($genomeId);
2408 :    
2409 :     foreach $contig ($fig->contigs_of($genomeId))
2410 :     {
2411 :     $tag1 = $fig->dna_seq($genomeId,join("_",($contig,1,10)));
2412 :     $tag2 = $fig->dna_seq($genomeId,join("_",($contig,10,1)));
2413 :     print join("\t",($tag1,$tag2,$contig,$contig_lengths->{$contig})),"\n";
2414 :     }
2415 :    
2416 :     ###############################################
2417 :    
2418 :     ### accessing data related to features
2419 :    
2420 :     use FIGO;
2421 :     my $figO = new FIGO;
2422 :    
2423 :     my $genome = new GenomeO($figO,"83333.1");
2424 :     my $peg = "fig|83333.1.peg.4";
2425 :     my $pegO = new FeatureO($figO,$peg);
2426 :    
2427 :     print join("\t",$pegO->id,$pegO->location,$pegO->function_of),"\n",
2428 :     $pegO->dna_seq,"\n",
2429 :     $pegO->prot_seq,"\n";
2430 :    
2431 :     foreach $fidO ($genome->features_of('rna'))
2432 :     {
2433 :     print join("\t",$fidO->id,$fidO->location,$fidO->function_of),"\n";
2434 :     }
2435 :    
2436 :     #---------------------------------------------
2437 :    
2438 :    
2439 :     use FIG;
2440 :     my $fig = new FIG;
2441 :    
2442 :     my $genome = "83333.1";
2443 :     my $peg = "fig|83333.1.peg.4";
2444 :    
2445 :     print join("\t",$peg,scalar $fig->feature_location($peg),scalar $fig->function_of($peg)),"\n",
2446 :     $fig->dna_seq($genome,$fig->feature_location($peg)),"\n",
2447 :     $fig->get_translation($peg),"\n";
2448 :    
2449 :     foreach $fid ($fig->all_features($genome,'rna'))
2450 :     {
2451 :     print join("\t",$fid,scalar $fig->feature_location($fid),scalar $fig->function_of($fid)),"\n";
2452 :     }
2453 :    
2454 :     ###############################################
2455 :    
2456 :     ### accessing similarities
2457 :    
2458 :     use FIGO;
2459 :     my $figO = new FIGO;
2460 :    
2461 :     $peg = "fig|83333.1.peg.4";
2462 :     $pegO = new FeatureO($figO,$peg);
2463 :    
2464 :     @sims = $pegO->sims; # use sims( -all => 1, -max => 10000, -cutoff => 1.0e-20) to all
2465 :     # sims (including non-FIG sequences
2466 :     foreach $sim (@sims)
2467 :     {
2468 :     $peg2 = $sim->id2;
2469 :     $pegO2 = new FeatureO($figO,$peg2);
2470 :     $func = $pegO2->function_of;
2471 :     $sc = $sim->psc;
2472 :     print join("\t",($peg2,$sc,$func)),"\n";
2473 :     }
2474 :    
2475 :     #---------------------------------------------
2476 :    
2477 :    
2478 :     use FIG;
2479 :     my $fig = new FIG;
2480 :    
2481 :     $peg = "fig|83333.1.peg.4";
2482 :    
2483 :     @sims = $fig->sims($peg,1000,1.0e-5,"fig");
2484 :     foreach $sim (@sims)
2485 :     {
2486 :     $peg2 = $sim->id2;
2487 :     $func = $fig->function_of($peg2);
2488 :     $sc = $sim->psc;
2489 :     print join("\t",($peg2,$sc,$func)),"\n";
2490 :     }
2491 :    
2492 :     ###############################################
2493 :    
2494 :     ### accessing BBHs
2495 :    
2496 :     use FIGO;
2497 :     my $figO = new FIGO;
2498 :    
2499 :     $peg = "fig|83333.1.peg.4";
2500 :     $pegO = new FeatureO($figO,$peg);
2501 :    
2502 :     @bbhs = $pegO->bbhs;
2503 :     foreach $bbh (@bbhs)
2504 :     {
2505 :     $peg2 = $bbh->peg2;
2506 :     $pegO2 = new FeatureO($figO,$peg2);
2507 :     $func = $pegO2->function_of;
2508 :     $sc = $bbh->psc;
2509 :     print join("\t",($peg2,$sc,$func)),"\n";
2510 :     }
2511 :    
2512 :     #---------------------------------------------
2513 :    
2514 :     use FIG;
2515 :     my $fig = new FIG;
2516 :    
2517 :     $peg = "fig|83333.1.peg.4";
2518 :    
2519 :     @bbhs = $fig->bbhs($peg);
2520 :     foreach $bbh (@bbhs)
2521 :     {
2522 :     ($peg2,$sc,$bit_score) = @$bbh;
2523 :     $func = $fig->function_of($peg2);
2524 :     print join("\t",($peg2,$sc,$func)),"\n";
2525 :     }
2526 :    
2527 :     ###############################################
2528 :    
2529 :     ### accessing annotations
2530 :    
2531 :     use FIGO;
2532 :     my $figO = new FIGO;
2533 :    
2534 :     $peg = "fig|83333.1.peg.4";
2535 :     $pegO = new FeatureO($figO,$peg);
2536 :    
2537 :     @annotations = $pegO->annotations;
2538 :    
2539 :     foreach $ann (@annotations)
2540 :     {
2541 :     print join("\n",$ann->fid,$ann->timestamp(1),$ann->made_by,$ann->text),"\n\n";
2542 :     }
2543 :    
2544 :     #---------------------------------------------
2545 :    
2546 :     use FIG;
2547 :     my $fig = new FIG;
2548 :    
2549 :     $peg = "fig|83333.1.peg.4";
2550 :     @annotations = $fig->feature_annotations($peg);
2551 :     foreach $_ (@annotations)
2552 :     {
2553 :     (undef,$ts,$who,$text) = @$_;
2554 :     $who =~ s/master://i;
2555 :     print "$ts\n$who\n$text\n\n";
2556 :     }
2557 :    
2558 :     ###############################################
2559 :    
2560 :     ### accessing coupling data
2561 :    
2562 :    
2563 :     use FIGO;
2564 :     my $figO = new FIGO;
2565 :    
2566 :     my $peg = "fig|83333.1.peg.4";
2567 :     my $pegO = new FeatureO($figO,$peg);
2568 :     foreach $coupled ($pegO->coupled_to)
2569 :     {
2570 :     print join("\t",($coupled->peg1,$coupled->peg2,$coupled->sc)),"\n";
2571 :     foreach $tuple ($coupled->evidence)
2572 :     {
2573 :     my($peg3O,$peg4O,$rep) = @$tuple;
2574 :     print "\t",join("\t",($peg3O->id,$peg4O->id,$rep)),"\n";
2575 :     }
2576 :     print "\n";
2577 :     }
2578 :    
2579 :     #---------------------------------------------
2580 :    
2581 :    
2582 :     use FIG;
2583 :     my $fig = new FIG;
2584 :    
2585 :     my $peg1 = "fig|83333.1.peg.4";
2586 :     foreach $coupled ($fig->coupled_to($peg1))
2587 :     {
2588 :     ($peg2,$sc) = @$coupled;
2589 :     print join("\t",($peg1,$peg2,$sc)),"\n";
2590 :     foreach $tuple ($fig->coupling_evidence($peg1,$peg2))
2591 :     {
2592 :     my($peg3,$peg4,$rep) = @$tuple;
2593 :     print "\t",join("\t",($peg3,$peg4,$rep)),"\n";
2594 :     }
2595 :     print "\n";
2596 :     }
2597 :    
2598 :     ###############################################
2599 :    
2600 :     =head3 Accessing Subsystem data
2601 :    
2602 :     use FIGO;
2603 :     my $figO = new FIGO;
2604 :    
2605 :     foreach $sub ($figO->subsystems)
2606 :     {
2607 :     if ($sub->usable)
2608 :     {
2609 :     print join("\t",($sub->id,$sub->curator)),"\n";
2610 :    
2611 :     print "\tRoles\n";
2612 :     @roles = $sub->roles;
2613 :     foreach $role (@roles)
2614 :     {
2615 :     print "\t\t",join("\t",($role->id)),"\n";
2616 :     }
2617 :    
2618 :     print "\tGenomes\n";
2619 :     foreach $genome ($sub->genomes)
2620 :     {
2621 :     print "\t\t",join("\t",($sub->variant($genome),
2622 :     $genome->id,
2623 :     $genome->genus_species)),"\n";
2624 :     @pegs = ();
2625 :     foreach $role (@roles)
2626 :     {
2627 :     push(@pegs,$sub->pegs_in_cell($genome,$role));
2628 :     }
2629 :     print "\t\t\t",join(",",@pegs),"\n";
2630 :     }
2631 :     }
2632 :     }
2633 :    
2634 :     #---------------------------------------------
2635 :    
2636 :     use FIG;
2637 :     my $fig = new FIG;
2638 :    
2639 :     foreach $sub (grep { $fig->usable_subsystem($_) } $fig->all_subsystems)
2640 :     {
2641 :     $subO = new Subsystem($sub,$fig);
2642 :     $curator = $subO->get_curator;
2643 :     print join("\t",($sub,$curator)),"\n";
2644 :    
2645 :     print "\tRoles\n";
2646 :     @roles = $subO->get_roles;
2647 :     foreach $role (@roles)
2648 :     {
2649 :     print "\t\t",join("\t",($role)),"\n";
2650 :     }
2651 :    
2652 :     print "\tGenomes\n";
2653 :     foreach $genome ($subO->get_genomes)
2654 :     {
2655 :     print "\t\t",join("\t",($subO->get_variant_code_for_genome($genome),
2656 :     $genome,
2657 :     $fig->genus_species($genome))),"\n";
2658 :     foreach $role (@roles)
2659 :     {
2660 :     push(@pegs,$subO->get_pegs_from_cell($genome,$role));
2661 :     }
2662 :     print "\t\t\t",join(",",@pegs),"\n";
2663 :     }
2664 :     print "\n";
2665 :     }
2666 :    
2667 :     ###############################################
2668 :    
2669 :     =head3 Accessing FIGfams
2670 :    
2671 :     use FIGO;
2672 :     my $figO = new FIGO;
2673 :    
2674 :     foreach $fam ($figO->all_figfams)
2675 :     {
2676 :     print join("\t",($fam->id,$fam->function)),"\n";
2677 :     foreach $pegO ($fam->members)
2678 :     {
2679 :     $peg = $pegO->id;
2680 :     print "\t$peg\n";
2681 :     }
2682 :     }
2683 :    
2684 :     #---------------------------------------------
2685 :    
2686 :     use FIG;
2687 :     use FigFam;
2688 :     use FigFams;
2689 :    
2690 :     my $fig = new FIG;
2691 :     my $figfams = new FigFams($fig);
2692 :    
2693 :     foreach $fam ($figfams->all_families)
2694 :     {
2695 :     my $figfam = new FigFam($fig,$fam);
2696 :     print join("\t",($fam,$figfam->family_function)),"\n";
2697 :     foreach $peg ($figfam->list_members)
2698 :     {
2699 :     print "\t$peg\n";
2700 :     }
2701 :     }
2702 :    
2703 :     ###############################################
2704 :    
2705 :     =head3 Placing a sequence into a FIGfam
2706 :    
2707 :     use FIGO;
2708 :     my $figO = new FIGO;
2709 :    
2710 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2711 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2712 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2713 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2714 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2715 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2716 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2717 :     RKLMMNHQ";
2718 :     $seq =~ s/\n//gs;
2719 :    
2720 :     my($fam,$sims) = $figO->family_containing($seq);
2721 :    
2722 :     if ($fam)
2723 :     {
2724 :     print join("\t",($fam->id,$fam->function)),"\n";
2725 :     print &Dumper($sims);
2726 :     }
2727 :     else
2728 :     {
2729 :     print "Could not place it in a family\n";
2730 :     }
2731 :    
2732 :     #---------------------------------------------
2733 :    
2734 :     use FIG;
2735 :     use FigFam;
2736 :     use FigFams;
2737 :    
2738 :     my $fig = new FIG;
2739 :     my $figfams = new FigFams($fig);
2740 :    
2741 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2742 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2743 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2744 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2745 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2746 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2747 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2748 :     RKLMMNHQ";
2749 :     $seq =~ s/\n//gs;
2750 :    
2751 :     my($fam,$sims) = $figfams->place_in_family($seq);
2752 :    
2753 :     if ($fam)
2754 :     {
2755 :     print join("\t",($fam->family_id,$fam->family_function)),"\n";
2756 :     print &Dumper($sims);
2757 :     }
2758 :     else
2759 :     {
2760 :     print "Could not place it in a family\n";
2761 :     }
2762 :    
2763 :     ###############################################
2764 :    
2765 :     =head3 Getting representative sequences for a FIGfam
2766 :    
2767 :     use FIGO;
2768 :     my $figO = new FIGO;
2769 :    
2770 :     $fam = "FIG102446";
2771 :     my $famO = &FigFamO::new('FigFamO',$figO,$fam);
2772 :     my @rep_seqs = $famO->rep_seqs;
2773 :    
2774 :     foreach $seq (@rep_seqs)
2775 :     {
2776 :     print ">query\n$seq\n";
2777 :     }
2778 :    
2779 :     #---------------------------------------------
2780 :    
2781 :     use FIG;
2782 :     use FigFam;
2783 :     use FigFams;
2784 :    
2785 :     my $fig = new FIG;
2786 :    
2787 :     $fam = "FIG102446";
2788 :     my $famO = new FigFam($fig,$fam);
2789 :     my @rep_seqs = $famO->representatives;
2790 :    
2791 :     foreach $seq (@rep_seqs)
2792 :     {
2793 :     print ">query\n$seq\n";
2794 :     }
2795 :    
2796 :    
2797 :     ###############################################
2798 :    
2799 :    
2800 :     =head3 Testing for membership in FIGfam
2801 :    
2802 :     use FIGO;
2803 :     my $figO = new FIGO;
2804 :    
2805 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2806 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2807 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2808 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2809 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2810 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2811 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2812 :     RKLMMNHQ";
2813 :     $seq =~ s/\n//gs;
2814 :    
2815 :     $fam = "FIG102446";
2816 :     my $famO = &FigFamO::new('FigFamO',$figO,$fam);
2817 :     my($should_be, $sims) = $famO->should_be_member($seq);
2818 :    
2819 :     if ($should_be)
2820 :     {
2821 :     print join("\t",($famO->id,$famO->function)),"\n";
2822 :     print &Dumper($sims);
2823 :     }
2824 :     else
2825 :     {
2826 :     print "Sequence should not be added to family\n";
2827 :     }
2828 :    
2829 :     #---------------------------------------------
2830 :    
2831 :     use FIG;
2832 :     use FigFam;
2833 :     use FigFams;
2834 :    
2835 :     my $fig = new FIG;
2836 :    
2837 :     $seq = "MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
2838 :     AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
2839 :     IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
2840 :     AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETRNQ
2841 :     LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
2842 :     MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
2843 :     LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
2844 :     RKLMMNHQ";
2845 :     $seq =~ s/\n//gs;
2846 :    
2847 :     $fam = "FIG102446";
2848 :     my $famO = new FigFam($fig,$fam);
2849 :     my($should_be, $sims) = $famO->should_be_member($seq);
2850 :    
2851 :     if ($should_be)
2852 :     {
2853 :     print join("\t",($famO->family_id,$famO->family_function)),"\n";
2854 :     print &Dumper($sims);
2855 :     }
2856 :     else
2857 :     {
2858 :     print "Sequence should not be added to family\n";
2859 :     }
2860 :    
2861 :     =cut
2862 :    

MCS Webmaster
ViewVC Help
Powered by ViewVC 1.0.3